BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8772

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622148.1|  PREDICTED: fumarate hydratase 1, mitochondri...    414   1e-139   Nicotiana tomentosiformis
ref|XP_009778286.1|  PREDICTED: fumarate hydratase 1, mitochondri...    414   1e-139   Nicotiana sylvestris
gb|KJB09427.1|  hypothetical protein B456_001G141300                    406   1e-136   Gossypium raimondii
ref|XP_007051015.1|  Fumarase 1 isoform 1                               402   9e-135   Theobroma cacao [chocolate]
ref|XP_007051016.1|  Fumarase 1 isoform 2                               401   1e-134   Theobroma cacao [chocolate]
ref|XP_006359871.1|  PREDICTED: fumarate hydratase 1, mitochondri...    400   2e-134   
ref|XP_006480011.1|  PREDICTED: fumarate hydratase 1, mitochondri...    400   1e-133   
ref|XP_004247395.1|  PREDICTED: fumarate hydratase 1, mitochondrial     398   2e-133   Solanum lycopersicum
gb|KDO87115.1|  hypothetical protein CISIN_1g010908mg                   396   3e-133   Citrus sinensis [apfelsine]
ref|XP_008235134.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    397   3e-133   
ref|XP_012082825.1|  PREDICTED: fumarate hydratase 1, mitochondrial     397   7e-133   Jatropha curcas
ref|XP_002523133.1|  aspartate ammonia lyase, putative                  395   1e-132   
gb|KDO87114.1|  hypothetical protein CISIN_1g010908mg                   396   1e-132   Citrus sinensis [apfelsine]
ref|XP_006444417.1|  hypothetical protein CICLE_v10019838mg             396   1e-132   Citrus clementina
ref|XP_006444418.1|  hypothetical protein CICLE_v10019838mg             396   2e-132   Citrus clementina
ref|XP_007200983.1|  hypothetical protein PRUPE_ppa004758mg             396   2e-132   Prunus persica
gb|EYU46762.1|  hypothetical protein MIMGU_mgv1a005258mg                392   4e-131   Erythranthe guttata [common monkey flower]
ref|XP_011079617.1|  PREDICTED: fumarate hydratase 1, mitochondrial     392   4e-131   Sesamum indicum [beniseed]
ref|XP_011458750.1|  PREDICTED: fumarate hydratase 1, mitochondri...    390   3e-130   Fragaria vesca subsp. vesca
ref|XP_011458749.1|  PREDICTED: fumarate hydratase 1, mitochondri...    390   3e-130   Fragaria vesca subsp. vesca
ref|NP_001275422.1|  fumarate hydratase 1, mitochondrial-like           390   3e-130   Solanum tuberosum [potatoes]
ref|XP_010259454.1|  PREDICTED: fumarate hydratase 1, mitochondrial     389   7e-130   Nelumbo nucifera [Indian lotus]
ref|XP_010069886.1|  PREDICTED: fumarate hydratase 1, mitochondrial     388   3e-129   Eucalyptus grandis [rose gum]
emb|CDY57717.1|  BnaC04g51900D                                          387   3e-129   Brassica napus [oilseed rape]
ref|XP_006397946.1|  hypothetical protein EUTSA_v10001422mg             387   5e-129   Eutrema salsugineum
emb|CDP17101.1|  unnamed protein product                                386   1e-128   Coffea canephora [robusta coffee]
ref|XP_004240578.1|  PREDICTED: fumarate hydratase 1, mitochondri...    385   2e-128   Solanum lycopersicum
ref|XP_009142525.1|  PREDICTED: fumarate hydratase 1, mitochondrial     385   2e-128   Brassica rapa
ref|XP_002880309.1|  hypothetical protein ARALYDRAFT_483931             385   3e-128   Arabidopsis lyrata subsp. lyrata
ref|XP_008386708.1|  PREDICTED: fumarate hydratase 1, mitochondrial     387   4e-128   
ref|NP_182273.1|  fumarate hydratase 1                                  384   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010680310.1|  PREDICTED: fumarate hydratase 1, mitochondrial     384   6e-128   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX80112.1|  BnaA05g00440D                                          384   6e-128   Brassica napus [oilseed rape]
dbj|BAH19491.1|  AT2G47510                                              384   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523964.1|  PREDICTED: fumarate hydratase 1, mitochondrial     383   1e-127   Tarenaya hassleriana [spider flower]
ref|XP_010507880.1|  PREDICTED: fumarate hydratase 1, mitochondri...    382   3e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006296086.1|  hypothetical protein CARUB_v10025236mg             382   3e-127   Capsella rubella
ref|XP_010506787.1|  PREDICTED: fumarate hydratase 1, mitochondri...    382   6e-127   Camelina sativa [gold-of-pleasure]
ref|XP_002283168.2|  PREDICTED: fumarate hydratase 1, mitochondrial     382   6e-127   Vitis vinifera
ref|XP_010245463.1|  PREDICTED: fumarate hydratase 1, mitochondri...    384   7e-127   Nelumbo nucifera [Indian lotus]
ref|XP_002273033.1|  PREDICTED: fumarate hydratase 1, mitochondrial     381   1e-126   Vitis vinifera
ref|XP_010507882.1|  PREDICTED: fumarate hydratase 1, mitochondri...    381   1e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010518455.1|  PREDICTED: fumarate hydratase 1, mitochondri...    381   1e-126   Camelina sativa [gold-of-pleasure]
ref|XP_002302734.1|  Fumarate hydratase 1 family protein                380   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011007799.1|  PREDICTED: fumarate hydratase 1, mitochondrial     380   2e-126   Populus euphratica
ref|XP_009346608.1|  PREDICTED: fumarate hydratase 1, mitochondrial     380   2e-126   Pyrus x bretschneideri [bai li]
ref|XP_008790868.1|  PREDICTED: fumarate hydratase 1, mitochondri...    379   7e-126   Phoenix dactylifera
ref|XP_010938348.1|  PREDICTED: fumarate hydratase 1, mitochondrial     378   2e-125   Elaeis guineensis
ref|XP_007145184.1|  hypothetical protein PHAVU_007G217600g             376   7e-125   Phaseolus vulgaris [French bean]
ref|XP_008345222.1|  PREDICTED: fumarate hydratase 1, mitochondrial     376   1e-124   Malus domestica [apple tree]
gb|AAB39989.1|  fumarase                                                375   1e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378742.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    378   2e-124   Pyrus x bretschneideri [bai li]
ref|XP_009384520.1|  PREDICTED: fumarate hydratase 1, mitochondrial     371   8e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008454312.1|  PREDICTED: fumarate hydratase 1, mitochondrial     370   1e-122   Cucumis melo [Oriental melon]
ref|XP_009802913.1|  PREDICTED: fumarate hydratase 1, mitochondrial     369   2e-122   Nicotiana sylvestris
ref|XP_004152237.1|  PREDICTED: fumarate hydratase 1, mitochondrial     369   6e-122   Cucumis sativus [cucumbers]
ref|XP_010482421.1|  PREDICTED: fumarate hydratase 2, chloroplast...    367   2e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010442577.1|  PREDICTED: fumarate hydratase 2, chloroplast...    367   3e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010442576.1|  PREDICTED: fumarate hydratase 2, chloroplast...    367   4e-121   Camelina sativa [gold-of-pleasure]
emb|CDY27481.1|  BnaC04g51220D                                          366   5e-121   Brassica napus [oilseed rape]
ref|NP_199908.1|  fumarate hydratase 2                                  366   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442609.1|  PREDICTED: fumarate hydratase 2, chloroplast...    366   7e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010442613.1|  PREDICTED: fumarate hydratase 2, chloroplast...    366   8e-121   Camelina sativa [gold-of-pleasure]
ref|XP_004495932.1|  PREDICTED: fumarate hydratase 1, mitochondri...    366   9e-121   Cicer arietinum [garbanzo]
ref|XP_006280350.1|  hypothetical protein CARUB_v10026277mg             366   1e-120   Capsella rubella
ref|NP_851166.1|  fumarate hydratase 2                                  365   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442599.1|  PREDICTED: fumarate hydratase 2, chloroplastic     365   3e-120   Camelina sativa [gold-of-pleasure]
ref|XP_002864085.1|  hypothetical protein ARALYDRAFT_495160             364   4e-120   Arabidopsis lyrata subsp. lyrata
gb|ACJ85812.1|  unknown                                                 359   4e-120   Medicago truncatula
ref|XP_003557953.1|  PREDICTED: fumarate hydratase 1, mitochondri...    364   6e-120   Brachypodium distachyon [annual false brome]
ref|XP_003518952.1|  PREDICTED: fumarate hydratase 1, mitochondrial     363   7e-120   Glycine max [soybeans]
ref|XP_003591472.1|  Fumarate hydratase                                 362   4e-119   Medicago truncatula
ref|XP_008795801.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    361   5e-119   Phoenix dactylifera
