BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8785

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004250945.1|  PREDICTED: dicarboxylate transporter 1, chlo...    219   1e-63   Solanum lycopersicum
ref|XP_006361749.1|  PREDICTED: dicarboxylate transporter 1, chlo...    218   3e-63   Solanum tuberosum [potatoes]
ref|XP_009609674.1|  PREDICTED: dicarboxylate transporter 1, chlo...    214   6e-62   Nicotiana tomentosiformis
ref|XP_009777235.1|  PREDICTED: dicarboxylate transporter 1, chlo...    214   1e-61   Nicotiana sylvestris
ref|XP_007015047.1|  Dicarboxylate transporter 1 isoform 3              199   9e-58   
ref|XP_011080429.1|  PREDICTED: dicarboxylate transporter 1, chlo...    201   1e-57   Sesamum indicum [beniseed]
ref|XP_010102341.1|  2-oxoglutarate/malate translocator                 202   4e-57   Morus notabilis
ref|XP_002313335.2|  hypothetical protein POPTR_0009s05850g             194   7e-57   
gb|EYU46260.1|  hypothetical protein MIMGU_mgv1a003794mg                201   8e-57   Erythranthe guttata [common monkey flower]
gb|EYU31365.1|  hypothetical protein MIMGU_mgv1a003738mg                201   1e-56   Erythranthe guttata [common monkey flower]
gb|EPS73843.1|  hypothetical protein M569_00906                         198   1e-56   Genlisea aurea
ref|XP_002282809.1|  PREDICTED: dicarboxylate transporter 1, chlo...    199   3e-56   Vitis vinifera
ref|XP_007015045.1|  Dicarboxylate transporter 1 isoform 1              199   5e-56   
ref|XP_004142115.1|  PREDICTED: dicarboxylate transporter 1, chlo...    199   6e-56   Cucumis sativus [cucumbers]
ref|XP_011625484.1|  PREDICTED: dicarboxylate transporter 1, chlo...    198   7e-56   Amborella trichopoda
ref|XP_010031793.1|  PREDICTED: dicarboxylate transporter 1, chlo...    198   1e-55   
gb|KJB35803.1|  hypothetical protein B456_006G129000                    198   1e-55   Gossypium raimondii
ref|XP_007211882.1|  hypothetical protein PRUPE_ppa003549mg             198   1e-55   Prunus persica
ref|XP_008449718.1|  PREDICTED: dicarboxylate transporter 1, chlo...    198   1e-55   Cucumis melo [Oriental melon]
ref|NP_568283.2|  dicarboxylate transporter 1                           198   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010257247.1|  PREDICTED: dicarboxylate transporter 1, chlo...    198   1e-55   Nelumbo nucifera [Indian lotus]
ref|NP_001119216.1|  dicarboxylate transporter 1                        198   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227299.1|  PREDICTED: dicarboxylate transporter 1, chlo...    198   1e-55   Prunus mume [ume]
gb|KHG21220.1|  2-oxoglutarate/malate translocator, chloroplastic       197   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010536081.1|  PREDICTED: dicarboxylate transporter 1, chlo...    197   2e-55   
ref|XP_009375074.1|  PREDICTED: dicarboxylate transporter 1, chlo...    198   2e-55   
ref|XP_006399771.1|  hypothetical protein EUTSA_v10013154mg             197   3e-55   Eutrema salsugineum [saltwater cress]
ref|XP_004291789.1|  PREDICTED: dicarboxylate transporter 1, chlo...    197   3e-55   Fragaria vesca subsp. vesca
ref|XP_012089998.1|  PREDICTED: dicarboxylate transporter 1, chlo...    197   4e-55   Jatropha curcas
ref|XP_008363620.1|  PREDICTED: dicarboxylate transporter 1, chlo...    197   4e-55   
sp|Q41364.1|DIT1_SPIOL  RecName: Full=Dicarboxylate transporter 1...    196   5e-55   Spinacia oleracea
ref|XP_009343722.1|  PREDICTED: dicarboxylate transporter 1, chlo...    196   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_008344435.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    193   7e-55   
ref|XP_009411283.1|  PREDICTED: dicarboxylate transporter 1, chlo...    196   8e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK25523.1|  hypothetical protein AALP_AA8G126300                    195   9e-55   Arabis alpina [alpine rockcress]
ref|XP_007015046.1|  Dicarboxylate transporter 1 isoform 2              193   1e-54   
ref|XP_009394734.1|  PREDICTED: dicarboxylate transporter 1, chlo...    195   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287403.1|  hypothetical protein CARUB_v10000609mg             195   1e-54   Capsella rubella
ref|XP_010419844.1|  PREDICTED: dicarboxylate transporter 1, chlo...    195   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010453335.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010492022.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002873582.1|  hypothetical protein ARALYDRAFT_909232             194   2e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_009348953.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_011025529.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   3e-54   Populus euphratica
emb|CDY53969.1|  BnaA10g30010D                                          194   3e-54   Brassica napus [oilseed rape]
ref|XP_008801951.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   3e-54   Phoenix dactylifera
ref|XP_009121830.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   3e-54   Brassica rapa
ref|XP_009366121.1|  PREDICTED: dicarboxylate transporter 1, chlo...    194   3e-54   
emb|CDX97208.1|  BnaC09g44170D                                          194   4e-54   
ref|XP_002513507.1|  2-oxoglutarate/malate translocator, chloropl...    194   4e-54   Ricinus communis
dbj|BAK00367.1|  predicted protein                                      193   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006446115.1|  hypothetical protein CICLE_v10014769mg             193   7e-54   Citrus clementina [clementine]
emb|CDP12268.1|  unnamed protein product                                193   7e-54   Coffea canephora [robusta coffee]
ref|XP_011045437.1|  PREDICTED: dicarboxylate transporter 1, chlo...    192   2e-53   Populus euphratica
ref|XP_010453336.1|  PREDICTED: dicarboxylate transporter 1, chlo...    190   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_011006198.1|  PREDICTED: dicarboxylate transporter 1, chlo...    190   1e-52   Populus euphratica
ref|XP_002299910.2|  hypothetical protein POPTR_0001s26580g             189   2e-52   Populus trichocarpa [western balsam poplar]
gb|ABK24751.1|  unknown                                                 190   2e-52   Picea sitchensis
ref|XP_010931014.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    188   4e-52   
ref|XP_007132020.1|  hypothetical protein PHAVU_011G059900g             188   6e-52   Phaseolus vulgaris [French bean]
ref|XP_004507091.1|  PREDICTED: dicarboxylate transporter 1, chlo...    187   1e-51   Cicer arietinum [garbanzo]
ref|NP_001066885.1|  Os12g0515400                                       186   2e-51   
emb|CAX65044.1|  plastidic 2-oxoglutarate/malate translocator           185   3e-51   Pisum sativum [garden pea]
ref|XP_003537966.1|  PREDICTED: dicarboxylate transporter 1, chlo...    186   3e-51   Glycine max [soybeans]
ref|XP_002442229.1|  hypothetical protein SORBIDRAFT_08g016630          186   3e-51   Sorghum bicolor [broomcorn]
ref|XP_003539493.1|  PREDICTED: dicarboxylate transporter 1, chlo...    186   4e-51   Glycine max [soybeans]
ref|XP_010673637.1|  PREDICTED: dicarboxylate transporter 1, chlo...    185   6e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001105570.1|  LOC542560                                          185   1e-50   Zea mays [maize]
gb|KEH30210.1|  2-oxoglutarate/malate translocator                      184   2e-50   Medicago truncatula
ref|XP_003575954.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    181   3e-49   
ref|XP_004964101.1|  PREDICTED: dicarboxylate transporter 1, chlo...    172   3e-46   
emb|CAN74406.1|  hypothetical protein VITISV_043636                     143   5e-37   Vitis vinifera
ref|XP_001700410.1|  oxoglutarate:malate antiporter                     139   2e-34   Chlamydomonas reinhardtii
ref|XP_001700411.1|  chloroplast oxoglutarate-malate translocator       139   2e-34   Chlamydomonas reinhardtii
ref|XP_002955862.1|  hypothetical protein VOLCADRAFT_106989             139   2e-34   Volvox carteri f. nagariensis
dbj|BAD91178.1|  putative plastidic 2-oxoglutarate/malate translo...    132   3e-32   Mesembryanthemum crystallinum
ref|XP_005843613.1|  hypothetical protein CHLNCDRAFT_140201             130   2e-31   Chlorella variabilis
ref|XP_002507903.1|  divalent Anion:Na+ symporter family                127   4e-30   Micromonas commoda
gb|EYU18451.1|  hypothetical protein MIMGU_mgv1a003725mg                126   7e-30   Erythranthe guttata [common monkey flower]
ref|XP_005650106.1|  oxoglutarate:malate antiporter                     125   1e-29   Coccomyxa subellipsoidea C-169
gb|AFK44505.1|  unknown                                                 121   4e-29   Medicago truncatula
ref|XP_003078785.1|  2-oxoglutarate/malate translocator (ISS)           124   4e-29   Ostreococcus tauri
ref|XP_011087921.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    124   4e-29   Sesamum indicum [beniseed]
ref|XP_009774993.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    124   4e-29   Nicotiana sylvestris
ref|XP_007512423.1|  2-oxoglutarate/malate translocator                 124   5e-29   Bathycoccus prasinos
ref|XP_009624586.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    124   5e-29   Nicotiana tomentosiformis
ref|NP_201234.1|  dicarboxylate transport 2.1                           124   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866607.1|  DCT/DIT2.1                                         124   6e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_006351757.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    124   7e-29   Solanum tuberosum [potatoes]
ref|XP_010315125.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    124   8e-29   Solanum lycopersicum
emb|CDY18717.1|  BnaA09g06780D                                          123   9e-29   Brassica napus [oilseed rape]
gb|EEE53308.1|  hypothetical protein OsJ_36283                          122   9e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009112126.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    123   1e-28   Brassica rapa
ref|XP_010520862.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    123   1e-28   Tarenaya hassleriana [spider flower]
ref|WP_038563803.1|  2-oxoglutarate translocator                        122   1e-28   Terribacillus goriensis
gb|ABO87605.1|  chloroplast glutamate/malate translocator               122   2e-28   Pisum sativum [garden pea]
ref|XP_010546344.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    122   2e-28   Tarenaya hassleriana [spider flower]
gb|EPS71302.1|  glutamate/malate translocator                           122   2e-28   Genlisea aurea
gb|KFK28120.1|  hypothetical protein AALP_AA8G475200                    122   2e-28   Arabis alpina [alpine rockcress]
ref|XP_007148387.1|  hypothetical protein PHAVU_006G204300g             122   2e-28   Phaseolus vulgaris [French bean]
gb|EYU39124.1|  hypothetical protein MIMGU_mgv1a003844mg                122   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_010461628.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010484204.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    122   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002323748.1|  putative oxoglutarate-malate-translocase fam...    121   6e-28   Populus trichocarpa [western balsam poplar]
emb|CDY43805.1|  BnaA06g23410D                                          120   7e-28   Brassica napus [oilseed rape]
ref|XP_010444361.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    120   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004485598.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    120   8e-28   Cicer arietinum [garbanzo]
ref|XP_006280257.1|  hypothetical protein CARUB_v10026173mg             120   9e-28   Capsella rubella
ref|XP_011397588.1|  Dicarboxylate transporter 1, chloroplastic         120   9e-28   Auxenochlorella protothecoides
emb|CDX81219.1|  BnaC09g06300D                                          120   9e-28   
ref|XP_003593234.1|  2-oxoglutarate/malate translocator                 120   1e-27   Medicago truncatula
ref|XP_006394170.1|  hypothetical protein EUTSA_v10003922mg             120   1e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010108404.1|  2-oxoglutarate/malate translocator                 120   1e-27   Morus notabilis
ref|XP_010272978.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010266911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    120   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_008346519.1|  PREDICTED: dicarboxylate transporter 2, chlo...    117   1e-27   
ref|XP_009150500.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    120   2e-27   Brassica rapa
ref|XP_003547089.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    119   3e-27   Glycine max [soybeans]
ref|XP_009381488.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    118   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84512.1|  BnaC03g49880D                                          119   4e-27   
ref|WP_018664356.1|  hypothetical protein                               113   5e-27   
ref|XP_009381487.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    118   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381486.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    118   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011043103.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    118   7e-27   Populus euphratica
ref|XP_003057697.1|  divalent Anion:Na+ symporter family                117   7e-27   Micromonas pusilla CCMP1545
emb|CDO97413.1|  unnamed protein product                                118   8e-27   Coffea canephora [robusta coffee]
ref|WP_025752426.1|  2-oxoglutarate translocator                        116   1e-26   Bacillus
ref|WP_019392157.1|  MULTISPECIES: 2-oxoglutarate translocator          116   1e-26   Bacillus
gb|KFM93392.1|  transporter, divalent anion:Na+ symporter family ...    115   1e-26   Bacillus paralicheniformis
ref|WP_013351349.1|  MULTISPECIES: 2-oxoglutarate translocator          116   1e-26   Bacillus subtilis group
ref|XP_009366350.1|  PREDICTED: dicarboxylate transporter 2, chlo...    117   1e-26   Pyrus x bretschneideri [bai li]
gb|KJB32094.1|  hypothetical protein B456_005G223500                    117   2e-26   Gossypium raimondii
ref|WP_032858509.1|  2-oxoglutarate translocator                        116   2e-26   Bacillus
ref|WP_038829541.1|  2-oxoglutarate translocator                        116   2e-26   Bacillus subtilis
ref|WP_007408966.1|  MULTISPECIES: 2-oxoglutarate translocator          116   2e-26   Bacillus
ref|WP_015417012.1|  MULTISPECIES: 2-oxoglutarate/malate transporter    116   2e-26   Bacillales
ref|WP_003155645.1|  MULTISPECIES: 2-oxoglutarate translocator          116   2e-26   Bacillus
ref|XP_010942614.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    117   2e-26   Elaeis guineensis
gb|EMT05118.1|  2-oxoglutarate/malate translocator, chloroplastic       114   2e-26   
ref|WP_042634956.1|  2-oxoglutarate translocator                        115   2e-26   Bacillus amyloliquefaciens
ref|XP_008805911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    117   2e-26   
ref|WP_039076181.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus
ref|WP_044163592.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus halotolerans
ref|WP_003233725.1|  2-oxoglutarate translocator                        115   3e-26   Bacillales
ref|WP_010330322.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus vallismortis
ref|WP_041057032.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus subtilis
ref|WP_024715768.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus tequilensis
ref|WP_019257759.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus
ref|WP_024120552.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus
ref|WP_028402895.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus panaciterrae
ref|WP_003239908.1|  hypothetical protein                               115   3e-26   Bacillus subtilis
ref|WP_010333359.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus mojavensis
ref|WP_041906771.1|  MULTISPECIES: 2-oxoglutarate translocator          115   3e-26   Bacillus subtilis
ref|WP_024572847.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus
ref|WP_015383080.1|  MULTISPECIES: 2-oxoglutarate/malate transporter    115   3e-26   Bacillus
ref|WP_019713597.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus subtilis
ref|XP_009401226.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    116   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KIN32538.1|  hypothetical protein B4069_0846                         115   3e-26   Bacillus subtilis
ref|WP_040083848.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus
ref|WP_014113016.1|  2-oxoglutarate translocator                        115   3e-26   Bacillus
ref|XP_006492620.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    116   3e-26   Citrus sinensis [apfelsine]
ref|WP_013390434.1|  MULTISPECIES: 2-oxoglutarate translocator          115   3e-26   Bacillus subtilis group
ref|XP_006423815.1|  hypothetical protein CICLE_v10028114mg             116   3e-26   Citrus clementina [clementine]
dbj|BAD19756.1|  putative plastidic general dicarboxylate transpo...    116   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|WP_010787924.1|  2-oxoglutarate/malate translocator                 115   3e-26   Bacillus atrophaeus
ref|XP_004290424.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    116   4e-26   Fragaria vesca subsp. vesca
ref|XP_012069162.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    116   4e-26   Jatropha curcas
gb|EAZ09443.1|  hypothetical protein OsI_31717                          115   4e-26   Oryza sativa Indica Group [Indian rice]
ref|WP_045293908.1|  2-oxoglutarate translocator                        115   4e-26   Bacillus aryabhattai
gb|ACL52604.1|  unknown                                                 115   4e-26   Zea mays [maize]
ref|WP_003328331.1|  2-oxoglutarate translocator                        115   5e-26   Bacillus atrophaeus
ref|WP_043977584.1|  2-oxoglutarate translocator                        115   5e-26   Bacillus megaterium
ref|WP_028409745.1|  2-oxoglutarate translocator                        115   5e-26   Bacillus
ref|WP_013085539.1|  2-oxoglutarate translocator                        115   5e-26   Bacillus megaterium
ref|WP_016765975.1|  2-oxoglutarate translocator                        115   5e-26   Bacillus megaterium
ref|WP_034648188.1|  2-oxoglutarate translocator                        114   5e-26   Bacillus megaterium
ref|XP_007042895.1|  Dicarboxylate transport 2.1                        115   6e-26   
gb|ACN34632.1|  unknown                                                 115   6e-26   Zea mays [maize]
ref|NP_001104868.1|  plastidic general dicarboxylate transporter        115   6e-26   
ref|XP_006827969.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    115   7e-26   Amborella trichopoda
ref|WP_029319476.1|  2-oxoglutarate translocator                        114   7e-26   Bacillus
ref|WP_013059892.1|  2-oxoglutarate translocator                        114   7e-26   Bacillus
ref|WP_014457694.1|  2-oxoglutarate translocator                        114   7e-26   Bacillus megaterium
ref|WP_028411930.1|  MULTISPECIES: 2-oxoglutarate translocator          114   8e-26   Bacillus
ref|XP_002460379.1|  hypothetical protein SORBIDRAFT_02g027290          115   9e-26   Sorghum bicolor [broomcorn]
ref|XP_003574657.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    115   9e-26   
ref|WP_020450525.1|  MULTISPECIES: 2-oxoglutarate/malate transpor...    114   9e-26   Bacillus subtilis group
ref|XP_011090364.1|  PREDICTED: dicarboxylate transporter 1, chlo...    114   9e-26   Sesamum indicum [beniseed]
ref|XP_007199747.1|  hypothetical protein PRUPE_ppa003588mg             115   1e-25   Prunus persica
ref|XP_001773473.1|  predicted protein                                  114   1e-25   
ref|WP_039073282.1|  MULTISPECIES: 2-oxoglutarate translocator          114   1e-25   Bacillales
ref|WP_043925701.1|  2-oxoglutarate translocator                        114   1e-25   Bacillus haynesii
ref|XP_002445989.1|  hypothetical protein SORBIDRAFT_07g029165          114   1e-25   
ref|WP_026589611.1|  2-oxoglutarate translocator                        114   1e-25   Bacillus
ref|XP_004957073.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    114   1e-25   Setaria italica
sp|Q8L7Z9.1|DIT2_SPIOL  RecName: Full=Dicarboxylate transporter 2...    114   1e-25   Spinacia oleracea
ref|XP_004973727.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    114   1e-25   Setaria italica
ref|XP_008237290.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    114   2e-25   Prunus mume [ume]
ref|WP_018712252.1|  hypothetical protein                               113   2e-25   Campylobacter ureolyticus
ref|XP_010690536.1|  PREDICTED: dicarboxylate transporter 2, chlo...    114   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_011197641.1|  2-oxoglutarate translocator                        113   2e-25   Bacillus
ref|WP_003179716.1|  MULTISPECIES: 2-oxoglutarate translocator          113   2e-25   Bacillus
ref|WP_026578902.1|  2-oxoglutarate translocator                        113   2e-25   Bacillus sp. SB47
ref|XP_007511000.1|  2-oxoglutarate/malate translocator                 114   2e-25   Bathycoccus prasinos
ref|XP_010520600.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    113   2e-25   Tarenaya hassleriana [spider flower]
ref|WP_014663179.1|  2-oxoglutarate translocator                        113   2e-25   Bacillus sp. JS
ref|XP_008382044.1|  PREDICTED: dicarboxylate transporter 2, chlo...    114   3e-25   
ref|WP_036200998.1|  2-oxoglutarate translocator                        112   3e-25   
ref|WP_041581256.1|  2-oxoglutarate translocator                        112   3e-25   
ref|XP_002445990.1|  hypothetical protein SORBIDRAFT_07g029170          113   3e-25   Sorghum bicolor [broomcorn]
tpg|DAA47747.1|  TPA: hypothetical protein ZEAMMB73_941040              113   3e-25   
gb|AGK55800.1|  divalent anion:Na+ symporter (DASS) family transp...    112   3e-25   Bacillus sp. 1NLA3E
ref|XP_001422207.1|  DASS family transporter: 2-oxoglutarate/malate     113   3e-25   Ostreococcus lucimarinus CCE9901
ref|XP_006660729.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    113   3e-25   Oryza brachyantha
dbj|BAD09285.1|  putative glutamate/malate translocator                 113   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001104869.1|  plastidic general dicarboxylate transporter        113   4e-25   Zea mays [maize]
emb|CAN78375.1|  hypothetical protein VITISV_000698                     113   5e-25   Vitis vinifera
dbj|BAD06222.1|  plastidic general dicarboxylate transporter            113   5e-25   Zea mays [maize]
dbj|BAJ99052.1|  predicted protein                                      113   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03702.1|  predicted protein                                      113   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86680.1|  predicted protein                                      113   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP01518.1|  unnamed protein product                                112   5e-25   Coffea canephora [robusta coffee]
ref|WP_016645858.1|  divalent anion:Na+ symporter (DASS) family t...    112   6e-25   Campylobacter ureolyticus
ref|XP_002994720.1|  hypothetical protein SELMODRAFT_237013             112   6e-25   
ref|WP_003223030.1|  2-oxoglutarate translocator                        112   7e-25   Bacillus subtilis
ref|XP_010648147.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    112   7e-25   Vitis vinifera