gb|EMT27288.1|  Fumarate hydratase 2, chloroplastic                     360   1e-118   Aegilops tauschii
gb|EMS52788.1|  Fumarate hydratase 2, chloroplastic                     360   1e-118   Triticum urartu
ref|XP_006281482.1|  hypothetical protein CARUB_v10027566mg             360   1e-118   Capsella rubella
ref|XP_004984441.1|  PREDICTED: fumarate hydratase 1, mitochondri...    358   7e-118   Setaria italica
ref|XP_010026118.1|  PREDICTED: fumarate hydratase 1, mitochondri...    358   9e-118   Eucalyptus grandis [rose gum]
gb|KCW58396.1|  hypothetical protein EUGRSUZ_H01083                     357   1e-117   Eucalyptus grandis [rose gum]
gb|KHN08665.1|  Fumarate hydratase 2, chloroplastic                     356   2e-117   Glycine soja [wild soybean]
ref|XP_003518957.1|  PREDICTED: fumarate hydratase 1, mitochondri...    356   2e-117   Glycine max [soybeans]
ref|XP_006651566.1|  PREDICTED: fumarate hydratase 1, mitochondri...    355   9e-117   Oryza brachyantha
ref|XP_010103413.1|  Fumarate hydratase 1                               355   1e-116   Morus notabilis
gb|EEC75213.1|  hypothetical protein OsI_11478                          356   1e-116   Oryza sativa Indica Group [Indian rice]
gb|ABF95833.1|  Fumarate hydratase 1, mitochondrial precursor, pu...    356   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008359427.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    355   1e-116   Malus domestica [apple tree]
ref|NP_001146296.1|  uncharacterized protein LOC100279871               355   1e-116   Zea mays [maize]
gb|ACL53645.1|  unknown                                                 355   1e-116   Zea mays [maize]
ref|XP_003536023.1|  PREDICTED: fumarate hydratase 1, mitochondri...    355   1e-116   Glycine max [soybeans]
gb|KHN30668.1|  Fumarate hydratase 1, mitochondrial                     354   4e-116   Glycine soja [wild soybean]
ref|XP_010482423.1|  PREDICTED: fumarate hydratase 2, chloroplast...    353   1e-115   Camelina sativa [gold-of-pleasure]
gb|KFK37522.1|  hypothetical protein AALP_AA4G268000                    352   2e-115   Arabis alpina [alpine rockcress]
gb|AAL62385.1|  fumarate hydratase                                      342   2e-115   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24782.1|  unknown                                                 350   9e-115   Picea sitchensis
gb|KHG29130.1|  Fumarate hydratase 1, mitochondrial -like protein       346   2e-113   Gossypium arboreum [tree cotton]
gb|ERN02044.1|  hypothetical protein AMTR_s00045p00124970               346   5e-113   Amborella trichopoda
ref|XP_004290822.2|  PREDICTED: fumarate hydratase 1, mitochondri...    342   9e-112   Fragaria vesca subsp. vesca
ref|XP_007145185.1|  hypothetical protein PHAVU_007G217700g             333   2e-108   Phaseolus vulgaris [French bean]
gb|EPS58214.1|  hypothetical protein M569_16601                         319   3e-105   Genlisea aurea
gb|EEE59021.1|  hypothetical protein OsJ_10766                          307   3e-98    Oryza sativa Japonica Group [Japonica rice]
gb|KJB22510.1|  hypothetical protein B456_004G051500                    302   1e-96    Gossypium raimondii
emb|CDW80164.1|  fumarate mitochondrial-like                            301   1e-95    Stylonychia lemnae
gb|EJY71120.1|  Fumarate hydratase                                      293   3e-92    Oxytricha trifallax
gb|KDO87117.1|  hypothetical protein CISIN_1g010908mg                   290   4e-92    Citrus sinensis [apfelsine]
ref|XP_005850869.1|  hypothetical protein CHLNCDRAFT_34079              287   3e-90    Chlorella variabilis
ref|XP_001761516.1|  predicted protein                                  287   5e-90    Physcomitrella patens
emb|CCG81126.1|  Fumarate hydratase, mitochondrial                      285   1e-89    Taphrina deformans PYCC 5710
emb|CEG73219.1|  Putative AaceriACR013Cp                                282   3e-88    Rhizopus microsporus
ref|XP_009701525.1|  PREDICTED: fumarate hydratase, mitochondrial       275   3e-88    Cariama cristata
gb|KFP59440.1|  hypothetical protein N322_00331                         274   3e-88    Cariama cristata
ref|XP_008333578.1|  PREDICTED: fumarate hydratase, mitochondrial       282   4e-88    Cynoglossus semilaevis
ref|XP_009489604.1|  PREDICTED: fumarate hydratase, mitochondrial       273   7e-88    Pelecanus crispus
gb|KFQ55579.1|  hypothetical protein N334_00310                         273   9e-88    Pelecanus crispus
gb|EIE78369.1|  fumarate hydratase                                      281   9e-88    Rhizopus delemar RA 99-880
pir||JC4293  fumarate hydratase (EC 4.2.1.2) precursor - Rhizopus...    281   1e-87 
emb|CDH55360.1|  fumarate hydratase                                     281   1e-87    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS07604.1|  Putative Fumarase                                      281   1e-87    Lichtheimia ramosa
ref|XP_001753417.1|  predicted protein                                  280   1e-87    Physcomitrella patens
emb|CEP15950.1|  hypothetical protein                                   280   2e-87    Parasitella parasitica
emb|CCA67859.1|  probable FUM1-fumarate hydratase                       281   2e-87    Serendipita indica DSM 11827
ref|XP_005650930.1|  fumarate hydratase                                 280   3e-87    Coccomyxa subellipsoidea C-169
ref|XP_008530562.1|  PREDICTED: fumarate hydratase, mitochondrial       271   3e-87    Equus przewalskii [Przewalski horse]
ref|XP_008635756.1|  PREDICTED: fumarate hydratase, mitochondrial       279   4e-87    
ref|NP_001119412.1|  fumarate hydratase 2                               277   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011621870.1|  PREDICTED: fumarate hydratase 1, mitochondrial     276   7e-87    Amborella trichopoda
gb|ACY91850.1|  fumarase                                                278   7e-87    Rhizopus oryzae
ref|XP_008847403.1|  PREDICTED: fumarate hydratase, mitochondrial       279   9e-87    Nannospalax galili
sp|P55250.1|FUMH_RHIOR  RecName: Full=Fumarate hydratase, mitocho...    278   9e-87    Rhizopus oryzae
ref|XP_006998748.1|  PREDICTED: fumarate hydratase, mitochondrial...    275   9e-87    
ref|XP_003974177.1|  PREDICTED: fumarate hydratase, mitochondrial       278   2e-86    Takifugu rubripes [tiger puffer]
gb|KFH63115.1|  fumarate hydratase, mitochondrial                       278   2e-86    Mortierella verticillata NRRL 6337
ref|XP_004555021.1|  PREDICTED: fumarate hydratase, mitochondrial...    277   3e-86    Maylandia zebra
ref|XP_004450319.1|  PREDICTED: fumarate hydratase, mitochondrial...    277   3e-86    Dasypus novemcinctus
ref|XP_009087608.1|  PREDICTED: fumarate hydratase, mitochondrial       277   3e-86    Serinus canaria [canary]
gb|ESA01861.1|  hypothetical protein GLOINDRAFT_337726                  276   4e-86    Rhizophagus irregularis DAOM 181602
ref|XP_003037573.1|  hypothetical protein SCHCODRAFT_81011              277   4e-86    Schizophyllum commune H4-8
ref|XP_003439886.2|  PREDICTED: fumarate hydratase, mitochondrial...    277   5e-86    Oreochromis niloticus
emb|CDH51516.1|  fumarate hydratase                                     276   5e-86    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011272281.1|  fumarate hydratase                                 276   5e-86    Wickerhamomyces ciferrii
ref|XP_004578565.1|  PREDICTED: fumarate hydratase, mitochondrial       277   5e-86    Ochotona princeps [southern American pika]
ref|XP_008295685.1|  PREDICTED: fumarate hydratase, mitochondrial       276   6e-86    Stegastes partitus
ref|XP_004895657.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   7e-86    
dbj|GAN02812.1|  fumarate hydratase                                     276   7e-86    Mucor ambiguus
ref|XP_001900957.1|  fumarase                                           276   7e-86    Brugia malayi [agent of lymphatic filariasis]
ref|XP_006958376.1|  fumarate hydratase                                 275   7e-86    Wallemia mellicola CBS 633.66
ref|XP_006102845.1|  PREDICTED: fumarate hydratase, mitochondrial       276   8e-86    Myotis lucifugus
gb|AAH06048.1|  Fumarate hydratase 1                                    276   8e-86    Mus musculus [mouse]
ref|XP_006800490.1|  PREDICTED: fumarate hydratase, mitochondrial...    276   8e-86    Neolamprologus brichardi [lyretail cichlid]