ref|XP_002500710.1|  divalent Anion:Na+ symporter family                111   7e-25   Micromonas commoda
ref|WP_014097116.1|  2-oxoglutarate translocator                        111   9e-25   Bacillus coagulans
ref|WP_042357669.1|  2-oxoglutarate translocator                        111   9e-25   Bacillus rubiinfantis
ref|XP_002974927.1|  hypothetical protein SELMODRAFT_267817             112   9e-25   
ref|WP_006637412.1|  sodium/sulfate symporter YflS                      111   9e-25   Bacillus sonorensis
ref|XP_002988946.1|  hypothetical protein SELMODRAFT_129026             112   1e-24   
ref|XP_003578268.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    112   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_003531538.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    112   1e-24   Glycine max [soybeans]
emb|CDY31328.1|  BnaA02g34130D                                          112   1e-24   Brassica napus [oilseed rape]
ref|XP_010461605.1|  PREDICTED: dicarboxylate transporter 2.2, ch...    112   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009380879.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    112   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002866606.1|  DIT2.2                                             112   1e-24   Arabidopsis lyrata subsp. lyrata
ref|NP_201233.1|  dicarboxylate transporter 2.2                         111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394171.1|  hypothetical protein EUTSA_v10003941mg             111   1e-24   Eutrema salsugineum [saltwater cress]
dbj|BAK44253.1|  dicarboxylate transporter                              111   1e-24   Eggerthella sp. YY7918
ref|WP_041690951.1|  2-oxoglutarate translocator                        110   2e-24   
ref|WP_042744509.1|  2-oxoglutarate translocator                        106   2e-24   
ref|XP_009130447.1|  PREDICTED: dicarboxylate transporter 2.2, ch...    111   2e-24   Brassica rapa
gb|KFK28119.1|  hypothetical protein AALP_AA8G475100                    111   2e-24   Arabis alpina [alpine rockcress]
ref|XP_010484203.1|  PREDICTED: dicarboxylate transporter 2.2, ch...    111   2e-24   Camelina sativa [gold-of-pleasure]
ref|WP_026684112.1|  2-oxoglutarate translocator                        110   3e-24   Bacillus coagulans
gb|KGH77071.1|  2-oxoglutarate translocator                             105   3e-24   Oenococcus oeni IOEB_9304
gb|KJB79625.1|  hypothetical protein B456_013G059600                    109   3e-24   Gossypium raimondii
emb|CEG00699.1|  Sodium/sulphate symporter                              110   4e-24   Ostreococcus tauri
ref|XP_003084104.1|  glutamate/malate translocator (ISS)                110   5e-24   
ref|XP_003064395.1|  divalent Anion:Na+ symporter family                110   5e-24   Micromonas pusilla CCMP1545
ref|WP_029285914.1|  2-oxoglutarate translocator                        108   6e-24   Pedobacter sp. R20-19
ref|WP_008510084.1|  2-oxoglutarate translocator                        108   7e-24   Mucilaginibacter paludis
ref|XP_008462877.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    110   8e-24   Cucumis melo [Oriental melon]
ref|XP_004137158.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    110   8e-24   Cucumis sativus [cucumbers]
ref|WP_036154823.1|  2-oxoglutarate translocator                        108   8e-24   Lysinibacillus odysseyi
gb|AAK43871.1|AF370494_1  2-oxoglutarate/malate translocator prec...    108   8e-24   Arabidopsis thaliana [mouse-ear cress]
ref|WP_006555548.1|  divalent anion:Na+ symporter (DASS) family t...    108   9e-24   Veillonella seminalis
ref|XP_006280266.1|  hypothetical protein CARUB_v10026187mg             109   9e-24   Capsella rubella
ref|XP_010536080.1|  PREDICTED: dicarboxylate transporter 1, chlo...    107   1e-23   
ref|WP_033543815.1|  2-oxoglutarate translocator                        108   1e-23   Planococcus sp. CAU13
ref|XP_005848004.1|  hypothetical protein CHLNCDRAFT_56149              108   1e-23   Chlorella variabilis
ref|XP_010520855.1|  PREDICTED: dicarboxylate transporter 2.2, ch...    109   1e-23   Tarenaya hassleriana [spider flower]
ref|WP_023385002.1|  divalent anion:Na+ symporter (DASS) family p...    108   1e-23   Campylobacter fetus
ref|WP_036802812.1|  2-oxoglutarate translocator                        108   1e-23   
gb|KJB79626.1|  hypothetical protein B456_013G059600                    108   1e-23   Gossypium raimondii
gb|ETP70180.1|  2-oxoglutarate translocator                             108   1e-23   Planomicrobium glaciei CHR43
ref|XP_005850013.1|  hypothetical protein CHLNCDRAFT_20518              108   2e-23   Chlorella variabilis
gb|EPS58215.1|  hypothetical protein M569_16600                         103   2e-23   Genlisea aurea
gb|KHG19166.1|  2-oxoglutarate/malate translocator, chloroplastic       108   2e-23   Gossypium arboreum [tree cotton]
gb|KJB79624.1|  hypothetical protein B456_013G059600                    108   2e-23   Gossypium raimondii
ref|WP_025553155.1|  hypothetical protein                               103   2e-23   
ref|WP_002471714.1|  2-oxoglutarate translocator                        107   2e-23   Staphylococcus pettenkoferi
ref|WP_000493040.1|  2-oxoglutarate translocator                        107   2e-23   Vibrio cholerae
dbj|GAO43521.1|  putative malate transporter                            107   2e-23   Flavihumibacter petaseus NBRC 106054
ref|WP_042740292.1|  2-oxoglutarate translocator                        107   3e-23   Staphylococcus
ref|WP_000493041.1|  2-oxoglutarate translocator                        107   3e-23   Vibrio cholerae
emb|CDY46791.1|  BnaC02g42990D                                          108   3e-23   Brassica napus [oilseed rape]
ref|WP_000493042.1|  2-oxoglutarate translocator                        107   3e-23   
ref|WP_010619226.1|  2-oxoglutarate translocator                        107   3e-23   
ref|WP_041017059.1|  2-oxoglutarate translocator                        107   3e-23   
ref|WP_027378953.1|  2-oxoglutarate translocator                        107   3e-23   
ref|WP_042479679.1|  2-oxoglutarate translocator                        107   4e-23   
ref|WP_027275760.1|  2-oxoglutarate translocator                        106   4e-23   
ref|WP_039069533.1|  2-oxoglutarate translocator                        106   4e-23   
ref|WP_000493039.1|  2-oxoglutarate translocator                        106   5e-23   
ref|WP_033930314.1|  2-oxoglutarate translocator                        106   5e-23   
ref|XP_001755334.1|  predicted protein                                  105   5e-23   
ref|XP_001781877.1|  predicted protein                                  105   6e-23   
ref|WP_029859134.1|  hypothetical protein                               102   6e-23   
ref|WP_034674881.1|  2-oxoglutarate translocator                        106   7e-23   
ref|WP_037441920.1|  2-oxoglutarate translocator                        105   8e-23   
ref|WP_036800605.1|  2-oxoglutarate translocator                        105   8e-23   
ref|WP_039367064.1|  2-oxoglutarate translocator                        105   9e-23   
ref|WP_010299206.1|  2-oxoglutarate translocator                        105   9e-23   
ref|WP_039471791.1|  2-oxoglutarate translocator                        105   1e-22   
gb|EQC65418.1|  2-oxoglutarate/malate translocator                      103   1e-22   
ref|WP_031828591.1|  2-oxoglutarate translocator                        102   1e-22   
ref|WP_029095534.1|  2-oxoglutarate translocator                        105   1e-22   
gb|AII14882.1|  DASS family sodium/dicarboxylate symporter              105   1e-22   
ref|XP_002977176.1|  hypothetical protein SELMODRAFT_151685             104   1e-22   
ref|XP_002965332.1|  hypothetical protein SELMODRAFT_230600             104   1e-22   
ref|XP_001753146.1|  predicted protein                                  105   1e-22   
ref|WP_038455621.1|  2-oxoglutarate translocator                        105   1e-22   
ref|WP_029292431.1|  2-oxoglutarate translocator                        105   1e-22   
ref|WP_004096030.1|  2-oxoglutarate translocator                        105   1e-22   
ref|WP_025518842.1|  hypothetical protein                               101   1e-22   
ref|WP_029862441.1|  2-oxoglutarate translocator                        101   2e-22   
ref|WP_029810646.1|  2-oxoglutarate translocator                        101   2e-22   
ref|WP_031502137.1|  2-oxoglutarate translocator                        105   2e-22   
ref|WP_010372129.1|  2-oxoglutarate translocator                        105   2e-22   
gb|ETJ00105.1|  hypothetical protein Q611_LSC00146G0002                 100   2e-22   
gb|EHY93411.1|  putative di- and tricarboxylate transporter             104   2e-22   
gb|AAM89395.1|  glutamate/malate translocator                           105   2e-22   
ref|WP_034618246.1|  2-oxoglutarate translocator                        104   2e-22   
ref|XP_005652072.1|  Sodium/sulfate symporter                           105   3e-22   
ref|WP_026707155.1|  2-oxoglutarate translocator                        104   3e-22   
ref|XP_011401658.1|  Dicarboxylate transporter 1, chloroplastic         104   3e-22   
gb|KKB74104.1|  2-oxoglutarate translocator                             104   3e-22   
ref|XP_004984114.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    105   3e-22   
ref|WP_026073362.1|  2-oxoglutarate translocator                        104   3e-22   
ref|WP_045500045.1|  2-oxoglutarate translocator                        104   3e-22   
ref|WP_038602287.1|  2-oxoglutarate translocator                        104   3e-22   
gb|KFF75424.1|  2-oxoglutarate translocator                             104   3e-22   
ref|WP_000493055.1|  2-oxoglutarate translocator                        103   3e-22   
ref|XP_001696590.1|  2-oxoglutarate/malate translocator                 105   4e-22   
ref|WP_022746998.1|  putative malate transporter YflS                   103   4e-22   
ref|WP_002977415.1|  2-oxoglutarate translocator                        103   4e-22   
ref|WP_029378255.1|  2-oxoglutarate translocator                        103   4e-22   
ref|WP_034699340.1|  2-oxoglutarate translocator                        103   5e-22   
ref|WP_005386905.1|  2-oxoglutarate translocator                        103   5e-22   
ref|WP_042722362.1|  2-oxoglutarate translocator                        103   5e-22   
ref|WP_025533190.1|  2-oxoglutarate translocator                        102   6e-22   
gb|EMS48908.1|  2-oxoglutarate/malate translocator, chloroplastic       100   6e-22   
ref|WP_009660890.1|  2-oxoglutarate translocator                        103   6e-22   
ref|WP_011672928.1|  2-oxoglutarate translocator                        103   6e-22   
ref|WP_016475465.1|  divalent anion:Na+ symporter (DASS) family t...    103   6e-22   
ref|WP_000493056.1|  MULTISPECIES: 2-oxoglutarate translocator          103   6e-22   
ref|WP_018137065.1|  hypothetical protein                               103   7e-22   
ref|WP_025543159.1|  2-oxoglutarate translocator                        102   7e-22   
ref|WP_019878601.1|  hypothetical protein                               103   7e-22   
ref|WP_029863307.1|  2-oxoglutarate translocator                        102   7e-22   
ref|WP_000493054.1|  2-oxoglutarate translocator                        103   7e-22   
ref|WP_025519096.1|  2-oxoglutarate translocator                        102   7e-22   
ref|WP_029845759.1|  2-oxoglutarate translocator                        102   8e-22   
gb|KEQ31373.1|  2-oxoglutarate translocator                             103   8e-22   
ref|WP_029841903.1|  2-oxoglutarate translocator                        102   8e-22   
ref|WP_037438221.1|  2-oxoglutarate translocator                        103   8e-22   
ref|WP_029800088.1|  2-oxoglutarate translocator                        102   8e-22   
ref|WP_009372098.1|  2-oxoglutarate translocator                        102   9e-22   
gb|KDO14330.1|  2-oxoglutarate translocator                             102   9e-22   
ref|WP_017867632.1|  2-oxoglutarate translocator                        103   9e-22   
ref|WP_000458310.1|  2-oxoglutarate translocator                        102   9e-22   
dbj|BAK95706.1|  putative citrate transporter                           101   1e-21   
ref|WP_027374530.1|  MULTISPECIES: 2-oxoglutarate translocator          102   1e-21   
ref|WP_004692973.1|  2-oxoglutarate translocator                        102   1e-21   
ref|WP_034687098.1|  2-oxoglutarate translocator                        102   1e-21   
ref|WP_004697146.1|  2-oxoglutarate translocator                        102   1e-21   
ref|WP_034989265.1|  2-oxoglutarate translocator                        102   1e-21   
ref|WP_043498342.1|  2-oxoglutarate translocator                        102   1e-21   
ref|WP_008600725.1|  MULTISPECIES: 2-oxoglutarate translocator          102   1e-21   
ref|WP_012864229.1|  2-oxoglutarate translocator                        102   1e-21   
dbj|GAJ26897.1|  2-oxoglutarate/malate translocator                     102   1e-21   
ref|WP_025535261.1|  2-oxoglutarate translocator                        102   1e-21   
ref|WP_031780455.1|  2-oxoglutarate translocator                        102   1e-21   
gb|EMD78885.1|  putative 2-oxoglutarate/malate translocator             102   2e-21   
ref|WP_038114652.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_020835222.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_034988937.1|  2-oxoglutarate translocator                        102   2e-21   
ref|XP_011045725.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    103   2e-21   
ref|WP_000493045.1|  2-oxoglutarate translocator                        102   2e-21   
ref|XP_002300194.2|  putative oxoglutarate-malate-translocase fam...    103   2e-21   
ref|WP_025547571.1|  2-oxoglutarate translocator                        102   2e-21   
gb|ETZ23288.1|  2-oxoglutarate translocator                             102   2e-21   
ref|WP_042771187.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_025611302.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_025636275.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_025787668.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_025604554.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_025630129.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_035166249.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_029815021.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_003004083.1|  2-oxoglutarate translocator                        102   2e-21   
ref|WP_031846587.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_031413129.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_031778702.1|  2-oxoglutarate translocator                        101   2e-21   
gb|KHF07152.1|  2-oxoglutarate translocator                             101   2e-21   
ref|WP_029805577.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_025504977.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_005498683.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_025795900.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_025626170.1|  2-oxoglutarate translocator                        101   2e-21   
ref|WP_021842417.1|  transporter DASS family                          96.7    3e-21   
ref|WP_031381798.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_017447632.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_040998492.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_034730448.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_024701309.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_005454276.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_029825684.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_029804741.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_017531615.1|  MULTISPECIES: 2-oxoglutarate translocator          101   3e-21   
ref|WP_017723110.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_008713765.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_034710102.1|  2-oxoglutarate translocator                        101   3e-21   
gb|AGB12076.1|  putative translocator                                   101   3e-21   
gb|EFO36829.1|  2-oxoglutarate/malate translocator                      101   3e-21   
ref|WP_040543388.1|  2-oxoglutarate translocator                        101   3e-21   
gb|EME76704.1|  anion transporter                                       101   3e-21   
gb|EIW19355.1|  anion transporter                                       101   3e-21   
ref|WP_021346170.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_025576307.1|  2-oxoglutarate translocator                        101   3e-21   
ref|WP_009087594.1|  MULTISPECIES: 2-oxoglutarate translocator          101   4e-21   
ref|WP_024568310.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_007840608.1|  MULTISPECIES: 2-oxoglutarate translocator          101   4e-21   
ref|WP_025624265.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_025554538.1|  2-oxoglutarate translocator                        101   4e-21   
ref|XP_004250120.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    101   4e-21   
gb|EIW32183.1|  anion transporter                                       101   4e-21   
ref|WP_028982962.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_010026829.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_021448447.1|  na+ symporter family protein                       101   4e-21   
ref|WP_028977160.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_036674200.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_033908116.1|  2-oxoglutarate translocator                        100   4e-21   
ref|WP_011302369.1|  2-oxoglutarate translocator                        101   4e-21   
ref|WP_040347794.1|  2-oxoglutarate translocator                        100   4e-21   
ref|WP_034326331.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_041079305.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_037537679.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_003001370.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_031841362.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_034875512.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_031812541.1|  2-oxoglutarate translocator                        100   5e-21   
ref|WP_045181544.1|  2-oxoglutarate translocator                        100   6e-21   
gb|ACU05461.1|  anion transporter                                       100   6e-21   
ref|WP_038205893.1|  2-oxoglutarate translocator                        100   7e-21   
ref|WP_028790814.1|  2-oxoglutarate translocator                        100   7e-21   
ref|WP_021772120.1|  putative 2-oxoglutarate/malate translocator        100   7e-21   
ref|WP_014234103.1|  2-oxoglutarate translocator                        100   7e-21   
dbj|BAL54892.1|  divalent anion:Na+ symporter, DASS family              100   7e-21   
ref|WP_020334774.1|  2-oxoglutarate translocator                        100   7e-21   
gb|EAX47424.1|  anion transporter                                       100   8e-21   
ref|WP_045754915.1|  2-oxoglutarate translocator                        100   8e-21   
ref|WP_040683231.1|  2-oxoglutarate translocator                        100   8e-21   
ref|WP_043151211.1|  permease                                           100   9e-21   
ref|WP_014243176.1|  2-oxoglutarate translocator                        100   9e-21   
ref|WP_029861249.1|  2-oxoglutarate translocator                        100   9e-21   
gb|KED43475.1|  2-oxoglutarate translocator                             100   9e-21   
ref|WP_010495522.1|  2-oxoglutarate translocator                        100   9e-21   
ref|WP_014425790.1|  2-oxoglutarate translocator                        100   9e-21   
ref|WP_034704428.1|  2-oxoglutarate translocator                        100   1e-20   
gb|KIY93412.1|  2-oxoglutarate/malate translocator Flags: Precursor   97.4    1e-20   
ref|WP_021797818.1|  transporter, DASS family                           100   1e-20   
ref|WP_025626594.1|  2-oxoglutarate translocator                      99.8    1e-20   
ref|WP_004902093.1|  2-oxoglutarate translocator                        100   1e-20   
ref|WP_008918345.1|  2-oxoglutarate translocator                        100   1e-20   
ref|WP_026258083.1|  2-oxoglutarate translocator                      99.8    1e-20   
ref|WP_038464208.1|  2-oxoglutarate translocator                      99.8    1e-20   
ref|WP_038174908.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_025589928.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_043042510.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_025527212.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_036486051.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_037354028.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_026759724.1|  2-oxoglutarate translocator                      99.4    2e-20   
ref|WP_043037281.1|  2-oxoglutarate translocator                      99.0    2e-20   
dbj|GAL52200.1|  putative transporter                                 97.4    3e-20   
ref|WP_034745423.1|  2-oxoglutarate translocator                      99.0    3e-20   
ref|WP_036376936.1|  2-oxoglutarate translocator                      99.0    3e-20   
ref|WP_028129304.1|  2-oxoglutarate translocator                      99.0    3e-20   
ref|WP_038026714.1|  2-oxoglutarate translocator                      98.6    3e-20   
ref|WP_026766662.1|  2-oxoglutarate translocator                      98.6    3e-20   
ref|WP_039476182.1|  2-oxoglutarate translocator                      98.6    3e-20   
ref|WP_038674799.1|  2-oxoglutarate translocator                      98.6    4e-20   
gb|AIF49710.1|  anion transporter                                     98.6    4e-20   
ref|XP_011100029.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  99.0    4e-20   
ref|WP_021072000.1|  2-oxoglutarate translocator                      98.6    4e-20   
ref|WP_034833506.1|  2-oxoglutarate translocator                      98.6    4e-20   
gb|KEQ19593.1|  2-oxoglutarate translocator                           98.2    5e-20   
ref|WP_043886829.1|  2-oxoglutarate translocator                      98.2    5e-20   
ref|WP_034586872.1|  2-oxoglutarate translocator                      98.2    5e-20   
ref|WP_038668023.1|  2-oxoglutarate translocator                      98.2    5e-20   
ref|WP_038139950.1|  2-oxoglutarate translocator                      98.2    5e-20   
ref|WP_038189804.1|  MULTISPECIES: 2-oxoglutarate translocator        98.2    5e-20   
dbj|GAF36487.1|  2-oxoglutarate/malate translocator                   95.5    5e-20   
gb|ERL04006.1|  putative 2-oxoglutarate/malate translocator           98.2    5e-20   
ref|WP_035879535.1|  2-oxoglutarate translocator                      98.2    6e-20   
ref|XP_009589933.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  98.6    6e-20   
ref|XP_002451514.1|  hypothetical protein SORBIDRAFT_04g003080        98.6    6e-20   
ref|WP_040637569.1|  2-oxoglutarate translocator                      97.8    6e-20   
ref|WP_035825773.1|  2-oxoglutarate translocator                      98.2    6e-20   
ref|WP_013957038.1|  2-oxoglutarate translocator                      98.2    7e-20   
ref|WP_006500685.1|  2-oxoglutarate translocator                      97.8    8e-20   
ref|WP_012305442.1|  2-oxoglutarate translocator                      97.8    8e-20   
ref|WP_011960208.1|  C4-dicarboxylate ABC transporter                 97.8    8e-20   
ref|WP_010078392.1|  cation transport protein                         95.5    8e-20   
ref|WP_033934696.1|  2-oxoglutarate translocator                      97.4    8e-20   
gb|EEX68501.1|  transporter, DASS family                              97.4    8e-20   



>ref|XP_004250945.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Solanum 
lycopersicum]
Length=555

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 174/220 (79%), Gaps = 6/220 (3%)
 Frame = +3

Query  87   MASLAVTSAVNPRFRPH-----RLSFHRPLQFNLKSAK-TELLITPGLKNHERNNVKRLH  248
            MASLA+TSAVN R RP      R+S  + L F   S K T L  +  L     N  K   
Sbjct  1    MASLALTSAVNLRLRPTPSQKPRISITQSLHFTQTSLKSTNLGKSLNLGGKRLNLEKSRR  60

Query  249  HIVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQPGGVSRNAWQLL  428
             IVKASAS ++++  A       PWQGAA+KPL+ASIATGVILWF+P P GV++NAWQLL
Sbjct  61   VIVKASASASASSSPAIVPQQQPPWQGAAMKPLIASIATGVILWFIPAPAGVTKNAWQLL  120

Query  429  SIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARG  608
            +IFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARG
Sbjct  121  AIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARG  180

Query  609  FIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            FIKTGLGNRIAYQFV LFGSSSLGLGYSLVFSEALLAPAI
Sbjct  181  FIKTGLGNRIAYQFVKLFGSSSLGLGYSLVFSEALLAPAI  220



>ref|XP_006361749.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Solanum 
tuberosum]
Length=554

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 172/219 (79%), Gaps = 5/219 (2%)
 Frame = +3

Query  87   MASLAVTSAVNPRFRPH-----RLSFHRPLQFNLKSAKTELLITPGLKNHERNNVKRLHH  251
            MASLA+TSAVN R RP      R+S  + L F   S KT  L        +R N ++   
Sbjct  1    MASLALTSAVNLRLRPTPSQKPRISITQSLHFTQTSLKTTNLGKSLNLGGKRLNHEKSRR  60

Query  252  IVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQPGGVSRNAWQLLS  431
            ++  +++ AS +  A       PWQGAA+KPL+ASIATGVILWF+P P GV++NAWQLL+
Sbjct  61   VIVKTSASASASSPAIVPQQQPPWQGAAMKPLIASIATGVILWFIPAPAGVTKNAWQLLA  120

Query  432  IFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGF  611
            IFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGF
Sbjct  121  IFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGF  180

Query  612  IKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            IKTGLGNRIAYQFV LFGSSSLGLGYSLVFSEALLAPAI
Sbjct  181  IKTGLGNRIAYQFVKLFGSSSLGLGYSLVFSEALLAPAI  219



>ref|XP_009609674.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=561

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 174/229 (76%), Gaps = 18/229 (8%)
 Frame = +3

Query  87   MASLAVTSAVNPRFRP-----HRLSFHRPLQFNLKSAKTELLITPGLKN----------H  221
            MASLA+TSAVN R RP       L   + LQ    S KT   +T   KN           
Sbjct  1    MASLALTSAVNLRLRPTPSQKSHLFSPQSLQSTQISKKTPSFLTSSFKNPLNLEKSLNLG  60

Query  222  ERNNVKRLHHIVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQPGG  401
            +R+N+ +   ++      +++   +    P QPWQGAAIKPL+ASIATG+ILWF+P P G
Sbjct  61   KRSNLDKPRSVI---IKASASTTPSAIVPPQQPWQGAAIKPLIASIATGIILWFIPAPAG  117

Query  402  VSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLI  581
            V++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLI
Sbjct  118  VTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLI  177

Query  582  ALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            ALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI
Sbjct  178  ALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI  226



>ref|XP_009777235.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
sylvestris]
Length=561

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 174/229 (76%), Gaps = 18/229 (8%)
 Frame = +3

Query  87   MASLAVTSAVNPRFRP-----HRLSFHRPLQFNLKSAKTELLITPGLKN----------H  221
            MASLA+TSAVN R RP       L   + LQ    S KT   +T   KN           
Sbjct  1    MASLALTSAVNLRLRPTPSQKSHLFSPQSLQSTQISKKTPSFLTSSFKNPLNLEKSLNPG  60

Query  222  ERNNVKRLHHIVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQPGG  401
            +R N+ +L  ++      ++++  +    P QPWQGAAIKPL+ASIATG+ILW +P P G
Sbjct  61   KRLNLDKLRSVI---IKASASSTPSAIVPPQQPWQGAAIKPLIASIATGIILWLIPAPAG  117

Query  402  VSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLI  581
            V++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLI
Sbjct  118  VTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLI  177

Query  582  ALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            ALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI
Sbjct  178  ALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI  226



>ref|XP_007015047.1| Dicarboxylate transporter 1 isoform 3 [Theobroma cacao]
 gb|EOY32666.1| Dicarboxylate transporter 1 isoform 3 [Theobroma cacao]
Length=377

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLMASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  154  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  214  VFSEALLAPAI  224



>ref|XP_011080429.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Sesamum 
indicum]
Length=482

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVI+WF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  17   MKPLLASIATGVIIWFLPAPDGVSRIAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  76

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  77   LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  136

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  137  VFSEALLAPAI  147



>ref|XP_010102341.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXB93302.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  100  IKPLLASIATGIILWFVPMPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  159

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  160  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  219

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  220  VFSEALLAPAI  230



>ref|XP_002313335.2| hypothetical protein POPTR_0009s05850g, partial [Populus trichocarpa]
 gb|EEE87290.2| hypothetical protein POPTR_0009s05850g, partial [Populus trichocarpa]
Length=300

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  28   MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  87

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  88   LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  147

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  148  VFSEALLAPAI  158



>gb|EYU46260.1| hypothetical protein MIMGU_mgv1a003794mg [Erythranthe guttata]
Length=564

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 175/231 (76%), Gaps = 19/231 (8%)
 Frame = +3

Query  87   MASLAVTSAVNPRFRPHRLSFHRP----------LQFNLKS-AKTELLITPGLKNHER--  227
            MAS AVTS++N RFRP  LS  +P          L   L++  K  +  +    +H+R  
Sbjct  1    MASFAVTSSLNLRFRP--LSTPKPRRPATPKSLHLTHKLRTLVKNSITNSINPHSHDRIP  58

Query  228  ----NNVKRLHHIVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQP  395
                N    L    +   + A+ AP +   AP QPWQGAA+KPL+ASIATGVILWF+P P
Sbjct  59   FANQNPAFSLPAPNRNPIAAAAAAPPSSPPAPPQPWQGAAMKPLIASIATGVILWFLPAP  118

Query  396  GGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPW  575
             GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPW
Sbjct  119  EGVSRVAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPW  178

Query  576  LIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            LIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI
Sbjct  179  LIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI  229



>gb|EYU31365.1| hypothetical protein MIMGU_mgv1a003738mg [Erythranthe guttata]
Length=567

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIA GVILWF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  102  IKPLVASIAVGVILWFIPAPNGVSRIAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  161

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  162  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  221

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  222  VFSEALLAPAI  232



>gb|EPS73843.1| hypothetical protein M569_00906, partial [Genlisea aurea]
Length=448

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATGVI+WF+P P GVSRNAWQLLSIFLATIVGII+QPLPLGAVAL+GLGA V
Sbjct  7    IKPLIASIATGVIIWFIPAPQGVSRNAWQLLSIFLATIVGIISQPLPLGAVALLGLGASV  66

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  67   LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  126

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  127  VFSEALLAPAI  137



>ref|XP_002282809.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Vitis 
vinifera]
Length=559

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL A+IATGVILWFVPQP GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLAAAIATGVILWFVPQPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  214  VFSEALLAPAI  224



>ref|XP_007015045.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY32664.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
Length=559

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLMASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  154  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  214  VFSEALLAPAI  224



>ref|XP_004142115.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Cucumis 
sativus]
 gb|KGN54177.1| 2-oxoglutarate/malate translocator [Cucumis sativus]
Length=572

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  107  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  166

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  167  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  226

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  227  VFSEALLAPAI  237



>ref|XP_011625484.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Amborella 
trichopoda]
Length=558

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 168/223 (75%), Gaps = 9/223 (4%)
 Frame = +3

Query  87   MASLAVTSAVNPRFRPHRL----SFHRPLQF--NLKS--AKTELLIT-PGLKNHERNNVK  239
            MAS AVTS +N   RP       S  + LQ   NL S   K EL    P ++   R +V 
Sbjct  1    MASFAVTSPLNLGLRPSSTCKPRSSAKALQIKPNLTSNHVKKELFSRLPLVQKQIRVSVS  60

Query  240  RLHHIVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQPGGVSRNAW  419
            R       + S    A A   A  ++PWQGA++KPLLASIATG+ILWF+P P GVSRNAW
Sbjct  61   RSFPSGSRNPSTVVRASATSPATVSEPWQGASLKPLLASIATGLILWFIPSPSGVSRNAW  120

Query  420  QLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFF  599
            QLL+IFLATIVGIITQPLPLGAVAL+GLGA VLTKTLTFAAAFSAFGDPIPWLIALAFFF
Sbjct  121  QLLAIFLATIVGIITQPLPLGAVALLGLGATVLTKTLTFAAAFSAFGDPIPWLIALAFFF  180

Query  600  ARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            ARGFIKTGLG R+AYQFVSLFG+SSLGLGYSLVFSEALLAPAI
Sbjct  181  ARGFIKTGLGKRVAYQFVSLFGNSSLGLGYSLVFSEALLAPAI  223



>ref|XP_010031793.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW51183.1| hypothetical protein EUGRSUZ_J00769 [Eucalyptus grandis]
Length=571

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            + PLLASIATGVILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  MGPLLASIATGVILWFVPVPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGAAV  165

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFV LFGSSSLGLGYSL
Sbjct  166  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVKLFGSSSLGLGYSL  225

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  226  VFSEALLAPAI  236



>gb|KJB35803.1| hypothetical protein B456_006G129000 [Gossypium raimondii]
Length=559

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 161/203 (79%), Gaps = 16/203 (8%)
 Frame = +3

Query  120  PRFRPHRLSFHRPLQFNLKSAKTELLITPGLKNHERNNVKRLHHIVKasasgastapaag  299
            P+   H  SF +PL            +TP + N   N +++ H   K +   A++ PAA 
Sbjct  38   PKSTSHNSSFIKPLS-----------LTPIITN---NGIQKRHS--KLTVKAAASTPAAV  81

Query  300  gaapaqpwqgaaIKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPL  479
                 QPWQGAA+KPL+ASIATGVILWF+P P GVSRNAWQLLSIFLATIVGIITQPLPL
Sbjct  82   TPPSQQPWQGAALKPLIASIATGVILWFLPVPSGVSRNAWQLLSIFLATIVGIITQPLPL  141

Query  480  GAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvsl  659
            GAVAL+GLGA VLTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSL
Sbjct  142  GAVALLGLGASVLTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSL  201

Query  660  fgssslglgyslvfsEALLAPAI  728
            FGSSSLGLGYSLVFSEALLAPAI
Sbjct  202  FGSSSLGLGYSLVFSEALLAPAI  224



>ref|XP_007211882.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
 gb|EMJ13081.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
Length=566

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  101  MKPLLASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  160

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  161  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  220

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  221  VFSEALLAPAI  231



>ref|XP_008449718.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Cucumis 
melo]
Length=573

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  108  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  167