ref|NP_034339.2|  fumarate hydratase, mitochondrial precursor           276   8e-86    Mus musculus [mouse]
gb|AAA52483.1|  fumarase precursor (EC 4.2.1.2)                         275   9e-86    Homo sapiens [man]
ref|XP_004711822.1|  PREDICTED: fumarate hydratase, mitochondrial...    276   9e-86    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010164262.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   1e-85    Caprimulgus carolinensis
ref|XP_005884158.1|  PREDICTED: fumarate hydratase, mitochondrial       275   1e-85    
sp|P14408.1|FUMH_RAT  RecName: Full=Fumarate hydratase, mitochond...    276   1e-85    Rattus norvegicus [brown rat]
ref|XP_005969001.1|  PREDICTED: fumarate hydratase, mitochondrial       276   1e-85    Pantholops hodgsonii
ref|XP_009278489.1|  PREDICTED: fumarate hydratase, mitochondrial       275   1e-85    Aptenodytes forsteri
ref|XP_011396762.1|  Fumarate hydratase 2, chloroplastic                275   1e-85    Auxenochlorella protothecoides
ref|NP_001069271.1|  fumarate hydratase, mitochondrial                  276   1e-85    Bos taurus [bovine]
ref|XP_010774773.1|  PREDICTED: fumarate hydratase, mitochondrial       276   1e-85    Notothenia coriiceps [yellowbelly rockcod]
prf||1709138A  fumarase                                                 276   1e-85 
ref|NP_058701.2|  fumarate hydratase, mitochondrial precursor           276   1e-85    Rattus norvegicus [brown rat]
ref|XP_005897261.1|  PREDICTED: fumarate hydratase, mitochondrial       276   1e-85    Bos mutus
ref|XP_004330338.1|  PREDICTED: fumarate hydratase, mitochondrial...    273   1e-85    Tursiops truncatus [Atlantic bottle-nosed dolphin]
gb|EYB92700.1|  hypothetical protein Y032_0191g1324                     268   2e-85    Ancylostoma ceylanicum
pdb|3E04|A  Chain A, Crystal Structure Of Human Fumarate Hydratase      275   2e-85    Homo sapiens [man]
ref|XP_006050829.1|  PREDICTED: fumarate hydratase, mitochondrial       276   2e-85    Bubalus bubalis [domestic water buffalo]
ref|NP_001155363.1|  fumarate hydratase, mitochondrial                  276   2e-85    Ovis aries [domestic sheep]
ref|XP_002717380.1|  PREDICTED: fumarate hydratase, mitochondrial       275   2e-85    Oryctolagus cuniculus [domestic rabbit]
gb|AAY59704.1|  fumarate hydratase                                      274   2e-85    Cricetulus griseus [Chinese hamsters]
ref|XP_007240663.1|  PREDICTED: fumarate hydratase, mitochondrial...    267   2e-85    Astyanax mexicanus [blind cave fish]
ref|XP_004895654.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   2e-85    
ref|XP_010392198.1|  PREDICTED: fumarate hydratase, mitochondrial       274   2e-85    Corvus cornix cornix
ref|XP_006993784.1|  PREDICTED: fumarate hydratase, mitochondrial       274   2e-85    
ref|XP_005041811.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   2e-85    
gb|KFO62089.1|  hypothetical protein N302_14449                         274   2e-85    Corvus brachyrhynchos
gb|KIO08161.1|  hypothetical protein M404DRAFT_14265                    275   3e-85    Pisolithus tinctorius Marx 270
gb|KFW87389.1|  hypothetical protein N305_02194                         274   3e-85    Manacus vitellinus
gb|KFP81385.1|  hypothetical protein N311_05316                         273   3e-85    Apaloderma vittatum
ref|XP_005078228.1|  PREDICTED: fumarate hydratase, mitochondrial       275   3e-85    Mesocricetus auratus [Syrian golden hamster]
ref|XP_005041810.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   3e-85    
gb|KFW11876.1|  hypothetical protein N326_13222                         273   3e-85    Eurypyga helias
emb|CDS05044.1|  Putative Fumarate hydratase, mitochondrial             273   3e-85    Lichtheimia ramosa
ref|XP_010202049.1|  PREDICTED: fumarate hydratase, mitochondrial       273   4e-85    Colius striatus
gb|KGL79172.1|  hypothetical protein N309_10896                         273   4e-85    Tinamus guttatus
ref|XP_004439637.1|  PREDICTED: fumarate hydratase, mitochondrial       275   4e-85    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFP26128.1|  hypothetical protein N325_10917                         273   4e-85    Colius striatus
ref|XP_005419421.1|  PREDICTED: fumarate hydratase, mitochondrial...    275   4e-85    
ref|XP_009979909.1|  PREDICTED: fumarate hydratase, mitochondrial       272   4e-85    Tauraco erythrolophus
ref|XP_008929917.1|  PREDICTED: fumarate hydratase, mitochondrial       274   4e-85    Manacus vitellinus
ref|XP_010075048.1|  PREDICTED: fumarate hydratase, mitochondrial       273   4e-85    Pterocles gutturalis
gb|KFV66685.1|  hypothetical protein N307_11320                         273   5e-85    Picoides pubescens
ref|XP_004895653.1|  PREDICTED: fumarate hydratase, mitochondrial...    275   5e-85    
ref|XP_003499892.1|  PREDICTED: fumarate hydratase, mitochondrial...    275   5e-85    Cricetulus griseus [Chinese hamsters]
ref|NP_957257.1|  fumarate hydratase, mitochondrial precursor           275   5e-85    Danio rerio [leopard danio]
gb|KFV00612.1|  hypothetical protein N340_04373                         272   5e-85    Tauraco erythrolophus
gb|KFP18053.1|  hypothetical protein Z169_14841                         273   5e-85    Egretta garzetta
ref|XP_005368585.1|  PREDICTED: fumarate hydratase, mitochondrial       274   5e-85    Microtus ochrogaster [prairie voles]
ref|XP_005326633.1|  PREDICTED: fumarate hydratase, mitochondrial       274   5e-85    Ictidomys tridecemlineatus
gb|KFZ60559.1|  hypothetical protein N338_09291                         273   5e-85    Podiceps cristatus
ref|NP_001267172.1|  fumarate hydratase, mitochondrial                  274   5e-85    Pan troglodytes
ref|XP_002718365.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   5e-85    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008489569.1|  PREDICTED: fumarate hydratase, mitochondrial       273   5e-85    Calypte anna
gb|KGL93621.1|  hypothetical protein N301_03833                         273   6e-85    Charadrius vociferus
gb|KFO98944.1|  hypothetical protein N300_02760                         273   6e-85    Calypte anna
ref|NP_000134.2|  fumarate hydratase, mitochondrial                     274   6e-85    Homo sapiens [man]
ref|XP_010581869.1|  PREDICTED: fumarate hydratase, mitochondrial...    273   6e-85    Haliaeetus leucocephalus
gb|KFQ04696.1|  hypothetical protein N329_04765                         273   6e-85    Haliaeetus albicilla
ref|XP_011845414.1|  PREDICTED: fumarate hydratase, mitochondrial       274   6e-85    Mandrillus leucophaeus
emb|CCF51284.1|  probable FUM1-fumarate hydratase                       274   6e-85    Ustilago hordei
ref|XP_004283542.1|  PREDICTED: fumarate hydratase, mitochondrial       273   7e-85    
gb|KFV39301.1|  hypothetical protein N341_12919                         273   7e-85    Tyto alba [Schleiereule]
ref|XP_007988126.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Chlorocebus sabaeus
ref|XP_007462683.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Lipotes vexillifer [baiji]
ref|XP_003824573.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Pan paniscus [bonobo]
gb|KFW71651.1|  hypothetical protein AS28_14072                         273   7e-85    Pygoscelis adeliae
ref|XP_011891657.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Cercocebus atys
ref|XP_010382999.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Rhinopithecus roxellana
ref|XP_003267364.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_588397.3|  fumarate hydratase (predicted)                        274   7e-85    Schizosaccharomyces pombe 972h-
ref|XP_010295483.1|  PREDICTED: fumarate hydratase, mitochondrial       273   7e-85    Phaethon lepturus
ref|XP_007182482.1|  PREDICTED: fumarate hydratase, mitochondrial       274   7e-85    Balaenoptera acutorostrata scammoni
sp|P10173.1|FUMH_PIG  RecName: Full=Fumarate hydratase, mitochond...    273   7e-85    Sus scrofa [pigs]
emb|CDQ03094.1|  Protein BM-FUM-1                                       273   8e-85    
ref|NP_001230517.1|  fumarate hydratase                                 274   8e-85    Sus scrofa [pigs]
ref|XP_003893750.1|  PREDICTED: fumarate hydratase, mitochondrial       274   8e-85    Papio anubis [baboon]
ref|XP_010309788.1|  PREDICTED: fumarate hydratase, mitochondrial       273   8e-85    Balearica regulorum gibbericeps
ref|XP_005517420.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   8e-85    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_002760919.1|  PREDICTED: fumarate hydratase, mitochondrial       274   8e-85    Callithrix jacchus [common marmoset]
ref|XP_009508750.1|  PREDICTED: fumarate hydratase, mitochondrial       273   8e-85    Phalacrocorax carbo [common cormorant]
ref|XP_010117491.1|  PREDICTED: fumarate hydratase, mitochondrial       273   9e-85    Chlamydotis macqueenii
sp|Q60HF9.1|FUMH_MACFA  RecName: Full=Fumarate hydratase, mitocho...    274   9e-85    Macaca fascicularis [crab eating macaque]
ref|XP_001094968.1|  PREDICTED: fumarate hydratase, mitochondrial...    274   9e-85    Macaca mulatta [rhesus macaque]
ref|XP_007119566.1|  PREDICTED: fumarate hydratase, mitochondrial       274   9e-85    Physeter catodon
ref|XP_004028710.1|  PREDICTED: fumarate hydratase, mitochondrial       274   9e-85    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_005374877.1|  PREDICTED: fumarate hydratase, mitochondrial       274   9e-85    Chinchilla lanigera
gb|KFR02179.1|  hypothetical protein N306_08359                         272   9e-85    Opisthocomus hoazin [hoatzin]
gb|EOA97454.1|  Fumarate hydratase, mitochondrial                       273   9e-85    Anas platyrhynchos [duck]
ref|NP_001272104.1|  fumarate hydratase, mitochondrial                  274   9e-85    Macaca fascicularis [crab eating macaque]
ref|XP_537215.1|  PREDICTED: fumarate hydratase, mitochondrial is...    274   9e-85    Canis lupus familiaris [dogs]
ref|XP_010894175.1|  PREDICTED: fumarate hydratase, mitochondrial       273   9e-85    Esox lucius
gb|EHH15914.1|  hypothetical protein EGK_02083                          274   9e-85    Macaca mulatta [rhesus macaque]
ref|XP_009897885.1|  PREDICTED: fumarate hydratase, mitochondrial       273   9e-85    Picoides pubescens
ref|XP_010215690.1|  PREDICTED: fumarate hydratase, mitochondrial       273   1e-84    Tinamus guttatus
ref|XP_003935387.1|  PREDICTED: fumarate hydratase, mitochondrial       274   1e-84    Saimiri boliviensis boliviensis
ref|XP_010157072.1|  PREDICTED: fumarate hydratase, mitochondrial       273   1e-84    Eurypyga helias
ref|XP_005690753.1|  PREDICTED: fumarate hydratase, mitochondrial       275   1e-84    
gb|EHH50891.1|  hypothetical protein EGM_01787                          273   1e-84    Macaca fascicularis [crab eating macaque]
ref|XP_011289145.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    273   1e-84    Felis catus [cat]
ref|XP_011811077.1|  PREDICTED: fumarate hydratase, mitochondrial       273   1e-84    Colobus angolensis palliatus
ref|XP_004799295.1|  PREDICTED: fumarate hydratase, mitochondrial       273   1e-84    
gb|KFU98791.1|  hypothetical protein N339_03040                         272   1e-84    Pterocles gutturalis
ref|XP_009957277.1|  PREDICTED: fumarate hydratase, mitochondrial       272   1e-84    Leptosomus discolor
gb|KKA30722.1|  hypothetical protein TD95_003490                        274   1e-84    Thielaviopsis punctulata
ref|XP_008156858.1|  PREDICTED: fumarate hydratase, mitochondrial       274   1e-84    Eptesicus fuscus
ref|XP_005024942.1|  PREDICTED: fumarate hydratase, mitochondrial...    273   1e-84    Anas platyrhynchos [duck]
ref|XP_009074698.1|  PREDICTED: fumarate hydratase, mitochondrial       272   1e-84    Acanthisitta chloris
ref|XP_010182284.1|  PREDICTED: fumarate hydratase, mitochondrial       272   1e-84    Mesitornis unicolor
gb|KFP81796.1|  hypothetical protein N310_10621                         272   1e-84    Acanthisitta chloris
ref|XP_009869372.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    272   1e-84    Apaloderma vittatum
ref|XP_009962196.1|  PREDICTED: fumarate hydratase, mitochondrial       272   1e-84    Tyto alba [Schleiereule]
ref|XP_009328750.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Pygoscelis adeliae
ref|XP_001442829.1|  hypothetical protein                               272   2e-84    Paramecium tetraurelia strain d4-2
ref|XP_003410962.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Loxodonta africana [African bush elephant]
ref|XP_009883751.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Charadrius vociferus
gb|KFU88789.1|  hypothetical protein M959_14247                         272   2e-84    Chaetura pelagica
ref|XP_007940907.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Orycteropus afer afer
ref|XP_010735106.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Larimichthys crocea [croceine croaker]
ref|XP_003474362.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Cavia porcellus [guinea pig]
ref|XP_010640964.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Fukomys damarensis [Damara mole rat]
ref|XP_007532622.1|  PREDICTED: fumarate hydratase, mitochondrial       273   2e-84    Erinaceus europaeus [common hedgehog]
ref|XP_001526417.1|  fumarate hydratase, mitochondrial precursor        272   2e-84    Lodderomyces elongisporus NRRL YB-4239
ref|XP_009572884.1|  PREDICTED: fumarate hydratase, mitochondrial       271   2e-84    Fulmarus glacialis
ref|NP_001125540.1|  fumarate hydratase, mitochondrial                  273   2e-84    Pongo abelii [orang utan]
ref|XP_006142425.1|  PREDICTED: fumarate hydratase, mitochondrial...    273   2e-84    Tupaia chinensis
ref|XP_007441617.1|  PREDICTED: fumarate hydratase, mitochondrial...    266   2e-84    Python bivittatus
ref|XP_002189151.2|  PREDICTED: fumarate hydratase, mitochondrial...    273   3e-84    Taeniopygia guttata
ref|XP_004375908.1|  PREDICTED: fumarate hydratase, mitochondrial       272   3e-84    Trichechus manatus latirostris
gb|KFM08161.1|  hypothetical protein AS27_00695                         271   3e-84    Aptenodytes forsteri
ref|XP_009809639.1|  PREDICTED: fumarate hydratase, mitochondrial       271   3e-84    Gavia stellata
ref|NP_001006382.1|  fumarate hydratase, mitochondrial                  272   3e-84    
ref|XP_005482998.1|  PREDICTED: fumarate hydratase, mitochondrial...    272   3e-84    
ref|XP_011082445.1|  PREDICTED: fumarate hydratase 1, mitochondri...    270   3e-84    
ref|XP_004414328.1|  PREDICTED: fumarate hydratase, mitochondrial       272   3e-84    
gb|KHN89095.1|  putative fumarate hydratase, mitochondrial              272   3e-84    
gb|KIM67197.1|  hypothetical protein SCLCIDRAFT_14296                   271   3e-84    
ref|XP_010133173.1|  PREDICTED: fumarate hydratase, mitochondrial       271   3e-84    
gb|KFO88947.1|  hypothetical protein N320_10832                         271   3e-84    
ref|XP_009918043.1|  PREDICTED: fumarate hydratase, mitochondrial       272   4e-84    
ref|XP_007861040.1|  fumarate hydratase                                 272   4e-84    
ref|XP_008692868.1|  PREDICTED: fumarate hydratase, mitochondrial       271   4e-84    
ref|XP_011378307.1|  PREDICTED: fumarate hydratase, mitochondrial...    272   4e-84    
ref|XP_002918506.1|  PREDICTED: fumarate hydratase, mitochondrial       272   4e-84    
ref|XP_009942498.1|  PREDICTED: fumarate hydratase, mitochondrial       272   4e-84    
ref|XP_006924183.1|  PREDICTED: fumarate hydratase, mitochondrial       272   4e-84    
gb|KIK06867.1|  hypothetical protein K443DRAFT_129452                   271   4e-84    
ref|XP_009994835.1|  PREDICTED: fumarate hydratase, mitochondrial       271   4e-84    
gb|EJW81137.1|  fumarate hydratase                                      272   5e-84    
ref|XP_009639608.1|  PREDICTED: fumarate hydratase, mitochondrial       272   5e-84    
ref|XP_005153635.1|  PREDICTED: fumarate hydratase, mitochondrial...    271   5e-84    
ref|XP_011589654.1|  PREDICTED: fumarate hydratase, mitochondrial       271   5e-84    
ref|XP_008573483.1|  PREDICTED: fumarate hydratase, mitochondrial       271   5e-84    
gb|KIK96362.1|  hypothetical protein PAXRUDRAFT_826028                  271   5e-84    
ref|XP_011386691.1|  putative fumarase FUM1                             272   5e-84    
gb|EPB87937.1|  fumarate hydratase, mitochondrial                       271   6e-84    
ref|XP_008062082.1|  PREDICTED: fumarate hydratase, mitochondrial       274   6e-84    
ref|XP_004756941.1|  PREDICTED: fumarate hydratase, mitochondrial       272   6e-84    
ref|XP_001873245.1|  predicted protein                                  271   6e-84    
ref|XP_004036528.1|  hypothetical protein IMG5_078680                   271   6e-84    
ref|XP_005242931.1|  PREDICTED: fumarate hydratase, mitochondrial...    271   7e-84    