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  168  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  227

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  228  VFSEALLAPAI  238



>ref|NP_568283.2| dicarboxylate transporter 1 [Arabidopsis thaliana]
 sp|Q9LXV3.1|DIT1_ARATH RecName: Full=Dicarboxylate transporter 1, chloroplastic; AltName: 
Full=2-oxoglutarate/malate translocator 1; Short=AtpOMT1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB88250.1| 2-oxoglutarate/malate translocator precursor-like protein [Arabidopsis 
thaliana]
 gb|AED91822.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=557

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  92   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  152  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|XP_010257247.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nelumbo 
nucifera]
Length=571

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  LKPLMASIATGVILWFLPVPSGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  165

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  166  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  225

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  226  VFSEALLAPAI  236



>ref|NP_001119216.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
 gb|AED91823.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=556

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  92   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  152  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|XP_008227299.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Prunus 
mume]
Length=566

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  101  MKPLLASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  160

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  161  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  220

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  221  VFSEALLAPAI  231



>gb|KHG21220.1| 2-oxoglutarate/malate translocator, chloroplastic [Gossypium 
arboreum]
Length=559

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 174/228 (76%), Gaps = 9/228 (4%)
 Frame = +3

Query  45   LSHSPPLPRTAIAVMASLAVTSAVNPRFRPHRLSFHRPLQFNLKSAKTELLITPGLKNHE  224
            L+ S PL  + I  +A  +  S  NP F P  L   +    N  S   +L +TP + N  
Sbjct  6    LTSSCPLGYSRIKSLA-FSSRSCPNPVFSPPFLP--KSTSHN-SSFIKQLSLTPVITN--  59

Query  225  RNNVKRLHHIVKasasgastapaaggaapaqpwqgaaIKPLLASIATGVILWFVPQPGGV  404
             N +++ H   K +   A++ PAA      QPWQGAA+KPL+ASIATGVILWF+P P GV
Sbjct  60   -NRIQKRHS--KLTVKAAASTPAAVTPPSQQPWQGAALKPLIASIATGVILWFLPVPSGV  116

Query  405  SRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIA  584
            SRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA VLTKTLTF+AAFSAFGDPIPWLIA
Sbjct  117  SRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASVLTKTLTFSAAFSAFGDPIPWLIA  176

Query  585  LAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            LAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI
Sbjct  177  LAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSEALLAPAI  224



>ref|XP_010536081.1| PREDICTED: dicarboxylate transporter 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=560

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATGVILWFVP P GVSR+AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   IKPLIASIATGVILWFVPVPDGVSRSAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFV LFGSSSLGLGYSL
Sbjct  155  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVRLFGSSSLGLGYSL  214

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  215  VFSEALLAPAI  225



>ref|XP_009375074.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=623

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  158  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  217

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  218  LTKTLTFGAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  277

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  278  VFSEALLAPAI  288



>ref|XP_006399771.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
 dbj|BAJ33726.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41224.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
Length=555

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  90   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  149

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  150  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  209

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  210  VFSEALLAPAI  220



>ref|XP_004291789.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  103  MKPLIASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  162

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  163  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  222

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  223  VFSEALLAPAI  233



>ref|XP_012089998.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Jatropha 
curcas]
 gb|KDP22090.1| hypothetical protein JCGZ_25921 [Jatropha curcas]
Length=571

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILWFVP P GVSR AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  MKPLLASIATGVILWFVPVPSGVSRPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  165

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  166  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  225

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  226  VFSEALLAPAI  236



>ref|XP_008363620.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Malus 
domestica]
Length=569

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  164  LTKTLTFGAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  223

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  224  VFSEALLAPAI  234



>sp|Q41364.1|DIT1_SPIOL RecName: Full=Dicarboxylate transporter 1, chloroplastic; Short=SODIT1; 
AltName: Full=2-oxoglutarate/malate translocator; 
Flags: Precursor [Spinacia oleracea]
 gb|AAA68148.1| 2-oxoglutarate/malate translocator [Spinacia oleracea]
Length=569

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASI TGVI+WF+P P GVSRNAWQLL+IFL+TIVGIITQPLPLGAVALMGLGA V
Sbjct  104  IKPLLASILTGVIIWFIPTPEGVSRNAWQLLAIFLSTIVGIITQPLPLGAVALMGLGASV  163

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFV LFGSSSLGLGYSL
Sbjct  164  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVKLFGSSSLGLGYSL  223

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  224  VFSEALLAPAI  234



>ref|XP_009343722.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009343726.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=569

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  164  LTKTLTFGAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  223

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  224  VFSEALLAPAI  234



>ref|XP_008344435.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic-like [Malus domestica]
Length=447

 Score =   193 bits (491),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            + PL+ASIATG+ILWF P P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  102  MTPLIASIATGLILWFFPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  161

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  162  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  221

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  222  VFSEALLAPAI  232



>ref|XP_009411283.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=562

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL ASIATGVILW VP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  97   LKPLAASIATGVILWLVPAPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  156

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFVSLFGSSSLGLGYSL
Sbjct  157  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVSLFGSSSLGLGYSL  216

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  217  VFSEALLAPAI  227



>gb|KFK25523.1| hypothetical protein AALP_AA8G126300 [Arabis alpina]
Length=556

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  91   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  150

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  151  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  210

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  211  VFSEALLAPAI  221



>ref|XP_007015046.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY32665.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
Length=462

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  348  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  527
            +ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA VLTKT
Sbjct  1    MASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASVLTKT  60

Query  528  LTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsE  707
            LTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSE
Sbjct  61   LTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSLVFSE  120

Query  708  ALLAPAI  728
            ALLAPAI
Sbjct  121  ALLAPAI  127



>ref|XP_009394734.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=561

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL ASIATGV+LWFVP P GVSRNAWQLL+IFLATI+GIITQPLPLGAVALMGLGA V
Sbjct  96   LKPLAASIATGVLLWFVPAPSGVSRNAWQLLAIFLATIIGIITQPLPLGAVALMGLGASV  155

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL FAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  156  LTKTLPFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  215

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  216  VFSEALLAPAI  226



>ref|XP_006287403.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
 gb|EOA20301.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
Length=557

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF AAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  152  LTKTLTFTAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|XP_010419844.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Camelina 
sativa]
Length=559

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  214  VFSEALLAPAI  224



>ref|XP_010453335.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=559

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  214  VFSEALLAPAI  224



>ref|XP_010492022.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Camelina 
sativa]
Length=557

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  152  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|XP_002873582.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49841.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  89   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  148

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF AAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  149  LTKTLTFTAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  208

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  209  VFSEALLAPAI  219



>ref|XP_009348953.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=563

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            + PL+ASIATG+ILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  98   MTPLIASIATGLILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  157

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  158  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  217

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  218  VFSEALLAPAI  228



>ref|XP_011025529.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=565

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  100  MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  159

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  160  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  219

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  220  VFSEALLAPAI  230



>emb|CDY53969.1| BnaA10g30010D [Brassica napus]
Length=552

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  87   IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  146

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  147  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  206

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  207  VFSEALLAPAI  217



>ref|XP_008801951.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Phoenix 
dactylifera]
Length=558

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGV+LWFVP P GVSRNAWQLL++FLATIVGIITQPLPLGAVALMGLGA V
Sbjct  93   LKPLVASIATGVLLWFVPAPAGVSRNAWQLLAVFLATIVGIITQPLPLGAVALMGLGASV  152

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFVSLFGSSSLGLGYSL
Sbjct  153  LTKTLPFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVSLFGSSSLGLGYSL  212

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  213  VFSEALLAPAI  223



>ref|XP_009121830.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Brassica 
rapa]
Length=548

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  83   IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  142

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  143  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  202

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  203  VFSEALLAPAI  213



>ref|XP_009366121.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=588

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            + PL+ASIATG+ILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  123  MTPLIASIATGLILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  182

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  183  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  242

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  243  VFSEALLAPAI  253



>emb|CDX97208.1| BnaC09g44170D [Brassica napus]
Length=569

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  164  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVRLFGSSSLGLGYSL  223

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  224  VFSEALLAPAI  234



>ref|XP_002513507.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF48910.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
Length=561

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVI+WFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  96   IKPLLASIATGVIIWFVPVPTGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  155

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFV LFGSSSLGLGYSL
Sbjct  156  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVKLFGSSSLGLGYSL  215

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  216  VFSEALLAPAI  226



>dbj|BAK00367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVI+WF+P P GV+RNAWQLL++FLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLLASIATGVIIWFIPAPAGVARNAWQLLAVFLATIVGIITQPLPLGAVALLGLGAAV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT+TLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFVS FG S+LGLGYSL
Sbjct  154  LTRTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVSAFGGSTLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VF+EA LAPAI
Sbjct  214  VFAEAFLAPAI  224



>ref|XP_006446115.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 ref|XP_006470607.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Citrus 
sinensis]
 gb|ESR59355.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 gb|KDO61260.1| hypothetical protein CISIN_1g008538mg [Citrus sinensis]
Length=562

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATG+ILWFVP P GVS+NAWQLL+IFLATIVGII QPLPLGAVAL+GLGA V
Sbjct  97   LKPLIASIATGLILWFVPVPSGVSKNAWQLLAIFLATIVGIIAQPLPLGAVALLGLGASV  156

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTF+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFV LFGSSSLGLGYSL
Sbjct  157  LTKTLTFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVKLFGSSSLGLGYSL  216

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  217  VFSEALLAPAI  227



>emb|CDP12268.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL+ASIATGV+LW VP P GVSRNAWQLL+IFLATI+GIITQPLPLGAVAL+GLGA V
Sbjct  108  MKPLIASIATGVLLWLVPAPAGVSRNAWQLLAIFLATIIGIITQPLPLGAVALLGLGASV  167

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFA AFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFV LFGSSSLGLGYSL
Sbjct  168  LTKTLTFAGAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVKLFGSSSLGLGYSL  227

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  228  VFSEALLAPAI  238



>ref|XP_011045437.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  155  LTKTLPFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  214

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  215  VFSEALLAPAI  225



>ref|XP_010453336.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=560

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfg-ssslglgys  692
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQF      SSSLGLGYS
Sbjct  154  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFFVKLFGSSSLGLGYS  213

Query  693  lvfsEALLAPAI  728
            LVFSEALLAPAI
Sbjct  214  LVFSEALLAPAI  225



>ref|XP_011006198.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIATGVILW VP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIATGVILWLVPVPSGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  155  LTKTLPFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  214

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  215  VFSEALLAPAI  225



>ref|XP_002299910.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
 gb|EEE84715.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
Length=560

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPLLASIA GVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIAIGVILWFVPVPSGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL
Sbjct  155  LTKTLPFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSSLGLGYSL  214

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  215  VFSEALLAPAI  225



>gb|ABK24751.1| unknown [Picea sitchensis]
Length=594

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL ASIATGVI+W VP P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  129  LKPLAASIATGVIMWLVPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGAAV  188

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGD IPWLIALAFFFARGFIKTGLGNR+AYQFV+LFGSSSLGLGYSL
Sbjct  189  LTKTLTFAAAFSAFGDQIPWLIALAFFFARGFIKTGLGNRVAYQFVALFGSSSLGLGYSL  248

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  249  VFSEALLAPAI  259



>ref|XP_010931014.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Elaeis guineensis]
Length=557

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL A+IATGV+LW VP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   LKPLAATIATGVLLWLVPAPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFVSLFGSSSLGLGYSL
Sbjct  152  LTKTLPFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVSLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|XP_007132020.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
 gb|ESW04014.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
Length=559

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  94   IKPLLASIATGVILWFTPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  153

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL FAAAFS FGDPIPWLIALAFFFA+GFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  154  LTKTLPFAAAFSGFGDPIPWLIALAFFFAKGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  213

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  214  VFSEALLAPAI  224



>ref|XP_004507091.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cicer 
arietinum]
Length=557

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVILWFVP P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  92   IKPLLASIATGVILWFVPVPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F AAFS FGDPIPWLI LAFFFA+GFIKTGLGNR+AYQFVSLFGSSSLGLGYSL
Sbjct  152  LTKTLPFVAAFSGFGDPIPWLICLAFFFAKGFIKTGLGNRVAYQFVSLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|NP_001066885.1| Os12g0515400 [Oryza sativa Japonica Group]
 gb|ABA98704.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29904.1| Os12g0515400 [Oryza sativa Japonica Group]
Length=548

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+A+I TGV++W VP P GV+RNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  83   IKPLVATIGTGVLIWLVPPPAGVARNAWQLLSIFLATIVGIITQPLPLGAVALLGLGAAV  142

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT+TLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLG+R+AY FVS FG SSLGLGY+L
Sbjct  143  LTRTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGSRVAYAFVSAFGGSSLGLGYAL  202

Query  696  vfsEALLAPAI  728
            VF+EALLAPAI
Sbjct  203  VFAEALLAPAI  213



>emb|CAX65044.1| plastidic 2-oxoglutarate/malate translocator [Pisum sativum]
Length=480

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGVI+WF+P P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  14   IKPLLASIATGVIIWFLPTPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  73

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F AAFS FGDPIPWLI LAFFFA+GFIKTGLGNR+AYQFVSLFGSSSLGLGYSL
Sbjct  74   LTKTLPFVAAFSGFGDPIPWLICLAFFFAKGFIKTGLGNRVAYQFVSLFGSSSLGLGYSL  133

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  134  VFSEALLAPAI  144



>ref|XP_003537966.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=560

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  95   IKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  154

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL FAAAFS FGDPIPWLIALAFFFA+GFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  155  LTKTLPFAAAFSGFGDPIPWLIALAFFFAKGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  214

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  215  VFSEALLAPAI  225



>ref|XP_002442229.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
 gb|EES16067.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
Length=584

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLAS+A GV++WF+P P GV RNAWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  119  IKPLLASLAIGVLIWFLPAPAGVPRNAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  178

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLG+R+AY FV+ FGSSSLGLGYSL
Sbjct  179  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGSRVAYAFVAAFGSSSLGLGYSL  238

Query  696  vfsEALLAPAI  728
            VF+EALLAPAI
Sbjct  239  VFAEALLAPAI  249



>ref|XP_003539493.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=553

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  88   IKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  147

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL FAAAFS FGDPIPWLIALAFFFA+GFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  148  LTKTLPFAAAFSGFGDPIPWLIALAFFFAKGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  207

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  208  VFSEALLAPAI  218



>ref|XP_010673637.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASI TGVI+W +P P GV++ AWQLL+IFL+TIVGIITQPLPLGAVALMGLGA V
Sbjct  95   IKPLLASIITGVIIWLIPTPEGVTKQAWQLLAIFLSTIVGIITQPLPLGAVALMGLGASV  154

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +TKTL F+AAFSAFGDPIPWLIALAFFFARGFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  155  VTKTLPFSAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  214

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  215  VFSEALLAPAI  225



>ref|NP_001105570.1| LOC542560 [Zea mays]
 dbj|BAD06219.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
 gb|AFW56593.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
Length=578

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATGV++W +P P GV RNAWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  113  IKPLLASIATGVLIWLIPPPAGVPRNAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  172

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            L++TLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLG+R+AY FV+ FGSSSLGLGYSL
Sbjct  173  LSRTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGSRVAYAFVAAFGSSSLGLGYSL  232

Query  696  vfsEALLAPAI  728
            VF+EALLAPAI
Sbjct  233  VFAEALLAPAI  243



>gb|KEH30210.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=557

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+ASI TGVILWFVP P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  92   IKPLIASILTGVILWFVPTPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  151

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTKTL F AAFS FGDPIPWLI LAFFFA+GFIKTGLGNR+AYQFV LFGSSSLGLGYSL
Sbjct  152  LTKTLPFVAAFSGFGDPIPWLICLAFFFAKGFIKTGLGNRVAYQFVKLFGSSSLGLGYSL  211

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  212  VFSEALLAPAI  222



>ref|XP_003575954.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Brachypodium distachyon]
Length=560

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPLLASIATG+++WF+P P GV+RNAWQLL++FLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  93   IKPLLASIATGLLIWFIPAPAGVARNAWQLLAVFLATIVGIITQPLPLGAVALLGLGAAV  152

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT+TLTFAAAFSAFGDPIPWLI  AFFFARGFIKTGLGNR+AY
Sbjct  153  LTRTLTFAAAFSAFGDPIPWLIGRAFFFARGFIKTGLGNRVAY  195



>ref|XP_004964101.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Setaria 
italica]
Length=567

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLLA++ATGV++   P P GV R AWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  102  ITPLLATVATGVLIRLGPAPSGVPRKAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  161

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT+TLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLG+R+AY FV+ FGSSSLGLGYSL
Sbjct  162  LTRTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGSRVAYAFVAAFGSSSLGLGYSL  221

Query  696  vfsEALLAPAI  728
            VF+EALLAPAI
Sbjct  222  VFAEALLAPAI  232



>emb|CAN74406.1| hypothetical protein VITISV_043636 [Vitis vinifera]
Length=303

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  631  LPSPVLINPRAKKNASAISQGMGSPNAENAAANVRVFVSTHAPRPINATAPSGSGWVMIP  452
            LPSPVLI P AKK ASAIS G+GSP AE AAA VRV VST APRP +ATAPSGSG VM+P
Sbjct  3    LPSPVLIKPLAKKKASAISHGIGSPKAEKAAAKVRVLVSTDAPRPRSATAPSGSGCVMMP  62

Query  451  TMVARKIDSNCHAFRETPPGCGTNQRITPVAMDARSGL  338
            TMVARKI S+CHAF ETP GCGTN R+TPVA+ A SG 
Sbjct  63   TMVARKIASSCHAFLETPAGCGTNHRMTPVAIAAASGF  100



>ref|XP_001700410.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
 gb|EDO98099.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
Length=553

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +K L   +     LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  89   MKDLAICVGVATALWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAIIGLGAAM  148

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +TK LTFA AFSAF   IPWLIA+A+F A GFIK+GLGNRIAY  V   G ++LGL Y+L
Sbjct  149  ITKVLTFAEAFSAFASEIPWLIAIAYFLAGGFIKSGLGNRIAYMIVGALGKTTLGLTYAL  208

Query  696  vfsEALLAPAI  728
            VF+EALL+PAI
Sbjct  209  VFAEALLSPAI  219