ref|XP_009439959.1|  PREDICTED: fumarate hydratase, mitochondrial...    271   7e-84    
gb|EMC82421.1|  Fumarate hydratase, mitochondrial                       270   8e-84    
emb|CAG07957.1|  unnamed protein product                                270   8e-84    
gb|KIK28430.1|  hypothetical protein PISMIDRAFT_7450                    271   8e-84    
ref|XP_003204919.2|  PREDICTED: fumarate hydratase, mitochondrial       271   1e-83    
ref|XP_006185613.1|  PREDICTED: fumarate hydratase, mitochondrial       271   1e-83    
ref|XP_005510051.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   1e-83    
gb|KFO70082.1|  hypothetical protein N303_02489                         270   1e-83    
gb|KFV82233.1|  hypothetical protein N308_03081                         270   1e-83    
gb|EFO24875.2|  fumarate hydratase                                      271   1e-83    
ref|XP_006198857.1|  PREDICTED: fumarate hydratase, mitochondrial       271   1e-83    
emb|CBQ68213.1|  probable FUM1-fumarate hydratase                       271   1e-83    
ref|XP_008937257.1|  PREDICTED: fumarate hydratase, mitochondrial       270   1e-83    
ref|XP_009464197.1|  PREDICTED: fumarate hydratase, mitochondrial       271   1e-83    
ref|XP_010990376.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   1e-83    
ref|XP_010971718.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   1e-83    
ref|XP_010971707.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   1e-83    
ref|XP_006638882.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   1e-83    
ref|XP_009561479.1|  PREDICTED: fumarate hydratase, mitochondrial       270   1e-83    
gb|ETN79756.1|  fumarate hydratase, class II                            270   1e-83    
ref|XP_010990377.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   2e-83    
ref|XP_003139199.1|  fumarase 1                                         270   2e-83    
dbj|GAC99563.1|  hypothetical protein PHSY_007165                       269   2e-83    
gb|KIJ21628.1|  fumarate hydratase                                      270   2e-83    
ref|XP_001492705.2|  PREDICTED: fumarate hydratase, mitochondrial       271   2e-83    
emb|CDR44678.1|  CYFA0S15e01376g1_1                                     270   2e-83    
ref|XP_001377948.1|  PREDICTED: fumarate hydratase, mitochondrial       270   2e-83    
gb|EPB82664.1|  fumarate hydratase, mitochondrial                       269   2e-83    
gb|EST06716.1|  ferredoxin                                              270   2e-83    
emb|CDI51724.1|  probable FUM1-fumarate hydratase                       268   2e-83    
gb|KFX93722.1|  hypothetical protein V490_04713                         263   3e-83    
gb|EKD04289.1|  fumarate hydratase                                      270   3e-83    
gb|KIK60394.1|  hypothetical protein GYMLUDRAFT_244393                  269   3e-83    
ref|XP_007077049.1|  PREDICTED: fumarate hydratase, mitochondrial       270   3e-83    
ref|XP_006134174.1|  PREDICTED: fumarate hydratase, mitochondrial...    270   3e-83    
gb|AII97846.1|  BLTX475                                                 262   3e-83    
gb|AJW21490.1|  Fum1p                                                   269   3e-83    
emb|CAY86698.1|  Fum1p                                                  269   4e-83    
emb|CDK25346.1|  unnamed protein product                                269   4e-83    
gb|AJW07725.1|  Fum1p                                                   269   4e-83    
gb|KJA29256.1|  hypothetical protein HYPSUDRAFT_503715                  268   4e-83    
gb|EAW70091.1|  fumarate hydratase, isoform CRA_b                       270   4e-83    
gb|AJW23238.1|  Fum1p                                                   269   4e-83    
ref|XP_007762775.1|  fumarate hydratase                                 269   4e-83    
gb|AJW21046.1|  Fum1p                                                   269   4e-83    
ref|XP_011727766.1|  PREDICTED: fumarate hydratase, mitochondrial       270   4e-83    
ref|XP_006746745.1|  PREDICTED: fumarate hydratase, mitochondrial       270   4e-83    
ref|XP_008595655.1|  fumarate hydratase                                 270   4e-83    
ref|XP_007058980.1|  PREDICTED: fumarate hydratase, mitochondrial...    269   4e-83    
ref|XP_003956083.1|  hypothetical protein KAFR_0B06520                  269   4e-83    
gb|AJW11484.1|  Fum1p                                                   269   4e-83    
ref|NP_015061.1|  fumarase FUM1                                         269   4e-83    
dbj|GAA26717.1|  K7_Fum1p                                               269   4e-83    
ref|XP_005296563.1|  PREDICTED: fumarate hydratase, mitochondrial...    269   5e-83    
gb|AJW10336.1|  Fum1p                                                   269   5e-83    
gb|AJW06422.1|  Fum1p                                                   269   5e-83    
pdb|1YFM|A  Chain A, Recombinant Yeast Fumarase                         269   5e-83    
ref|XP_747830.1|  fumarate hydratase                                    271   5e-83    
gb|KGK38814.1|  hypothetical protein JL09_g1983                         268   5e-83    
gb|AJU31874.1|  Fum1p                                                   268   5e-83    
ref|NP_498642.1|  Protein FUM-1, isoform a                              269   5e-83    
ref|XP_008111211.1|  PREDICTED: fumarate hydratase, mitochondrial...    269   6e-83    
gb|EHN00014.1|  Fum1p                                                   268   6e-83    
gb|EFB22120.1|  hypothetical protein PANDA_006972                       268   6e-83    
gb|AJV94145.1|  Fum1p                                                   268   6e-83    
gb|KFH43308.1|  Fumarate hydratase-like protein                         270   6e-83    
gb|KGQ09969.1|  Fumarate hydratase                                      270   7e-83    
ref|XP_002989327.1|  hypothetical protein SELMODRAFT_129619             271   7e-83    
gb|KIJ68316.1|  hypothetical protein HYDPIDRAFT_173069                  268   7e-83    
ref|XP_006824593.1|  PREDICTED: fumarate hydratase, mitochondrial...    258   7e-83    
gb|EGA76536.1|  Fum1p                                                   268   8e-83    
ref|XP_501530.1|  YALI0C06776p                                          268   1e-82    
ref|XP_008167560.1|  PREDICTED: fumarate hydratase, mitochondrial...    268   1e-82    
gb|EJT43864.1|  FUM1-like protein                                       268   1e-82    
emb|CCO37210.1|  fumarate hydratase, class II                           259   1e-82    
ref|XP_004619073.1|  PREDICTED: fumarate hydratase, mitochondrial       268   1e-82    
gb|EJT46017.1|  fumarate hydratase                                      267   1e-82    
ref|XP_007265454.1|  fumarate hydratase                                 267   1e-82    
ref|XP_007807229.1|  fumarate hydratase precursor                       269   1e-82    
gb|KJH52474.1|  fumarate hydratase, class II                            267   1e-82    
gb|AGO11273.1|  AaceriACR013Cp                                          267   2e-82    
gb|EGT56625.1|  hypothetical protein CAEBREN_05116                      267   2e-82    
ref|XP_007319010.1|  hypothetical protein SERLADRAFT_469035             267   2e-82    
gb|KID89475.1|  fumarate hydratase                                      268   2e-82    
dbj|GAM89660.1|  hypothetical protein ANO11243_076990                   268   2e-82    
gb|KIL70702.1|  hypothetical protein M378DRAFT_6637                     267   2e-82    
ref|XP_010354171.1|  PREDICTED: fumarate hydratase, mitochondrial...    267   3e-82    
gb|KIN01511.1|  hypothetical protein OIDMADRAFT_123939                  266   3e-82    
emb|CDJ92654.1|  Fumarate lyase and Fumarase C domain containing ...    267   3e-82    
gb|AAA66909.1|  fumarase                                                267   3e-82    
ref|XP_005806444.1|  PREDICTED: fumarate hydratase, mitochondrial...    266   3e-82    
ref|XP_008405153.1|  PREDICTED: fumarate hydratase, mitochondrial       267   3e-82    
ref|XP_007579139.1|  PREDICTED: fumarate hydratase, mitochondrial       267   3e-82    
ref|XP_002980931.1|  hypothetical protein SELMODRAFT_113300             270   3e-82    
gb|KIM85397.1|  hypothetical protein PILCRDRAFT_817407                  267   3e-82    
ref|XP_002935862.2|  PREDICTED: fumarate hydratase, mitochondrial...    267   3e-82    
ref|XP_001730777.1|  hypothetical protein MGL_1776                      267   4e-82    
emb|CEJ82858.1|  Putative Fumarase                                      267   4e-82    
gb|KIE00198.1|  fumarate hydratase                                      268   4e-82    
gb|KDN71424.1|  putative fumarate hydratase                             266   4e-82    
gb|KJK75693.1|  Fumarate hydratase                                      268   4e-82    
ref|XP_003099493.1|  hypothetical protein CRE_01188                     266   4e-82    
ref|XP_007595676.1|  fumarate hydratase                                 268   4e-82    
dbj|GAA87674.1|  fumarate hydratase class II                            267   4e-82    
ref|XP_444816.1|  hypothetical protein                                  266   4e-82    
ref|XP_007360110.1|  fumarate hydratase                                 266   5e-82    
gb|EGA56432.1|  Fum1p                                                   265   5e-82    
emb|CDO72379.1|  hypothetical protein BN946_scf184977.g78               266   5e-82    
gb|KJR85488.1|  fumarate hydratase, class II                            267   5e-82    
gb|KDQ19923.1|  hypothetical protein BOTBODRAFT_51294                   266   5e-82    
gb|KJK89265.1|  hypothetical protein H633G_06855                        265   5e-82    
gb|KDN41519.1|  fumarate hydratase                                      265   5e-82    
ref|XP_719823.1|  hypothetical protein CaO19.6724                       259   6e-82    
ref|XP_004914678.1|  PREDICTED: fumarate hydratase, mitochondrial...    265   6e-82    
ref|XP_007379084.1|  fumarate hydratase                                 265   6e-82    
gb|KHN98805.1|  fumarate hydratase                                      267   6e-82    
ref|XP_002411057.1|  fumarase, putative                                 266   6e-82    
gb|KIW47448.1|  fumarate hydratase, class II                            267   6e-82    
emb|CEF64732.1|  Fumarate hydratase, mitochondrial                      265   8e-82    
gb|EFQ26635.1|  fumarate hydratase                                      267   8e-82    
gb|KIM48081.1|  hypothetical protein M413DRAFT_220518                   265   9e-82    
gb|KID72552.1|  fumarate hydratase                                      266   9e-82    
ref|XP_006691770.1|  fumarate hydratase-like protein                    267   9e-82    
ref|WP_008518092.1|  fumarate hydratase                                 265   1e-81    
ref|XP_007872376.1|  hypothetical protein PNEG_00490                    266   1e-81    
ref|XP_009497397.1|  fumarate hydratase, mitochondrial                  265   1e-81    
gb|ELQ41093.1|  fumarate hydratase class II 1                           265   1e-81    
gb|KFG85558.1|  fumarate hydratase                                      266   1e-81    
gb|KIH91518.1|  fumarate hydratase, class II                            265   1e-81    
ref|XP_007879047.1|  hypothetical protein PFL1_03339                    265   1e-81    
ref|XP_006277022.1|  PREDICTED: fumarate hydratase, mitochondrial...    265   1e-81    
gb|ELR03472.1|  fumarate hydratase, class II                            266   1e-81    
gb|EZF33427.1|  fumarate hydratase, mitochondrial                       266   1e-81    
ref|XP_002143446.1|  fumarate hydratase, putative                       266   1e-81    
ref|XP_003767837.1|  PREDICTED: fumarate hydratase, mitochondrial       266   2e-81    
dbj|GAK61852.1|  fumarate hydratase                                     265   2e-81    
emb|CDM27295.1|  Fumarate hydratase, mitochondrial                      266   2e-81    
dbj|GAA96186.1|  hypothetical protein E5Q_02850                         265   2e-81    
ref|XP_001257435.1|  fumarate hydratase, putative                       266   2e-81    
emb|CDO93438.1|  unnamed protein product                                265   2e-81    
ref|XP_003177324.1|  fumarate hydratase                                 266   2e-81    
gb|KGO68131.1|  Fumarase C, C-terminal                                  266   2e-81    
ref|XP_002625783.1|  fumarate hydratase class II                        267   2e-81    
ref|XP_003238110.1|  fumarate hydratase class II                        266   2e-81    
gb|KIO21601.1|  hypothetical protein M407DRAFT_245426                   265   2e-81    
ref|XP_002566272.1|  Pc22g23810                                         266   2e-81    
gb|EZF33426.1|  fumarate hydratase, mitochondrial                       266   2e-81    
gb|KDN39226.1|  Fumarate hydratase, mitochondrial                       265   2e-81    
ref|XP_002492874.1|  Fumarase, converts fumaric acid to L-malic a...    264   2e-81    
gb|KFY44404.1|  hypothetical protein V494_01487                         266   2e-81    
gb|EQL30770.1|  fumarate hydratase, mitochondrial                       266   2e-81    
gb|EEQ86930.1|  fumarate hydratase class II                             266   2e-81    
gb|KFY24949.1|  hypothetical protein V493_04923                         266   3e-81    
dbj|GAC74043.1|  ferredoxin                                             265   3e-81    
ref|XP_004336877.1|  fumarate hydratase, class II, putative             265   3e-81    
gb|KEY76450.1|  fumarate hydratase                                      266   3e-81    
ref|XP_007325603.1|  hypothetical protein AGABI1DRAFT_110391            265   3e-81    
gb|AAP51177.1|  fumarase                                                263   3e-81    
gb|KDR85119.1|  hypothetical protein GALMADRAFT_233751                  263   3e-81    
gb|ENH86884.1|  fumarate hydratase                                      265   3e-81    
gb|ETS64030.1|  hypothetical protein PaG_02367                          265   3e-81    
gb|ERG84110.1|  putative fumarate                                       264   3e-81    
gb|ESX01327.1|  Fumarate hydratase, mitochondrial                       264   4e-81    
gb|ERT00077.1|  fumarate hydratase, mitochondrial                       263   4e-81    
gb|KIM34410.1|  hypothetical protein M408DRAFT_325817                   263   4e-81    
gb|KKA74784.1|  fum-1                                                   262   4e-81    
ref|XP_009651690.1|  fumarate hydratase                                 264   4e-81    
ref|XP_001828833.2|  aspartate ammonia lyase                            264   4e-81    
ref|XP_007820058.1|  fumarate hydratase                                 265   4e-81    
gb|EPX73578.1|  fumarate hydratase                                      265   4e-81    
ref|XP_001270284.1|  fumarate hydratase, putative                       265   4e-81    
gb|EQK99496.1|  fumarate hydratase class II                             260   4e-81    
gb|EEH36265.2|  fumarate hydratase                                      266   5e-81    
ref|XP_009541236.1|  hypothetical protein HETIRDRAFT_153879             264   5e-81    
gb|EPE08450.1|  fumarate hydratase                                      265   5e-81    
gb|EXV03852.1|  fumarase                                                263   5e-81    
ref|XP_007916152.1|  putative fumarate hydratase protein                263   5e-81    
ref|XP_003720956.1|  fumarate hydratase                                 265   5e-81    
gb|EKV10050.1|  Fumarate hydratase, putative                            265   5e-81    
gb|KIJ45649.1|  hypothetical protein M422DRAFT_67105                    263   6e-81    
gb|EHK50052.1|  fumarate hydratase                                      263   6e-81    
gb|KIP12608.1|  hypothetical protein PHLGIDRAFT_81895                   263   6e-81    
gb|EGE07834.1|  fumarate hydratase                                      264   6e-81    
gb|EPB72045.1|  fumarate hydratase, class II                            263   7e-81    
gb|EEH23130.2|  fumarate hydratase, mitochondrial                       265   7e-81    
emb|CCE42271.1|  hypothetical protein CPAR2_808200                      263   7e-81    
gb|KIW26938.1|  fumarate hydratase, class II                            265   7e-81    
gb|KJZ70633.1|  Fumarate hydratase                                      263   7e-81    
ref|XP_007921856.1|  hypothetical protein MYCFIDRAFT_149663             263   7e-81    
gb|KDB17172.1|  fumarate hydratase precursor                            265   7e-81    
ref|XP_453112.1|  hypothetical protein                                  263   8e-81    