>ref|XP_001700411.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
 gb|EDO98100.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
Length=587

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +K L   +     LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  123  MKDLAICVGVATALWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAIIGLGAAM  182

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +TK LTFA AFSAF   IPWLIA+A+F A GFIK+GLGNRIAY  V   G ++LGL Y+L
Sbjct  183  ITKVLTFAEAFSAFASEIPWLIAIAYFLAGGFIKSGLGNRIAYMIVGALGKTTLGLTYAL  242

Query  696  vfsEALLAPAI  728
            VF+EALL+PAI
Sbjct  243  VFAEALLSPAI  253



>ref|XP_002955862.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
 gb|EFJ43063.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
Length=551

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +K L   +    +LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  87   MKDLGICVGIATLLWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAVLGLGAAM  146

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +TK LTFA AFSAF   IPWLIA+A+F A GFIK+GLGNRIAY  V   G ++LGL Y+L
Sbjct  147  ITKVLTFAEAFSAFASEIPWLIAIAYFLAGGFIKSGLGNRIAYAIVGALGKTTLGLTYAL  206

Query  696  vfsEALLAPAI  728
            VF+EALL+PAI
Sbjct  207  VFAEALLSPAI  217



>dbj|BAD91178.1| putative plastidic 2-oxoglutarate/malate translocator [Mesembryanthemum 
crystallinum]
Length=426

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/91 (97%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  456  IITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR  635
            IITQPLPLGAVALMGLGA VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR
Sbjct  1    IITQPLPLGAVALMGLGAAVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNR  60

Query  636  IAYQfvslfgssslglgyslvfsEALLAPAI  728
            IAYQFV LFG+SSLGLGYSLVFSEALLAPAI
Sbjct  61   IAYQFVKLFGASSLGLGYSLVFSEALLAPAI  91



>ref|XP_005843613.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
 gb|EFN51511.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
Length=536

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +K L   +A G  LW  P P GVS  AW LL++FL+TI GIIT P+PLGAVA+MGL A  
Sbjct  71   LKKLGICVAIGAALWVSPAPAGVSSQAWHLLAVFLSTICGIITTPMPLGAVAMMGLAAAQ  130

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT  LTFA AFSAF   IPWLIA+AF+ + GFI++GLG RIAY  VSLFG ++LGL YSL
Sbjct  131  LTGVLTFAQAFSAFASEIPWLIAIAFWLSGGFIRSGLGARIAYSIVSLFGKTTLGLTYSL  190

Query  696  vfsEALLAPAI  728
            V +EALLAPAI
Sbjct  191  VAAEALLAPAI  201



>ref|XP_002507903.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
 gb|ACO69161.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
Length=563

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL  S+  G+++W +P P GVS  AW LL++F+ TIVGIIT PLPLGA A++GLG  +
Sbjct  98   LKPLGYSVLAGLLIWLIPAPAGVSAQAWHLLAVFVGTIVGIITNPLPLGATAMIGLGVSM  157

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +T  L FAAAFSAF   IPWLIALAFF ARGFIKTGLGNRIAY  VSLFG S+LGL YSL
Sbjct  158  VTGLLPFAAAFSAFSSEIPWLIALAFFLARGFIKTGLGNRIAYYIVSLFGKSTLGLTYSL  217

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  218  VFSEALLAPAI  228



>gb|EYU18451.1| hypothetical protein MIMGU_mgv1a003725mg [Erythranthe guttata]
Length=568

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S+A G+ + +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  103  PLIISLAIGIAVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTAVL  162

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTFAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  163  TKTLTFAAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  222

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  223  LSEALIAPAM  232



>ref|XP_005650106.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25562.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
Length=466

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +K L   +A  V +WF P P GV+  AW LL+IFL TIVGIITQPLPLGAVA++GLGA +
Sbjct  1    MKNLGICVAVAVAVWFCPPPAGVTIQAWHLLAIFLGTIVGIITQPLPLGAVAMLGLGATM  60

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LTK LTF+AAFSAF   IPWLIA+AF+ + GFIK+GLGNR+AY  VS+FG ++LGL YSL
Sbjct  61   LTKVLTFSAAFSAFSSEIPWLIAIAFWLSGGFIKSGLGNRVAYAIVSVFGKTTLGLAYSL  120

Query  696  vfsEALLAPAI  728
            VF+EALLAPAI
Sbjct  121  VFAEALLAPAI  131



>gb|AFK44505.1| unknown [Medicago truncatula]
Length=285

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P   SI  G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  102  PFAISILIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  161

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  162  TKTLTFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLT  221

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  222  FSEVLIAPAM  231



>ref|XP_003078785.1| 2-oxoglutarate/malate translocator (ISS) [Ostreococcus tauri]
 emb|CAL51665.1| Sodium/sulphate symporter [Ostreococcus tauri]
Length=565

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL  S+  G++++ +P P GV+  AW LL++F+ATIVGIIT PLPLGAVA++GLG  +
Sbjct  100  LKPLGYSVLAGLLIYLIPTPAGVTVKAWNLLAVFVATIVGIITNPLPLGAVAMIGLGVSM  159

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
                L F+AAFSAF   IPWLIALAFF ARGFIKTGLGNRIAYQ VSLFG S+LGL YSL
Sbjct  160  TAGILPFSAAFSAFSSEIPWLIALAFFLARGFIKTGLGNRIAYQIVSLFGKSTLGLTYSL  219

Query  696  vfsEALLAPAI  728
            VFSEALLAPAI
Sbjct  220  VFSEALLAPAI  230



>ref|XP_011087921.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Sesamum indicum]
Length=562

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL SIA G+++ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PLLISIAIGILVRFFVPKPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF +AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  157  TKTLTFTSAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLT  216

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  217  LSEALIAPAM  226



>ref|XP_009774993.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nicotiana sylvestris]
 gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum]
Length=583

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+I+ +FVP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  118  PLIISVSIGLIVRFFVPKPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  177

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF AAF+AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  178  TKTLTFTAAFNAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  237

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  238  LSEALIAPAM  247



>ref|XP_007512423.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO17023.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=594

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +3

Query  339  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            K L  S+  G++LW  P P GV+  AW L ++F+ATIVGIITQPLPLGAVA++GLG  + 
Sbjct  130  KNLGYSVLAGLLLWICPAPAGVTAQAWHLFAVFVATIVGIITQPLPLGAVAMIGLGVSMT  189

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T  L F+AAFSAF   IPWLIA+AFF ARGFIKTGLGNRIAY  VSLFG+S+LGL YSLV
Sbjct  190  TGLLPFSAAFSAFASEIPWLIAIAFFLARGFIKTGLGNRIAYYIVSLFGASTLGLTYSLV  249

Query  699  fsEALLAPAI  728
            FSEALLAPAI
Sbjct  250  FSEALLAPAI  259



>ref|XP_009624586.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Nicotiana 
tomentosiformis]
Length=585

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+I+ +FVP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  120  PLIISVSIGLIVRFFVPKPPEVSLQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  179

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF AAF+AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  180  TKTLTFTAAFNAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  239

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  240  LSEALIAPAM  249



>ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
 sp|Q9FMF7.1|DIT21_ARATH RecName: Full=Dicarboxylate transporter 2.1, chloroplastic; AltName: 
Full=AtpDCT1; AltName: Full=Glutamate/malate translocator; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09860.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAL07178.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AAN31801.1| putative 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAU95461.1| At5g64290 [Arabidopsis thaliana]
 gb|AED97866.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
Length=563

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ SI+ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  98   PLILSISVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  LSEALIAPAM  227



>ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
Length=561

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ SI+ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  96   PLILSISVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  155

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  156  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  215

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  216  LSEALIAPAM  225



>ref|XP_006351757.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+I+ F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  119  PLIISVSIGLIVRFLVPRPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  178

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF++AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  179  TKTLTFSSAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  238

Query  699  fsEALLAPAI  728
             +EAL+APA+
Sbjct  239  LAEALIAPAM  248



>ref|XP_010315125.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 2.1, 
chloroplastic-like [Solanum lycopersicum]
Length=584

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+I+ F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  119  PLIISVSIGLIVRFLVPRPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  178

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF++AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  179  TKTLTFSSAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLA  238

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  239  LSEALIAPAM  248



>emb|CDY18717.1| BnaA09g06780D [Brassica napus]
Length=563

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F VP P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  98   PLILSLSVGLILRFAVPLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  ISEALIAPAM  227



>gb|EEE53308.1| hypothetical protein OsJ_36283 [Oryza sativa Japonica Group]
Length=497

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 97/131 (74%), Gaps = 28/131 (21%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            IKPL+A+I TGV++W                             PLPLGAVAL+GLGA V
Sbjct  83   IKPLVATIGTGVLIWL----------------------------PLPLGAVALLGLGAAV  114

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT+TLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLG+R+AY FVS FG SSLGLGY+L
Sbjct  115  LTRTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGSRVAYAFVSAFGGSSLGLGYAL  174

Query  696  vfsEALLAPAI  728
            VF+EALLAPAI
Sbjct  175  VFAEALLAPAI  185



>ref|XP_009112126.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Brassica rapa]
Length=563

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F VP P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  98   PLILSLSVGLILRFAVPLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  ISEALIAPAM  227



>ref|XP_010520862.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Tarenaya 
hassleriana]
Length=564

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            I PL+ S+A G++L F VP+P GV+   WQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  97   ILPLILSVAVGLVLRFAVPKPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTTS  156

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            ++T+TL FAAAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y 
Sbjct  157  IVTRTLPFAAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYG  216

Query  693  lvfsEALLAPAI  728
            L  SEAL+APA+
Sbjct  217  LTLSEALIAPAM  228



>ref|WP_038563803.1| 2-oxoglutarate translocator [Terribacillus aidingensis]
 gb|AIF67752.1| 2-oxoglutarate translocator [Terribacillus aidingensis]
Length=477

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++  GVILWF+P P GV   AW L +IF+ATI+G+I +P+P+G+VA++ L A VLT
Sbjct  16   PLLITVLIGVILWFIPSPDGVKAEAWHLFAIFVATIIGLIIKPMPMGSVAILSLTAIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            KTL    A S F +   WLI +AFF +RGFIKTGLG+RIAY
Sbjct  76   KTLGLEEALSGFSNSTIWLIVIAFFISRGFIKTGLGSRIAY  116



>gb|ABO87605.1| chloroplast glutamate/malate translocator [Pisum sativum]
Length=519

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P L SI+ G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  54   PFLLSISIGLIVRFFVPKPVEVTAQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  113

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y LV
Sbjct  114  TKTLTFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLV  173

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  174  FSEVLIAPAM  183



>ref|XP_010546344.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010546345.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=558

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            I PL+ S+A G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  91   ILPLILSVAVGIILRFAVPIPQGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTTS  150

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            ++T+TL FAAAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y 
Sbjct  151  IVTRTLPFAAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYG  210

Query  693  lvfsEALLAPAI  728
            L  SEAL+APA+
Sbjct  211  LTLSEALIAPAM  222



>gb|EPS71302.1| glutamate/malate translocator [Genlisea aurea]
Length=548

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+A G++  +F+P+P  V+  AWQLLSIFL+T+ G++  PLP+GA A +GL   V+
Sbjct  83   PLLISLAVGIVTRYFIPKPPEVTPQAWQLLSIFLSTVAGLVLSPLPVGAWAFIGLTTAVV  142

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL FAAAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  143  TKTLRFAAAFSAFTSDVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  202

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  203  LSEALIAPAM  212



>gb|KFK28120.1| hypothetical protein AALP_AA8G475200 [Arabis alpina]
Length=559

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  94   PLILSVSVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  153

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  154  TRTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  213

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  214  LSEALIAPAM  223



>ref|XP_007148387.1| hypothetical protein PHAVU_006G204300g [Phaseolus vulgaris]
 gb|ESW20381.1| hypothetical protein PHAVU_006G204300g [Phaseolus vulgaris]
Length=566

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P L SI  G+ + +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  101  PFLISICIGLAVRFFVPKPVEVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTATVV  160

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  161  TKTLTFSAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLT  220

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  221  FSEVLIAPAM  230



>gb|EYU39124.1| hypothetical protein MIMGU_mgv1a003844mg [Erythranthe guttata]
Length=560

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL++S+A G  ++F +P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A +L
Sbjct  95   PLISSLAIGAAVFFLIPRPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTATIL  154

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL FAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  155  TNTLPFAAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIAMYFVKWLGKSTLGLSYGLT  214

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  215  LSEALIAPAM  224



>ref|XP_010461628.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Camelina sativa]
Length=560

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  95   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  154

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  155  TKTLTFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  214

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  215  LSEALIAPAM  224



>ref|XP_010484204.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Camelina 
sativa]
Length=563

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  98   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TKTLTFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  LSEALIAPAM  227



>ref|XP_002323748.1| putative oxoglutarate-malate-translocase family protein [Populus 
trichocarpa]
 gb|EEF03881.1| putative oxoglutarate-malate-translocase family protein [Populus 
trichocarpa]
Length=569

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  104  PLLISVSIGLIVRFAVPKPIEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  163

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TLTF+ AFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  164  TRTLTFSTAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  223

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  224  LSEALIAPAM  233



>emb|CDY43805.1| BnaA06g23410D [Brassica napus]
Length=555

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFLATI G++  PLP+GA A +GL A ++
Sbjct  90   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLATIAGLVLSPLPVGAWAFIGLTASIV  149

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  150  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  209

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  210  LSEALIAPAM  219



>ref|XP_010444361.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Camelina sativa]
Length=563

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  98   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASVV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  LSEALIAPAM  227



>ref|XP_004485598.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Cicer arietinum]
Length=566

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SIA G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  101  PFVISIAIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  160

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  161  TKTLSFTDAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLT  220

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  221  FSEVLIAPAM  230



>ref|XP_006280257.1| hypothetical protein CARUB_v10026173mg [Capsella rubella]
 gb|EOA13155.1| hypothetical protein CARUB_v10026173mg [Capsella rubella]
Length=560

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  95   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  154

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  155  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  214

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  215  LSEALIAPAM  224



>ref|XP_011397588.1| Dicarboxylate transporter 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24700.1| Dicarboxylate transporter 1, chloroplastic [Auxenochlorella protothecoides]
Length=486

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +3

Query  399  GVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAFSAFGDPIPWL  578
            GV   AW+LL IFL TI GIITQPLPLGAVA+MGLGA  LT  LTF AAFSAF + IPWL
Sbjct  42   GVGLPAWRLLGIFLGTIAGIITQPLPLGAVAMMGLGAAQLTGILTFQAAFSAFANEIPWL  101

Query  579  IALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            IA+AF+ + GFI++GLG RIAY  VS+FG ++LGL YSL  +EALLAPAI
Sbjct  102  IAIAFWLSGGFIRSGLGARIAYSIVSVFGKTTLGLTYSLTLAEALLAPAI  151



>emb|CDX81219.1| BnaC09g06300D [Brassica napus]
Length=556

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  91   PLILSLSVGLILRFAVSLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  151  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  210

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  211  ISEALIAPAM  220



>ref|XP_003593234.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
 gb|AES63485.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=567

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P   SI  G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  102  PFAISILIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  161

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  162  TKTLTFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLT  221

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  222  FSEVLIAPAM  231



>ref|XP_006394170.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
 dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31456.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
Length=561

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  96   PLLLSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  155

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  156  TRTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  215

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  216  LSEALIAPAM  225



>ref|XP_010108404.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXC19408.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S+A GV++ +FVP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  100  PLVISVAIGVLVRFFVPKPVEVSAQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTTSIV  159

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F  AFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  160  TKTLSFTTAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  219

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  220  LSEALIAPAM  229



>ref|XP_010272978.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nelumbo nucifera]
Length=572

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P L S++ GVI+ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  107  PFLISVSIGVIVRFIVPKPVEVSLQAWQLLAIFLSTIAGLVLNPLPVGAWAFLGLTTSIV  166

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+ AF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  167  TKTLTFSTAFEAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  226

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  227  LSEALIAPAM  236



>ref|XP_010266911.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nelumbo nucifera]
Length=578

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S+A GVI+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  113  PLVISVAIGVIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  172

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+ AF AF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  173  TKTLSFSTAFGAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  232

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  233  LSEALIAPAM  242



>ref|XP_008346519.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like [Malus 
domestica]
Length=279

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SIA G+++ +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   V+
Sbjct  99   PFIISIAIGIVVRFFVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  158

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  159  TGTLSFPTAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  218

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  219  ISEALIAPAM  228



>ref|XP_009150500.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Brassica 
rapa]
Length=555

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  90   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  149

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  150  TKTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  209

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  210  LSEALIAPAM  219



>ref|XP_003547089.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Glycine max]
Length=562

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  369  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAF  548
            ++ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+TKTLTF AAF
Sbjct  107  IVRFFVPKPVEVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVVTKTLTFTAAF  166

Query  549  SAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            SAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L FSE L+APA+
Sbjct  167  SAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWMGKSTLGLSYGLTFSEVLIAPAM  226



>ref|XP_009381488.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=528

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  154  TKTLTFSAAFDAFENEVIWLIVISFFFARGFVKTGLGDRIATFFVKWLGKSTLGLSYGLT  213

Query  699  fsEALLAPAI  728
            FSEA +APA+
Sbjct  214  FSEAFIAPAM  223



>emb|CDX84512.1| BnaC03g49880D [Brassica napus]
Length=562

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  97   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  156

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+F+AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  157  TRTLSFSAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  216

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  217  LSEALIAPAM  226



>ref|WP_018664356.1| hypothetical protein [Bacillus acidiproducens]
Length=164

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
             L  ++A GVI+W +  P G+   AW L +IF+ATI+G+I +PLP+G +A++ + A VLT
Sbjct  24   SLFITLAAGVIIWLIGAPAGLDEKAWHLFAIFVATIIGLIIKPLPMGGIAILSITAVVLT  83

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL    A S F +   WLI +AFF +RGFIKTGLGNRIAY
Sbjct  84   GTLELQQALSGFQNTTIWLIVIAFFISRGFIKTGLGNRIAY  124



>ref|XP_009381487.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  154  TKTLTFSAAFDAFENEVIWLIVISFFFARGFVKTGLGDRIATFFVKWLGKSTLGLSYGLT  213