>ref|XP_009622148.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622149.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622150.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
Length=493

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 209/219 (95%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAMLIAARR++ GS  S   +SLRYT CWR+FSTSFREE+DTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLIAARRLSAGSALS---DSLRYTSCWRFFSTSFREEKDTFGPILVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+ SIGKA+MQAA+EVAEGKLND
Sbjct  58   SLQNFDIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDRSIGKAIMQAAEEVAEGKLND  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKHVHPNDHVNRSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAME+NKRL+PNLKQLHTSLHSKSVEFKDIIKIGRT
Sbjct  178  HIAAAMELNKRLVPNLKQLHTSLHSKSVEFKDIIKIGRT  216



>ref|XP_009778286.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778287.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778288.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778289.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=493

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 209/219 (95%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAMLIAARR++ GS  S   +SLRYT CWR+FSTSFREE+DTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLIAARRLSAGSALS---DSLRYTSCWRFFSTSFREEKDTFGPILVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+ SIGKA+MQAA+EVAEGKLND
Sbjct  58   SLQNFDIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDRSIGKAIMQAAEEVAEGKLND  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKHVHPNDHVNRSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAME+NKRL+PNLKQLHTSLHSKSVEFKDIIKIGRT
Sbjct  178  HIAAAMELNKRLVPNLKQLHTSLHSKSVEFKDIIKIGRT  216



>gb|KJB09427.1| hypothetical protein B456_001G141300 [Gossypium raimondii]
 gb|KJB09428.1| hypothetical protein B456_001G141300 [Gossypium raimondii]
Length=496

 Score =   406 bits (1044),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RR++ GST S    SLRY  CWR FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSFSTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  120

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH+RG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHQRGDKFVHPNDHVNRSQSSNDTFPTVM  180

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN RL+P LK LH++LHSKS+EFKDI+KIGRT
Sbjct  181  HIAAAMEINSRLIPKLKILHSTLHSKSIEFKDIVKIGRT  219



>ref|XP_007051015.1| Fumarase 1 isoform 1 [Theobroma cacao]
 gb|EOX95172.1| Fumarase 1 isoform 1 [Theobroma cacao]
Length=496

 Score =   402 bits (1032),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RR++ GST S    SLRY  CWR +STSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSYSTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLND  120

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  180

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN RL P LK L ++LHSKS+EFKDI+KIGRT
Sbjct  181  HIAAAMEINSRLTPKLKILRSTLHSKSIEFKDIVKIGRT  219



>ref|XP_007051016.1| Fumarase 1 isoform 2 [Theobroma cacao]
 gb|EOX95173.1| Fumarase 1 isoform 2 [Theobroma cacao]
Length=497

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RR++ GST S    SLRY  CWR +STSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSYSTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLND  120

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  180

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN RL P LK L ++LHSKS+EFKDI+KIGRT
Sbjct  181  HIAAAMEINSRLTPKLKILRSTLHSKSIEFKDIVKIGRT  219



>ref|XP_006359871.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X2 
[Solanum tuberosum]
Length=493

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 204/219 (93%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAML AARR++ GS  S   +SLRYT  WR+FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLNAARRLSAGSALS---DSLRYTSSWRFFSTSFREERDTFGPILVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGGDRERMPEPIIRAFGI+KKCAAKVNM+YGL+ SIGKA+MQAA+EVAEG LND
Sbjct  58   SLQNFEIGGDRERMPEPIIRAFGIIKKCAAKVNMDYGLDQSIGKAIMQAAEEVAEGNLND  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH RG+K VHPNDHVN+SQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHNRGDKHVHPNDHVNKSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIA AME+NKRL+PNLKQLHTSL+SKSVEFKDIIKIGRT
Sbjct  178  HIAGAMELNKRLVPNLKQLHTSLNSKSVEFKDIIKIGRT  216