Query  699  fsEALLAPAI  728
            FSEA +APA+
Sbjct  214  FSEAFIAPAM  223



>ref|XP_009381486.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=565

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  154  TKTLTFSAAFDAFENEVIWLIVISFFFARGFVKTGLGDRIATFFVKWLGKSTLGLSYGLT  213

Query  699  fsEALLAPAI  728
            FSEA +APA+
Sbjct  214  FSEAFIAPAM  223



>ref|XP_011043103.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Populus euphratica]
Length=569

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  104  PLLISVSIGLIVRFAVPKPIEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  163

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F+ AFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  164  TRTLPFSTAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  223

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  224  LSEALIAPAM  233



>ref|XP_003057697.1| divalent Anion:Na+ symporter family [Micromonas pusilla CCMP1545]
 gb|EEH57648.1| divalent Anion:Na+ symporter family [Micromonas pusilla CCMP1545]
Length=515

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            +KPL  S+  G+I+W +P P GV+  AW L ++F+ TIVGIIT PLPLGA A++GL   +
Sbjct  50   LKPLGYSVLAGLIIWCIPAPVGVTVKAWHLFAVFVGTIVGIITNPLPLGATAMVGLAVSM  109

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +T  L FAAAFSAF   IPWLIA+AFF ARGFIKTGLGNRIAY  VS+FG S+LGL YSL
Sbjct  110  VTGLLPFAAAFSAFSSEIPWLIAIAFFLARGFIKTGLGNRIAYIIVSIFGKSTLGLTYSL  169

Query  696  vfsEALLAPAI  728
            VFSEA+LAPAI
Sbjct  170  VFSEAILAPAI  180



>emb|CDO97413.1| unnamed protein product [Coffea canephora]
Length=562

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            I PL+ S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  95   IIPLIISVSIGLIVRFLVPKPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTA  154

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            +LT+TL F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y 
Sbjct  155  ILTRTLPFTIAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYG  214

Query  693  lvfsEALLAPAI  728
            L  SEAL+APA+
Sbjct  215  LTLSEALIAPAM  226



>ref|WP_025752426.1| 2-oxoglutarate translocator [Bacillus flexus]
Length=477

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +ATG++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLATGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_019392157.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=466

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            + P L +IA GV++WF+P+P GV   AW LL+IF+ATI+G I +PLP+G++A++ L    
Sbjct  3    VVPFLITIAIGVLIWFIPEPSGVDPKAWHLLAIFVATIIGFILKPLPMGSLAILSLAVVA  62

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            +T  LT     S F +   WLI +AFF +RGFIKTGLG RIAY FV  FG  +LGL YSL
Sbjct  63   VTGVLTIDQTLSGFANTTIWLIVIAFFISRGFIKTGLGTRIAYLFVKRFGKKTLGLSYSL  122

Query  696  vfsEALLAPAI  728
            + S+ LLAPAI
Sbjct  123  LVSDLLLAPAI  133



>gb|KFM93392.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=295

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAY  117



>ref|WP_013351349.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CBI41844.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
DSM 7]
 gb|AEB22862.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
TA208]
 gb|AEB62315.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
LL3]
 gb|AEK87860.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
XH7]
 gb|AIW32753.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  75   LTGTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_009366350.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like, partial 
[Pyrus x bretschneideri]
Length=550

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SIA G+++ +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   V+
Sbjct  99   PFIISIAIGIVVRFFVPKPVQVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  158

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  159  TGTLSFPTAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  218

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  219  ISEALIAPAM  228



>gb|KJB32094.1| hypothetical protein B456_005G223500 [Gossypium raimondii]
Length=562

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S++ G+I+ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PLFLSVSIGLIVRFLVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTTSIV  156

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL FA+AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  157  TKTLPFASAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  216

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  217  LSEALIAPAM  226



>ref|WP_032858509.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|KDN91710.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_038829541.1| 2-oxoglutarate translocator, partial [Bacillus subtilis]
Length=450

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_007408966.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillales]
 gb|ABS73157.1| YflS [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 emb|CCG48710.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum YAU B9601-Y2]
 gb|EIF12295.1| 2-oxoglutarate/malate translocator [Bacillus sp. 5B6]
 gb|AFJ60820.1| divalent anion:Na+ symporter, DASS family [Bacillus amyloliquefaciens 
Y2]
 gb|EJD67601.1| YflS [Bacillus sp. 916]
 gb|AFZ89764.1| divalent anion:Na+ symporter, DASS family protein [Bacillus amyloliquefaciens 
subsp. plantarum AS43.3]
 emb|CDG28718.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5033]
 emb|CDG25023.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5113]
 gb|ERH50988.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EGD-AQ14]
 emb|CDH94478.1| Citrate carrier [Bacillus amyloliquefaciens subsp. plantarum 
NAU-B3]
 gb|AGZ55461.1| 2-oxoglutarate/malate translocator [Bacillus amyloliquefaciens 
CC178]
 gb|AHK48341.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum TrigoCor1448]
 gb|EYB35514.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EBL11]
 gb|AHZ14735.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
SQR9]
 gb|KFI14833.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFX40261.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AIU80898.1| Putative malate transporter YflS [Bacillus methylotrophicus]
 gb|AIW29039.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIW36630.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE77762.1| 2-oxoglutarate translocator [Bacillus sp. BH072]
 gb|KIR06440.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum]
 gb|KJD58150.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_015417012.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 emb|CCP20741.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5036]
 gb|AJC24759.1| 2-oxoglutarate translocator [Bacillus sp. Pc3]
 gb|AJH23098.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_003155645.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CCF04276.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum CAU B946]
 gb|EKE46374.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum M27]
 gb|AGF28678.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
IT-45]
 gb|ERK81651.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens UASWS 
BA1]
 gb|AHC41276.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens LFB112]
 gb|AIU76127.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_010942614.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Elaeis 
guineensis]
Length=563

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+++ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  98   PLAISVAIGLVVRFLVPRPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASVV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TKTLSFSAAFRAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGRSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  218  ISEAFIAPAM  227



>gb|EMT05118.1| 2-oxoglutarate/malate translocator, chloroplastic [Aegilops tauschii]
Length=278

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLIASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  151  TGTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGGSTLGLSYGLT  210

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  211  ISEACIAPAM  220



>ref|WP_042634956.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AJK64496.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. amyloliquefaciens KHG19]
Length=478

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAAGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  75   LTGTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_008805911.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Phoenix 
dactylifera]
Length=590

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  125  PLAISLAIGLAVRFLVPRPIEVTSQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASVV  184

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  185  TKTLSFSAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGRSTLGLSYGLT  244

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  245  ISEALIAPAM  254



>ref|WP_039076181.1| 2-oxoglutarate translocator [Bacillus sp. MSP13]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_044163592.1| 2-oxoglutarate translocator [Salinibacillus aidingensis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_003233725.1| 2-oxoglutarate translocator [Bacillus subtilis]
 ref|NP_388638.1| malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
168]
 sp|O34726.1|YFLS_BACSU RecName: Full=Putative malate transporter YflS [Bacillus subtilis 
subsp. subtilis str. 168]
 dbj|BAA22312.1| YflS [Bacillus subtilis]
 emb|CAB12586.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. 168]
 dbj|BAI84272.1| hypothetical protein BSNT_07134 [Bacillus subtilis subsp. natto 
BEST195]
 gb|ADV95745.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BSn5]
 gb|AEP89842.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
subtilis str. RO-NN-1]
 gb|EHA29288.1| hypothetical protein BSSC8_35680 [Bacillus subtilis subsp. subtilis 
str. SC-8]
 gb|AFQ56676.1| 2-oxoglutarate/malate transporter [Bacillus subtilis QB928]
 dbj|BAM49680.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7613]
 dbj|BAM56950.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7003]
 gb|AGA21274.1| Malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
BSP1]
 gb|EME07702.1| Na+ symporter (DASS) family protein [Bacillus subtilis MB73/2]
 gb|AGG60110.1| 2-oxoglutarate/malate transporter YflS [Bacillus subtilis subsp. 
subtilis 6051-HGW]
 gb|AHA76716.1| Putative malate transporter yflS [Bacillus subtilis PY79]
 gb|EXF51708.1| 2-oxoglutarate translocator [Bacillus subtilis QH-1]
 gb|KDE24759.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIC39140.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. JH642 substr. AG174]
 gb|AIC43372.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. AG1839]
 gb|KFC28723.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFH30358.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KFH30640.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 dbj|GAK79227.1| 2-oxoglutarate/malate transporter [Bacillus subtilis Miyagi-4]
 gb|AIX06521.1| Putative malate transporter YflS [Bacillus subtilis]
 emb|CEI55895.1| malate transporter YflS [Bacillus subtilis]
 emb|CEJ76320.1| malate transporter YflS [Bacillus sp.]
 gb|AIY92047.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. 168]
 gb|AIY96359.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE93426.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KIX81986.1| Putative malate transporter YflS [Bacillus subtilis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_010330322.1| 2-oxoglutarate translocator [Bacillus vallismortis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_041057032.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIL30211.1| hypothetical protein B4067_0819 [Bacillus subtilis subsp. subtilis]
 gb|KIN58890.1| hypothetical protein B4145_0772 [Bacillus subtilis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_024715768.1| 2-oxoglutarate translocator [Bacillus tequilensis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y FV  FG  +LGL YSL+F
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISYVFVQKFGKKTLGLSYSLLF  136

Query  702  sEALLAPAI  728
            S+ +L+PAI
Sbjct  137  SDLILSPAI  145



>ref|WP_019257759.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_024120552.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_028402895.1| 2-oxoglutarate translocator [Bacillus panaciterrae]
Length=483

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATI+G+I +PLPLG++A++ L   VLT
Sbjct  22   PLLTCVAIGLILWFITPPSGLDVKAWHLFAIFVATIIGLIIKPLPLGSIAVLSLTIIVLT  81

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY FV LFG  +LGL YSL+ 
Sbjct  82   NTLTLEKSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAYMFVRLFGKKTLGLSYSLIV  141

Query  702  sEALLAPAI  728
            S+ LL+PA+
Sbjct  142  SDLLLSPAM  150



>ref|WP_003239908.1| hypothetical protein [Bacillus subtilis]
 gb|ELS60507.1| hypothetical protein BSI_29070 [Bacillus subtilis subsp. inaquosorum 
KCTC 13429]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_010333359.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_041906771.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|KFI01861.1| 2-oxoglutarate translocator [Bacillus sp. BSC154]
Length=478

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y FV  FG  +LGL YSL+F
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISYVFVQKFGKKTLGLSYSLLF  136

Query  702  sEALLAPAI  728
            S+ +L+PAI
Sbjct  137  SDLILSPAI  145



>ref|WP_024572847.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIU10460.1| 2-oxoglutarate/malate transporter [Bacillus subtilis]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_015383080.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 gb|AGE62620.1| 2-oxoglutarate/malate transporter [Bacillus subtilis XF-1]
 gb|AGI28021.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. BAB-1]
 gb|ERI42751.1| 2-oxoglutarate translocator [Bacillus sp. EGD-AK10]
 gb|AID00435.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. OH 131.1]
 emb|CCU59962.1| 2-oxoglutarate/malate translocator [Bacillus subtilis E1]
 gb|KFF56609.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIN32357.1| hypothetical protein B4068_0716 [Bacillus subtilis]
 gb|KIN34108.1| hypothetical protein B4070_0771 [Bacillus subtilis]
 gb|KIN49661.1| hypothetical protein B4146_0798 [Bacillus subtilis]
 gb|KIN53365.1| hypothetical protein B4073_0722 [Bacillus subtilis]
 gb|KIO54969.1| hypothetical protein B4143_0730 [Bacillus subtilis]
 gb|AJO57407.1| 2-oxoglutarate translocator [Bacillus sp. YP1]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_019713597.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y FV  FG  +LGL YSL+F
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISYVFVQKFGKKTLGLSYSLLF  136

Query  702  sEALLAPAI  728
            S+ +L+PAI
Sbjct  137  SDLILSPAI  145



>ref|XP_009401226.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=562

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  97   PLAISLAVGLAVRFLVPRPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTASVI  156

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  157  TKTLTFSAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  216

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  217  VSEAFIAPAM  226



>gb|KIN32538.1| hypothetical protein B4069_0846 [Bacillus subtilis]
 gb|KIN44477.1| hypothetical protein B4071_0845 [Bacillus subtilis]
 gb|KIN49092.1| hypothetical protein B4072_0842 [Bacillus subtilis]
Length=493

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  32   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  91

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y FV  FG  +LGL YSL+F
Sbjct  92   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISYVFVQKFGKKTLGLSYSLLF  151

Query  702  sEALLAPAI  728
            S+ +L+PAI
Sbjct  152  SDLILSPAI  160



>ref|WP_040083848.1| 2-oxoglutarate translocator [Bacillus sp. A053]
 gb|KIH38638.1| 2-oxoglutarate translocator [Bacillus sp. A053]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y FV  FG  +LGL YSL+F
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISYVFVQKFGKKTLGLSYSLLF  136

Query  702  sEALLAPAI  728
            S+ +L+PAI
Sbjct  137  SDLILSPAI  145



>ref|WP_014113016.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AEP85700.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
spizizenii TU-B-10]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_006492620.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Citrus sinensis]
 gb|KDO45021.1| hypothetical protein CISIN_1g008532mg [Citrus sinensis]
Length=562

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SI+ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PFVISISIGLILRFLVPKPVEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F  AF+AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  157  TRTLAFPTAFAAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  216

Query  699  fsEALLAPAI  728
            FSEAL+APA+
Sbjct  217  FSEALIAPAM  226



>ref|WP_013390434.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 gb|ADP31232.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus 1942]
 gb|AIK49393.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus subsp. 
globigii]
 gb|KFK81246.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus subtilis 
subsp. niger]
 gb|AJF84091.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_006423815.1| hypothetical protein CICLE_v10028114mg [Citrus clementina]
 gb|ESR37055.1| hypothetical protein CICLE_v10028114mg [Citrus clementina]
Length=562

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SI+ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PFVISISIGLILRFLVPKPVEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F  AF+AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  157  TRTLAFPTAFAAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  216

Query  699  fsEALLAPAI  728
            FSEAL+APA+
Sbjct  217  FSEALIAPAM  226



>dbj|BAD19756.1| putative plastidic general dicarboxylate transporter [Oryza sativa 
Japonica Group]
 dbj|BAD22267.1| putative plastidic general dicarboxylate transporter [Oryza sativa 
Japonica Group]
Length=550

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            + PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A 
Sbjct  83   LAPLLVSLAVGLAVRFLAPRPPEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAA  142

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            V T TL FAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y 
Sbjct  143  VATHTLPFAAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGGSTLGLSYG  202

Query  693  lvfsEALLAPAI  728
            L  SEA ++PA+
Sbjct  203  LTISEAFISPAM  214



>ref|WP_010787924.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus]
 gb|EOB38136.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus UCMB-5137]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_004290424.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=545

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            I PL+ S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   
Sbjct  78   IAPLILSVAIGLAVRFLVPKPVQVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTS  137

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            V++ TLTF AAFSAF   + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y 
Sbjct  138  VVSGTLTFPAAFSAFTSEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYG  197

Query  693  lvfsEALLAPAI  728
            L  SEAL+APA+
Sbjct  198  LTISEALIAPAM  209



>ref|XP_012069162.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Jatropha 
curcas]
 gb|KDP40929.1| hypothetical protein JCGZ_24928 [Jatropha curcas]
Length=569

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            I PL+ S++ G++L F +P+P  ++  AWQLL+IF++TI G++  PLP+GA A +GL   
Sbjct  102  IFPLVISVSIGLVLRFCIPRPVEITPQAWQLLAIFISTIAGLVLNPLPVGAWAFLGLTTS  161

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            ++T+TLTF+ AFSAF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y 
Sbjct  162  IVTRTLTFSTAFSAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGKSTLGLSYG  221

Query  693  lvfsEALLAPAI  728
            L  SEAL+APA+
Sbjct  222  LTLSEALIAPAM  233



>gb|EAZ09443.1| hypothetical protein OsI_31717 [Oryza sativa Indica Group]
Length=550

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            + PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A 
Sbjct  83   LAPLLVSLAVGLAVRFLAPRPPEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAA  142

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            V T TL FAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y 
Sbjct  143  VATHTLPFAAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGGSTLGLSYG  202

Query  693  lvfsEALLAPAI  728
            L  SEA ++PA+
Sbjct  203  LTISEAFISPAM  214



>ref|WP_045293908.1| 2-oxoglutarate translocator [Bacillus aryabhattai]
 gb|KJL03397.1| 2-oxoglutarate translocator [Bacillus aryabhattai B8W22]
Length=477

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>gb|ACL52604.1| unknown [Zea mays]
 tpg|DAA40305.1| TPA: 2-oxoglutarate/malate translocator [Zea mays]
Length=530

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  65   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  124

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   GSS+LGL Y L 
Sbjct  125  TRTLPFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGSSTLGLSYGLT  184

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  185  LSEACIAPAM  194



>ref|WP_003328331.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
 gb|EIM09398.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus C89]
Length=478

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIENTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|WP_043977584.1| 2-oxoglutarate translocator [Bacillus aryabhattai]
Length=477

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDLKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_028409745.1| 2-oxoglutarate translocator [Bacillus sp. 171095_106]
Length=477

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_013085539.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADF42029.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium DSM 319]
Length=477

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_016765975.1| 2-oxoglutarate translocator [Bacillus megaterium]
Length=477

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_034648188.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|KFN06787.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus megaterium]
 gb|KGJ85087.1| 2-oxoglutarate translocator [Bacillus megaterium NBRC 15308 = 
ATCC 14581]
 gb|AJI23694.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
megaterium NBRC 15308 = ATCC 14581]
Length=477

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|XP_007042895.1| Dicarboxylate transport 2.1 [Theobroma cacao]
 gb|EOX98726.1| Dicarboxylate transport 2.1 [Theobroma cacao]
Length=564

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P   SI+ G+I+ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  99   PFFVSISIGLIVHFLVPKPVDVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  158

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  159  TRTLPFTTAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKCLGKSTLGLSYGLT  218

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  219  LSEALIAPAM  228



>gb|ACN34632.1| unknown [Zea mays]
 tpg|DAA40306.1| TPA: plastidic general dicarboxylate transporter [Zea mays]
Length=554

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  148

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   GSS+LGL Y L 
Sbjct  149  TRTLPFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGSSTLGLSYGLT  208

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  209  LSEACIAPAM  218



>ref|NP_001104868.1| plastidic general dicarboxylate transporter [Zea mays]
 dbj|BAD06220.1| plastidic general dicarboxylate transporter [Zea mays]
Length=554

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  148

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   GSS+LGL Y L 
Sbjct  149  TRTLPFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGSSTLGLSYGLT  208

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  209  LSEACIAPAM  218



>ref|XP_006827969.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Amborella 
trichopoda]
 gb|ERM95385.1| hypothetical protein AMTR_s00008p00213760 [Amborella trichopoda]
Length=563

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATG-VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + S+A G V+ + VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A MGL   V+
Sbjct  98   PFILSVAVGLVVRYLVPKPVEVTTQAWQLLSIFLSTITGLVLSPLPVGAWAFMGLTTAVI  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+F+ AF AF + + WLI ++FFFARGF+KT LG+RIA  FV   G S+LGL Y L 
Sbjct  158  TRTLSFSLAFEAFTNEVIWLIVISFFFARGFVKTRLGDRIANYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  ISEALIAPAM  227



>ref|WP_029319476.1| 2-oxoglutarate translocator [Bacillus sp. RP1137]
Length=477

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_013059892.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADE72219.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium QM B1551]
Length=477

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_014457694.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|AEN86919.1| Dicarboxylase translocator [Bacillus megaterium WSH-002]
Length=477

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|WP_028411930.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=477

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TLT   + S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  76   NTLTLEQSLSGFQNTTIWLIVIAFFISRGFIKTGLGTRVAY  116



>ref|XP_002460379.1| hypothetical protein SORBIDRAFT_02g027290 [Sorghum bicolor]
 gb|EER96900.1| hypothetical protein SORBIDRAFT_02g027290 [Sorghum bicolor]
Length=557

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  92   PFVISVAVGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  151

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL FAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   GSS+LGL Y L 
Sbjct  152  TRTLPFAAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGSSTLGLSYGLT  211

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  212  ISEACIAPAM  221



>ref|XP_003574657.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Brachypodium 
distachyon]
Length=556

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+AS+A G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLIASVAVGLAVRFLAPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  151  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGGSTLGLSYGLT  210

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  211  ISEACIAPAM  220



>ref|WP_020450525.1| MULTISPECIES: 2-oxoglutarate/malate transporter YflS [Bacillus 
subtilis group]
 gb|AGN35273.1| 2-oxoglutarate/malate transporter YflS [Bacillus licheniformis 
9945A]
 gb|ETB72216.1| 2-oxoglutarate translocator [Bacillus sp. CPSM8]
 gb|KJD54202.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLTVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            + S+ +L+PAI
Sbjct  135  LVSDLILSPAI  145



>ref|XP_011090364.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Sesamum 
indicum]
Length=413

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = +3

Query  495  MGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgsss  674
            MGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSS
Sbjct  1    MGLGACVLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQFVSLFGSSS  60

Query  675  lglgyslvfsEALLAPAI  728
            LGLGYSLVFSEALLAPAI
Sbjct  61   LGLGYSLVFSEALLAPAI  78



>ref|XP_007199747.1| hypothetical protein PRUPE_ppa003588mg [Prunus persica]
 gb|EMJ00946.1| hypothetical protein PRUPE_ppa003588mg [Prunus persica]
Length=563

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SIA G+++ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL + ++
Sbjct  98   PFIISIAIGLVVRFLVPKPVEVSPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTSSIV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TGTLPFTTAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  ISEALIAPAM  227



>ref|XP_001773473.1| predicted protein [Physcomitrella patens]
 gb|EDQ61673.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + S+  G+ L F V +P  VS  AWQLL+IF +TI G++  PLP+GA A +GL   V+
Sbjct  29   PFVLSVGVGLALRFLVKKPEAVSMQAWQLLAIFASTITGLVLSPLPVGAWAFLGLTVAVV  88

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTFAAAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  89   TKTLTFAAAFGAFTNDVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGKSTLGLSYGLA  148

Query  699  fsEALLAPAI  728
             SE LLAPA+
Sbjct  149  LSETLLAPAM  158



>ref|WP_039073282.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|AJO17019.1| YflS protein [Bacillus licheniformis]
Length=478

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            + S+ +L+PAI
Sbjct  135  LVSDLILSPAI  145



>ref|WP_043925701.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|EWH23105.1| 2-oxoglutarate translocator [Bacillus licheniformis S 16]
Length=478

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            + S+ +L+PAI
Sbjct  135  LVSDLILSPAI  145



>ref|XP_002445989.1| hypothetical protein SORBIDRAFT_07g029165 [Sorghum bicolor]
 gb|EES15484.1| hypothetical protein SORBIDRAFT_07g029165, partial [Sorghum bicolor]
Length=497

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V 
Sbjct  32   PLFISLALGLAVRFLVPRPAQVTSQAWQLLSIFLSTIAGLVLAPLPVGAWAFLGLTVTVA  91

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+FAAAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y LV
Sbjct  92   TRTLSFAAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLV  151

Query  699  fsEALLAPAI  728
             SEA+++PA+
Sbjct  152  ISEAVISPAM  161



>ref|WP_026589611.1| 2-oxoglutarate translocator [Bacillus sp. NSP9.1]
Length=478

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++W +P PGG+   AW L +IF+ATI+G I++PLP+GAVA+  L    
Sbjct  15   ILPLAVTILAGAVIWLIPPPGGLDPKAWHLFAIFVATIIGFISKPLPMGAVAIFALAMTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRIFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            +FS+ LLAPAI
Sbjct  135  LFSDLLLAPAI  145



>ref|XP_004957073.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Setaria italica]
Length=549

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S+A G+ + F+ P+P  VS   WQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  84   PLVISVAIGLAVRFLAPRPAEVSLQGWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  143

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   GSS+LGL Y L 
Sbjct  144  TRTLPFTAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGSSTLGLSYGLT  203

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  204  ISEACIAPAM  213



>sp|Q8L7Z9.1|DIT2_SPIOL RecName: Full=Dicarboxylate transporter 2, chloroplastic; AltName: 
Full=Glutamate/malate translocator; Flags: Precursor [Spinacia 
oleracea]
 gb|AAM89396.1| glutamate/malate translocator [Spinacia oleracea]
Length=564

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S++ G++L F VP+P  ++  AWQLL+IFL+T+ G++  PLP+GA A +G+ A V+
Sbjct  99   PLILSVSVGLLLRFAVPKPAELTPQAWQLLAIFLSTVAGLVLSPLPVGAWAFLGVTASVV  158

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL F  AF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  159  TKTLPFPTAFCAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  218

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  219  ISEALVAPAM  228



>ref|XP_004973727.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Setaria italica]
Length=554

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLLISLAAGLAVRFLVPRPAEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  148

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  149  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLA  208

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  209  ISEAFIAPAM  218



>ref|XP_008237290.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Prunus mume]
Length=563

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + S+A G+++ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL + ++
Sbjct  98   PFIISVAIGLVVRFLVPKPVEVSPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTSSIV  157

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  158  TGTLPFTTAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  217

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  218  ISEALIAPAM  227



>ref|WP_018712252.1| hypothetical protein [Campylobacter ureolyticus]
Length=466

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = +3

Query  339  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            K L+     G+++WF+P    VS+ AWQL +I +ATI+G+I QPLP+GAVA +G+ A +L
Sbjct  5    KKLITLFVVGLVIWFIPHSDAVSKEAWQLFAIVVATILGLILQPLPIGAVAFIGVAAAML  64

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+   A + FG    WLI  AF  ARGFIKTGLG RIAY+ +S+ G S+L LGYS+V
Sbjct  65   TNTLSVKEALTGFGSGTIWLIVSAFMIARGFIKTGLGRRIAYKIISILGDSTLRLGYSIV  124

Query  699  fsEALLAPAI  728
             S+A+++PA+
Sbjct  125  ISDAIISPAM  134



>ref|XP_010690536.1| PREDICTED: dicarboxylate transporter 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=559

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ SI+ G+IL F VP+P  ++  AWQLL+IFL+T+ G++  PLP+GA A +G+ A V+
Sbjct  94   PLILSISIGLILRFIVPRPVELTLQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGVTASVV  153

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL F  AF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  154  TKTLPFPTAFCAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  213

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  214  ISEALVAPAM  223



>ref|WP_011197641.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|AAU39715.1| putative malate transporter YflS [Bacillus licheniformis DSM 
13 = ATCC 14580]
 gb|AAU22366.2| putative 2-oxoglutarate/malate translocator [Bacillus licheniformis 
DSM 13 = ATCC 14580]
 gb|KJE31653.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=478

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAITA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            + S+ +L+PAI
Sbjct  135  LVSDLILSPAI  145



>ref|WP_003179716.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|EFV71632.1| YflS protein [Bacillus sp. BT1B_CT2]
 gb|EID49989.1| 2-oxoglutarate/malate translocator [Bacillus licheniformis WX-02]
 gb|EQM29468.1| 2-oxoglutarate translocator [Bacillus licheniformis CG-B52]
Length=478

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAITA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            + S+ +L+PAI
Sbjct  135  LVSDLILSPAI  145



>ref|WP_026578902.1| 2-oxoglutarate translocator [Bacillus sp. SB47]
Length=478

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PL  +I  G ++WF+P P G+   AW L +IF++TI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLTVTILVGAVIWFIPSPAGLDPKAWHLFAIFVSTIIGFISKPLPMGAIAVFALAVTA  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgysl  695
            LT TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL
Sbjct  75   LTGTLSIEETLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSL  134

Query  696  vfsEALLAPAI  728
            + S+ +L+PAI
Sbjct  135  LVSDLILSPAI  145



>ref|XP_007511000.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO66560.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=573

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            +K    S+  G+ + FV P+P GV   AW LLSIFLAT+ G++  PLP+GA A +GL   
Sbjct  108  LKAAAMSVGFGLFVCFVVPRPDGVVPQAWNLLSIFLATVAGLVLSPLPVGAWAFLGLTTA  167

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            V+TKTLTFA AF A  + + WLI LAFFFARGF+ TGLG+RIA  FV   G S+LGL Y 
Sbjct  168  VVTKTLTFAQAFGAMTNDVIWLIVLAFFFARGFVSTGLGDRIATMFVEKLGKSTLGLSYG  227

Query  693  lvfsEALLAPAI  728
            L  SEA+LAPA+
Sbjct  228  LSISEAVLAPAM  239



>ref|XP_010520600.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Tarenaya hassleriana]
Length=498

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  345  LLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            L+ S+A G+IL F VP+P  V+   W+LLSIFL+TI G++  PLP+GA A +GL   +++
Sbjct  34   LIISVAIGLILCFAVPKPKAVTSQGWRLLSIFLSTIAGLVLSPLPVGAWAFIGLTTSIVS  93

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
            +TL FAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G ++LGL Y L+ 
Sbjct  94   RTLPFAAAFSAFLNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKNTLGLSYGLIL  153

Query  702  sEALLAPAI  728
            SEA+++PA+
Sbjct  154  SEAVISPAM  162



>ref|WP_014663179.1| 2-oxoglutarate translocator [Bacillus sp. JS]
 gb|AFI27386.1| 2-oxoglutarate/malate translocator [Bacillus sp. JS]
Length=478

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+       FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  77   GTLSIEDTLIGFGNKTIWLIVIAFFISRGFIKTGLGARISY  117



>ref|XP_008382044.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like [Malus 
domestica]
Length=565

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SIA G+ + +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A  +
Sbjct  100  PFIISIAVGIAVRFFVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASXV  159

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+F  AF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  160  TGTLSFPTAFGAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  219

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  220  ISEALIAPAM  229



>ref|WP_036200998.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis]
 gb|KGR75386.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis BLB-1 
= JCM 15800]
Length=478

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            I PLL  I  G ++W +P PGG+   AW L +IF+ATI+G+I +P+P+G++A++ L    
Sbjct  15   IIPLLVVILIGAVIWLIPPPGGLQVQAWHLFAIFVATIIGLIIKPIPMGSMAILALTVIT  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
            +TKTLT   A S F +   WLI +AFF +RGFIKTGLG R+AY
Sbjct  75   VTKTLTLEEALSGFQNSTIWLIVIAFFISRGFIKTGLGTRVAY  117



>ref|WP_041581256.1| 2-oxoglutarate translocator [Bacillus sp. 1NLA3E]
Length=481

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL +I  GV LW +  P G+   AW L +IF+ATIVG++++P+P+G+VA++ L A VLT
Sbjct  20   PLLITIIVGVALWMITPPAGLDVQAWHLFAIFVATIVGLVSKPMPMGSVAILALTATVLT  79

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQ  647
            +TLT   A + F +   WLI +AFF +RGFIKTGLG+R+AY 
Sbjct  80   QTLTIDQALTGFQNSTIWLIVIAFFISRGFIKTGLGSRVAYM  121



>ref|XP_002445990.1| hypothetical protein SORBIDRAFT_07g029170 [Sorghum bicolor]
 gb|EES15485.1| hypothetical protein SORBIDRAFT_07g029170 [Sorghum bicolor]
Length=551

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLLISLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLA  205

Query  699  fsEALLAPAI  728
             SEA ++PA+
Sbjct  206  ISEAFISPAM  215



>tpg|DAA47747.1| TPA: hypothetical protein ZEAMMB73_941040 [Zea mays]
Length=513

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLA  205

Query  699  fsEALLAPAI  728
             SEAL++PA+
Sbjct  206  ISEALISPAM  215



>gb|AGK55800.1| divalent anion:Na+ symporter (DASS) family transporter [Bacillus 
sp. 1NLA3E]
Length=491

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL +I  GV LW +  P G+   AW L +IF+ATIVG++++P+P+G+VA++ L A VLT
Sbjct  30   PLLITIIVGVALWMITPPAGLDVQAWHLFAIFVATIVGLVSKPMPMGSVAILALTATVLT  89

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQ  647
            +TLT   A + F +   WLI +AFF +RGFIKTGLG+R+AY 
Sbjct  90   QTLTIDQALTGFQNSTIWLIVIAFFISRGFIKTGLGSRVAYM  131



>ref|XP_001422207.1| DASS family transporter: 2-oxoglutarate/malate [Ostreococcus 
lucimarinus CCE9901]
 gb|ABP00524.1| DASS family transporter: 2-oxoglutarate/malate [Ostreococcus 
lucimarinus CCE9901]
Length=527

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL AS+  G+++ F VP+P  V   AW LLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  64   PLAASVGVGLVVNFIVPRPEAVVPQAWALLSIFLSTICGLVLGPLPVGAWAFVGLTTAVV  123

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTL+F AAF A  + + WLI LAFFFARGF++TGLG+R+A  FV   G S+LGL Y L 
Sbjct  124  TKTLSFQAAFGAMTNDVIWLIVLAFFFARGFVRTGLGDRVATMFVRALGKSTLGLSYGLT  183

Query  699  fsEALLAPAI  728
             SEALLAPA+
Sbjct  184  ISEALLAPAM  193



>ref|XP_006660729.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Oryza brachyantha]
Length=552

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+A G+ + F+ P+P  VS  AWQ LS+FL+TI G++  PLP+GA A +GL A V 
Sbjct  87   PLLVSLAVGLAVRFLAPRPPEVSPQAWQRLSVFLSTIAGLVLGPLPVGAWAFLGLTAAVA  146

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL FAAAFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  147  THTLPFAAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGGSTLGLSYGLT  206

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  207  ISEAFIAPAM  216



>dbj|BAD09285.1| putative glutamate/malate translocator [Oryza sativa Japonica 
Group]
 dbj|BAD10286.1| putative glutamate/malate translocator [Oryza sativa Japonica 
Group]
 gb|EAZ43108.1| hypothetical protein OsJ_27699 [Oryza sativa Japonica Group]
Length=555

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+A G+ + F+ P+P  V+  AWQLLSIFL TI G++  PLP+GA A +GL A V 
Sbjct  90   PLLVSLAVGLAVRFLAPRPAEVTPQAWQLLSIFLTTIAGLVLGPLPVGAWAFLGLTATVA  149

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  150  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLA  209

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  210  ISEACIAPAM  219



>ref|NP_001104869.1| plastidic general dicarboxylate transporter [Zea mays]
 dbj|BAD06221.1| plastidic general dicarboxylate transporter [Zea mays]
 gb|ACN30635.1| unknown [Zea mays]
 tpg|DAA47746.1| TPA: plastidic general dicarboxylate transporter [Zea mays]
Length=551

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLA  205

Query  699  fsEALLAPAI  728
             SEAL++PA+
Sbjct  206  ISEALISPAM  215



>emb|CAN78375.1| hypothetical protein VITISV_000698 [Vitis vinifera]
Length=564

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SI+ G+I+ F VP+P  VS  AWQLL+IFL+T+ G++  PLP+GA A +GL   +L
Sbjct  99   PFIISISIGLIVRFLVPKPVQVSMQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGLXTSIL  158

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+F+ AF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  159  TNTLSFSTAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVANYFVKWLGKSTLGLSYGLT  218

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  219  FSEILIAPAM  228



>dbj|BAD06222.1| plastidic general dicarboxylate transporter [Zea mays]
Length=551

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  146  TRTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGRSTLGLSYGLA  205

Query  699  fsEALLAPAI  728
             SEAL++PA+
Sbjct  206  ISEALISPAM  215



>dbj|BAJ99052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLVASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  151  TGTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGGSTLGLSYGLT  210

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  211  ISEACIAPAM  220



>dbj|BAK03702.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLVASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL F AAF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  151  TGTLPFTAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVATYFVKWLGGSTLGLSYGLT  210

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  211  ISEACIAPAM  220



>dbj|BAJ86680.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL+ S+A G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V 
Sbjct  89   PLVVSLAAGLAVRFLAPRPAEVTLQAWQLLSIFLSTIAGLVLGPLPVGAWAFVGLTTAVA  148

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F AAFSAF + + WLI ++FFFARGF+KTGLG+RIA  F+   G S+LGL Y L 
Sbjct  149  TQTLPFEAAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFIKWLGGSTLGLSYGLT  208

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  209  VSEACIAPAM  218



>emb|CDP01518.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + S++ G+I  F VP+P  +SR +WQLLSIFL TI G+I  PLP+GA A+  L   V+
Sbjct  53   PFIISVSIGIIFNFAVPKPHQLSRKSWQLLSIFLTTISGLILSPLPVGAWAMFCLTLTVI  112

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF  AFSAF + + WLI ++FFF++GF+KTGLG R+A  FV   G ++LGL Y LV
Sbjct  113  TKTLTFMQAFSAFTNEVIWLIVISFFFSKGFVKTGLGERVAMMFVKWLGKNTLGLSYGLV  172

Query  699  fsEALLAPAI  728
             SEA ++PA+
Sbjct  173  LSEAAISPAM  182



>ref|WP_016645858.1| divalent anion:Na+ symporter (DASS) family transporter [Campylobacter 
ureolyticus]
 gb|EPH10223.1| divalent anion:Na+ symporter (DASS) family transporter [Campylobacter 
ureolyticus ACS-301-V-Sch3b]
Length=466

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = +3

Query  339  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            K L+     G+++WF+P    +S+ AWQL +I +ATI+G+I QPLP+GAVA +G+ A +L
Sbjct  5    KKLITLFVVGLVIWFIPHSDALSKEAWQLFAIVVATILGLILQPLPIGAVAFIGVAAAML  64

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+   A + FG    WLI  AF  ARGFIKTGLG RIAY+ +S+ G S+L LGYS+V
Sbjct  65   TNTLSVKEALTGFGSGTIWLIVSAFMIARGFIKTGLGRRIAYKIISILGDSTLRLGYSIV  124

Query  699  fsEALLAPAI  728
             S+A+++PA+
Sbjct  125  ISDAIISPAM  134



>ref|XP_002994720.1| hypothetical protein SELMODRAFT_237013 [Selaginella moellendorffii]
 gb|EFJ04214.1| hypothetical protein SELMODRAFT_237013 [Selaginella moellendorffii]
Length=507

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S++ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  31   PLAISVSVGLILRFLVPKPAAVSAQAWQLLSIFLSTITGLVLSPLPVGAWAFVGLTTTVL  90

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+FA+AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  91   TRTLSFASAFSAFTNDVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  150

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  151  VSEALIAPAM  160



>ref|WP_003223030.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|EFG91812.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
ATCC 6633]
 gb|ADM36825.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
str. W23]
 gb|KFK80732.1| 2-oxoglutarate/malate translocator [Bacillus subtilis]
 gb|AJD35451.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. spizizenii]
 gb|AJW86241.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=477

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLL-TVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  75

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL+     S FG+   WLI +AFF +RGFIKTGLG RI+Y
Sbjct  76   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARISY  116



>ref|XP_010648147.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Vitis vinifera]
Length=573

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P + SI+ G+I+ F VP+P  VS  AWQLL+IFL+T+ G++  PLP+GA A +GL   +L
Sbjct  108  PFIISISIGLIVRFLVPKPVQVSMQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGLTTSIL  167

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL+F+ AF AF + + WLI ++FFFARGF+KTGLG+R+A  FV   G S+LGL Y L 
Sbjct  168  TNTLSFSTAFGAFTNEVIWLIVISFFFARGFVKTGLGDRVANYFVKWLGKSTLGLSYGLT  227

Query  699  fsEALLAPAI  728
            FSE L+APA+
Sbjct  228  FSEILIAPAM  237



>ref|XP_002500710.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
 gb|ACO61968.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
Length=456

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  369  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAF  548
            V+ + +P P GV   AW LL+IFL+TI G++  PLP+GA A  GL  CV+TKTLTF  AF
Sbjct  2    VVKFVIPCPAGVLPQAWTLLAIFLSTIAGLVLTPLPVGAWAFCGLSMCVVTKTLTFQQAF  61

Query  549  SAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
            SA  + + WLI LAFFFA+GF++TGLG+R+A  FV + G S+LGL Y L  SEALLAPA+
Sbjct  62   SAMTNDVIWLIVLAFFFAKGFVQTGLGDRVATWFVKMLGKSTLGLSYGLSISEALLAPAM  121



>ref|WP_014097116.1| 2-oxoglutarate translocator [Bacillus coagulans]
 gb|AEP01032.1| anion transporter [Bacillus coagulans 36D1]
Length=475

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            ++ L  ++A G ++WF+P P  +   AW L +IF+ATIVG I +PLP+G VA++ + A V
Sbjct  13   LRALCITLAIGAVIWFIPSPVDLQEKAWHLFAIFVATIVGFIIKPLPMGGVAILSITAVV  72

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQ  647
            LT TL    A S F +   WLI +AFF +RGFIKTGLGNRIAY 
Sbjct  73   LTGTLKLEEALSGFQNTTIWLIVIAFFISRGFIKTGLGNRIAYM  116



>ref|WP_042357669.1| 2-oxoglutarate translocator [Bacillus sp. MT2]
Length=490

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 68/101 (67%), Gaps = 0/101 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            PLL +IA G   W +P P G+  NAW LL IF+ATI G+I++PLP+GA+ ++ +   VLT
Sbjct  29   PLLITIAIGAAFWIIPAPSGLEVNAWHLLGIFIATIFGVISKPLPMGAICIVAITITVLT  88

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
             TL    A S F +   WLI  AF  +RGF+KTGLGNRIAY
Sbjct  89   GTLKLEEALSGFSNSTIWLIVCAFLISRGFVKTGLGNRIAY  129



>ref|XP_002974927.1| hypothetical protein SELMODRAFT_267817 [Selaginella moellendorffii]
 gb|EFJ23712.1| hypothetical protein SELMODRAFT_267817 [Selaginella moellendorffii]
Length=549

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S++ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  84   PLAISVSVGLILRFLVPKPAAVSAQAWQLLSIFLSTITGLVLSPLPVGAWAFVGLTTTVL  143

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+FA+AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  144  TRTLSFASAFSAFTNDVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  203

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  204  VSEALIAPAM  213



>ref|WP_006637412.1| sodium/sulfate symporter YflS [Bacillus sonorensis]
 gb|EME75561.1| sodium/sulfate symporter YflS [Bacillus sonorensis L12]
Length=478

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  521
            P +  +  GV++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PFIIMVLAGVVIWFIPVPAGLDVKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTALT  76

Query  522  KTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvf  701
             TL+     S FG+   WLI +AFF +RGFIKTGLG RIAY FV +FG  +LGL YSL+F
Sbjct  77   GTLSIEDTLSGFGNKTIWLIVIAFFISRGFIKTGLGARIAYLFVRMFGKKTLGLSYSLLF  136

Query  702  sEALLAPAI  728
            S+ +L+PAI
Sbjct  137  SDLILSPAI  145



>ref|XP_002988946.1| hypothetical protein SELMODRAFT_129026 [Selaginella moellendorffii]
 gb|EFJ09975.1| hypothetical protein SELMODRAFT_129026 [Selaginella moellendorffii]
Length=561

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S++ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  96   PLAISVSVGLILRFLVPKPAAVSAQAWQLLSIFLSTITGLVLSPLPVGAWAFIGLTTTVL  155

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL+FA+AFSAF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  156  TRTLSFASAFSAFTNDVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  215

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  216  VSEALIAPAM  225



>ref|XP_003578268.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Brachypodium distachyon]
Length=550

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   V 
Sbjct  85   PLLVSLALGLAVRFLAPRPLEVSLQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTVAVA  144

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T+TL F  AFSAF + + WLI ++FFFARGF+KTGLG+RIA  F+   G S+LGL Y L 
Sbjct  145  TRTLPFGVAFSAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFIKWLGGSTLGLSYGLT  204

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  205  ISEACIAPAM  214



>ref|XP_003531538.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Glycine max]
Length=557

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +3

Query  369  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTFAAAF  548
            ++ + VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+TKTLTF  AF
Sbjct  102  IVRFLVPKPVQVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVVTKTLTFTEAF  161

Query  549  SAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslvfsEALLAPAI  728
             AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L FSE L+APA+
Sbjct  162  GAFTNEVIWLIVISFFFARGFVKTGLGDRIATFFVKWMGKSTLGLSYGLTFSEVLIAPAM  221



>emb|CDY31328.1| BnaA02g34130D [Brassica napus]
Length=557

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  SI+ G+I+ F +P+P  V+   WQLLS+FL TI G++  PLP+GA A +GL A ++
Sbjct  92   PLAISISIGLIVRFLIPKPEQVTSQGWQLLSVFLFTISGLVLGPLPVGAWAFIGLTASIV  151

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            T+TL+F+ AF+AF + + WLIA++FFFARGF+KTGLG+RIA
Sbjct  152  TRTLSFSTAFAAFTNELIWLIAISFFFARGFVKTGLGDRIA  192



>ref|XP_010461605.1| PREDICTED: dicarboxylate transporter 2.2, chloroplastic [Camelina 
sativa]
Length=549

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  SI+ G+I+ F+ P+P  V+   WQLLS+FL TI G++  PLP+GA A +GL A ++
Sbjct  84   PLAISISIGLIVRFIIPRPEQVTSQGWQLLSVFLFTISGLVLGPLPVGAWAFIGLTASIV  143

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            TKTL F+ AF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  144  TKTLPFSTAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  184



>ref|XP_009380879.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=561

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P   S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PL +GA A +GL A ++
Sbjct  96   PFAISVAIGLAVRFLVPRPVDVTPQAWQLLAIFLSTIAGLVLSPLSVGAWAFIGLTASII  155

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            TKTLTF+AAF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  156  TKTLTFSAAFGAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGRSTLGLSYGLT  215

Query  699  fsEALLAPAI  728
             SEA +APA+
Sbjct  216  ISEAFIAPAM  225



>ref|XP_002866606.1| DIT2.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42865.1| DIT2.2 [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  SI+ G+I+ F +P+P  V+   WQLLSIFL TI G++  PLP+GA A +GL A ++
Sbjct  86   PLTISISIGLIVRFLIPRPEQVTSQGWQLLSIFLFTISGLVLGPLPVGAWAFIGLTASIV  145

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            TKTL F+ AF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  146  TKTLPFSTAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  186



>ref|NP_201233.1| dicarboxylate transporter 2.2 [Arabidopsis thaliana]
 sp|Q9FMF8.1|DIT22_ARATH RecName: Full=Dicarboxylate transporter 2.2, chloroplastic; AltName: 
Full=AtpDCT2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09859.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAK76567.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AAM91759.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AED97865.1| dicarboxylate transporter 2.2 [Arabidopsis thaliana]
Length=549

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S++ G+I+ F +P+P  V+   WQLLSIFL TI G++  PLP+GA A +GL A ++
Sbjct  84   PLAISVSIGLIVRFLIPRPEQVTSQGWQLLSIFLFTISGLVLGPLPVGAWAFIGLTASIV  143

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            TKTL F+ AF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  144  TKTLPFSTAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  184



>ref|XP_006394171.1| hypothetical protein EUTSA_v10003941mg [Eutrema salsugineum]
 gb|ESQ31457.1| hypothetical protein EUTSA_v10003941mg [Eutrema salsugineum]
Length=551

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PLL S+  G+ + F +P+P  V+   WQLLS+FL TI G++  PLP+GA + +GL A V+
Sbjct  86   PLLISVLIGLTVRFLIPRPEQVTSQGWQLLSVFLFTISGLVLGPLPVGAWSFVGLTASVV  145

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            T+TL+F+AAF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  146  TRTLSFSAAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  186



>dbj|BAK44253.1| dicarboxylate transporter [Eggerthella sp. YY7918]
Length=492

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  354  SIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  533
            S+A GV+LWFVP P G+   AW + +IF ATIV +I +P+P+G++A+  +  CVLT T +
Sbjct  35   SVAIGVVLWFVPTPAGLETQAWHMFAIFAATIVALIIKPMPMGSIAICAIALCVLTNTTS  94

Query  534  FAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
                 S F +   WLI +AFF +RGFIKTGLG+R+AY
Sbjct  95   LKDGLSGFSNTTIWLIVIAFFISRGFIKTGLGSRVAY  131



>ref|WP_041690951.1| 2-oxoglutarate translocator [Eggerthella sp. YY7918]
Length=473

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  354  SIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  533
            S+A GV+LWFVP P G+   AW + +IF ATIV +I +P+P+G++A+  +  CVLT T +
Sbjct  16   SVAIGVVLWFVPTPAGLETQAWHMFAIFAATIVALIIKPMPMGSIAICAIALCVLTNTTS  75

Query  534  FAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAY  644
                 S F +   WLI +AFF +RGFIKTGLG+R+AY
Sbjct  76   LKDGLSGFSNTTIWLIVIAFFISRGFIKTGLGSRVAY  112



>ref|WP_042744509.1| 2-oxoglutarate translocator, partial [Oenococcus oeni]
Length=163

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  357  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTF  536
            IA G+ILW +P P G+  +AW LL+IF+ TIVGIIT PLP+GAV+++GL   +LT TLT 
Sbjct  9    IAVGIILWLIPAPVGIKIHAWHLLAIFIGTIVGIITGPLPMGAVSMLGLVLVMLTGTLTP  68

Query  537  AAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
             AAF+ F     WLI  AFF AR  IK+GLG RIA
Sbjct  69   DAAFTGFSQETVWLIVAAFFIARSIIKSGLGFRIA  103



>ref|XP_009130447.1| PREDICTED: dicarboxylate transporter 2.2, chloroplastic [Brassica 
rapa]
Length=556

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  SI+ G+I+ F +P+P  V+   WQLLS+FL TI G++  PLP+GA A +GL A ++
Sbjct  91   PLAVSISIGLIVRFLIPRPEQVTPQGWQLLSVFLFTISGLVLGPLPVGAWAFIGLTASIV  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            T+TL+F+ AF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  151  TRTLSFSTAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  191



>gb|KFK28119.1| hypothetical protein AALP_AA8G475100 [Arabis alpina]
Length=556

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  SI+ G+I+ F+ P+P  V+   WQLLSIF+ TI+G++  PLP+GA A +GL A ++
Sbjct  91   PLAISISIGLIVRFIIPKPEPVTSQGWQLLSIFIFTILGLVLGPLPVGAWAFIGLTASIV  150

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            TKTL F+ AF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  151  TKTLPFSTAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  191



>ref|XP_010484203.1| PREDICTED: dicarboxylate transporter 2.2, chloroplastic-like 
[Camelina sativa]
Length=548

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +3

Query  342  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            PL  S++ G+I+ F+ P+P  V+   WQLLS+FL TI G++  PLP+GA A +GL A ++
Sbjct  83   PLAISVSIGLIVRFIIPRPEQVTSQGWQLLSVFLFTISGLVLGPLPVGAWAFIGLTASIV  142

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
            TKTL F+ AF+AF + + WLIA++FFFARGFIKTGLG+RIA
Sbjct  143  TKTLPFSTAFAAFTNELIWLIAISFFFARGFIKTGLGDRIA  183



>ref|WP_026684112.1| 2-oxoglutarate translocator [Bacillus coagulans]
Length=477

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 0/104 (0%)
 Frame = +3

Query  336  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  515
            ++ L  ++  G ++WF+P P  +   AW L +IF+ATIVG I +PLP+G VA++ + A V
Sbjct  15   LRALCITLVIGAVIWFIPSPVDLQEKAWHLFAIFVATIVGFIIKPLPMGGVAILSITAVV  74

Query  516  LTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQ  647
            LT TL    A S F +   WLI +AFF +RGFIKTGLGNRIAY 
Sbjct  75   LTGTLKLEEALSGFQNTTIWLIVIAFFISRGFIKTGLGNRIAYM  118



>gb|KGH77071.1| 2-oxoglutarate translocator, partial [Oenococcus oeni IOEB_9304]
Length=179

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  357  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLTF  536
            IA G+ILW +P P G+  +AW LL+IF+ TIVGIIT PLP+GAV+++GL   +LT TLT 
Sbjct  25   IAVGIILWLIPAPVGIKIHAWHLLAIFIGTIVGIITGPLPMGAVSMLGLVLVMLTGTLTP  84

Query  537  AAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIA  641
             AAF+ F     WLI  AFF AR  IK+GLG RIA
Sbjct  85   DAAFTGFSQETVWLIVAAFFIARSIIKSGLGFRIA  119



>gb|KJB79625.1| hypothetical protein B456_013G059600 [Gossypium raimondii]
Length=384

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +3

Query  342  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  518
            P L SI+ G+I+ F +P P  V+  AWQL +IFL+TI G++  PLP+GA A +GL   ++
Sbjct  104  PFLISISIGLIVRFLIPIPVEVTLQAWQLFAIFLSTITGLVLSPLPVGAWAFLGLTTSIV  163

Query  519  TKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgyslv  698
            T TL F  AF AF + + WLI ++FFFARGF+KTGLG+RIA  FV   G S+LGL Y L 
Sbjct  164  TGTLPFTTAFGAFTNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLT  223

Query  699  fsEALLAPAI  728
             SEAL+APA+
Sbjct  224  LSEALIAPAM  233



>emb|CEG00699.1| Sodium/sulphate symporter [Ostreococcus tauri]
Length=552

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  336  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  512
            +KPL AS+A G+ + FV P+P  V   AW LL+IFL+TI G++  PLP+GA A +GL   
Sbjct  87   LKPLAASVAVGLAINFVVPRPEAVVPQAWALLAIFLSTISGLVLSPLPVGAWAFVGLTTA  146

Query  513  VLTKTLTFAAAFSAFGDPIPWLIALAFFFARGFIKTGLGNRIAYQfvslfgssslglgys  692
            V+T TL+F  AF+A  + + WLI LAFFFARGF++TGLG+R+A  FV   G S+LGL Y 
Sbjct  147  VVTGTLSFQNAFAAMTNDVIWLIVLAFFFARGFVRTGLGDRVATMFVRALGKSTLGLSYG  206

Query  693  lvfsEALLAPAI  728
            L  SEA+LAPA+
Sbjct  207  LTISEAILAPAM  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1350961752362