>ref|XP_006480011.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X1 
[Citrus sinensis]
Length=522

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/223 (84%), Positives = 204/223 (91%), Gaps = 1/223 (0%)
 Frame = +1

Query  118  ETQMAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGA  294
            E QMA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGA
Sbjct  23   EKQMAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGA  82

Query  295  QTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEG  474
            QTQRSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEG
Sbjct  83   QTQRSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEG  142

Query  475  KLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTF  654
            KLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTF
Sbjct  143  KLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTF  202

Query  655  PTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            PTVMHIAAAME N RL+PNLK LH SLHSKSVEFKDI+KIGRT
Sbjct  203  PTVMHIAAAMETNSRLIPNLKVLHNSLHSKSVEFKDIVKIGRT  245



>ref|XP_004247395.1| PREDICTED: fumarate hydratase 1, mitochondrial [Solanum lycopersicum]
Length=494

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/220 (86%), Positives = 206/220 (94%), Gaps = 4/220 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVC-WRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MAML AARR++ GS  S   +SLRYT   WR+FSTSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  1    MAMLNAARRLSAGSALS---DSLRYTSSSWRFFSTSFREERDTFGPILVPSDKLWGAQTQ  57

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNFEIGGDRERMPEPIIRAFGI+KKCAAKVNM+YGL+ SIGKA+MQAA+EVAEGKLN
Sbjct  58   RSLQNFEIGGDRERMPEPIIRAFGIIKKCAAKVNMDYGLDQSIGKAIMQAAEEVAEGKLN  117

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILG+ RG+K VHPNDHVN+SQSSNDTFPTV
Sbjct  118  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGYNRGDKHVHPNDHVNKSQSSNDTFPTV  177

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAAME+NKRL+PNLKQLHTSL+SKSVEFKDIIKIGRT
Sbjct  178  MHIAAAMELNKRLVPNLKQLHTSLNSKSVEFKDIIKIGRT  217



>gb|KDO87115.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87116.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=439

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 202/220 (92%), Gaps = 1/220 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAAME N RL+PNLK LH SLHSKSVEFKDI+KIGRT
Sbjct  181  MHIAAAMETNSRLIPNLKVLHNSLHSKSVEFKDIVKIGRT  220



>ref|XP_008235134.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial 
[Prunus mume]
Length=490

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 200/219 (91%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RRV  GST    S + RY  CWR +ST+FREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIISRRVVGGST---PSTAFRYATCWRPYSTAFREERDTFGPILVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN 
Sbjct  58   SLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNQ  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIA+AMEIN RL+PNLK LHTSLHSKS EFKDI+KIGRT
Sbjct  178  HIASAMEINSRLIPNLKTLHTSLHSKSDEFKDIVKIGRT  216



>ref|XP_012082825.1| PREDICTED: fumarate hydratase 1, mitochondrial [Jatropha curcas]
 gb|KDP28204.1| hypothetical protein JCGZ_13975 [Jatropha curcas]
Length=495

 Score =   397 bits (1019),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 202/219 (92%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA  + ARR++ GST S S  SLR+   WR +ST+FREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MATGVVARRLSHGSTSSQSIGSLRF-ASWRLYSTAFREERDTFGPIQVPSDKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFEIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGKLND  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+PNLK LHT+LHSKS+EFKDI+KIGRT
Sbjct  180  HIAAATEINSRLIPNLKNLHTTLHSKSIEFKDIVKIGRT  218



>ref|XP_002523133.1| aspartate ammonia lyase, putative [Ricinus communis]
 gb|EEF39318.1| aspartate ammonia lyase, putative [Ricinus communis]
Length=470

 Score =   395 bits (1016),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 202/219 (92%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM   ARR++  ST + +  SLRY   WR +ST+FREERDTFGPIQVP+DKLWGAQTQR
Sbjct  1    MAMGTIARRISRESTTTRAVGSLRY-ASWRLYSTAFREERDTFGPIQVPNDKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGKLND  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKYVHPNDHVNRSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EINKRL+PNL+ L T+LH+KSVEFKDI+KIGRT
Sbjct  180  HIAAATEINKRLIPNLRNLQTTLHAKSVEFKDIVKIGRT  218



>gb|KDO87114.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=487

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 202/220 (92%), Gaps = 1/220 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAAME N RL+PNLK LH SLHSKSVEFKDI+KIGRT
Sbjct  181  MHIAAAMETNSRLIPNLKVLHNSLHSKSVEFKDIVKIGRT  220



>ref|XP_006444417.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|ESR57657.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
Length=494

 Score =   396 bits (1017),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 202/220 (92%), Gaps = 1/220 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAAME N RL+PNLK LH SLHSKSVEFKDI+KIGRT
Sbjct  181  MHIAAAMETNSRLIPNLKVLHNSLHSKSVEFKDIVKIGRT  220



>ref|XP_006444418.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 ref|XP_006444419.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 ref|XP_006480012.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X2 
[Citrus sinensis]
 ref|XP_006480013.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X3 
[Citrus sinensis]
 gb|ESR57658.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|ESR57659.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|KDO87112.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87113.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=497

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/220 (84%), Positives = 202/220 (92%), Gaps = 1/220 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCG-STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MA+ + +RR+  G ST S  + +LRY  CWR +STSFREE+DTFGPI VPSDKLWGAQTQ
Sbjct  1    MAVYVISRRLLGGGSTTSQLAGTLRYGACWRSYSTSFREEKDTFGPILVPSDKLWGAQTQ  60

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLN  120

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTV  180

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAAME N RL+PNLK LH SLHSKSVEFKDI+KIGRT
Sbjct  181  MHIAAAMETNSRLIPNLKVLHNSLHSKSVEFKDIVKIGRT  220



>ref|XP_007200983.1| hypothetical protein PRUPE_ppa004758mg [Prunus persica]
 gb|EMJ02182.1| hypothetical protein PRUPE_ppa004758mg [Prunus persica]
Length=493

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 200/219 (91%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RRV  GST    S + RY  CWR +STSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIISRRVVGGST---PSTAFRYATCWRPYSTSFREERDTFGPILVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN 
Sbjct  58   SLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNQ  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIA+A+EIN RL+PNL+ LHTSLHSKS EFKDI+KIGRT
Sbjct  178  HIASAVEINSRLIPNLRTLHTSLHSKSDEFKDIVKIGRT  216



>gb|EYU46762.1| hypothetical protein MIMGU_mgv1a005258mg [Erythranthe guttata]
Length=491

 Score =   392 bits (1008),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 5/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAMLI +RR+   S RS  + S+   + W  +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAMLIISRRL---SGRSPMTSSIAANLRW--YSTSFREERDTFGPIQVPSDKLWGAQTQR  55

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGGDRERMPEPI+RAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVA+GKLND
Sbjct  56   SLQNFEIGGDRERMPEPIVRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVADGKLND  115

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  116  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKVVHPNDHVNRSQSSNDTFPTVM  175

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN  L+P LKQLHT+LHSKSVEFKDI+KIGRT
Sbjct  176  HIAAAMEINSLLIPKLKQLHTTLHSKSVEFKDIVKIGRT  214



>ref|XP_011079617.1| PREDICTED: fumarate hydratase 1, mitochondrial [Sesamum indicum]
Length=491

 Score =   392 bits (1007),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 5/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAMLIA+RR+   S+RS ++  L     +R++STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAMLIASRRL---SSRSTTTSCL--AASFRWYSTSFREERDTFGPIQVPSDKLWGAQTQR  55

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGKLND
Sbjct  56   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGKLND  115

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  116  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVM  175

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+E+N  L+P LKQLHT+LH+KSVEFKDI+KIGRT
Sbjct  176  HIAAAVEMNSGLIPKLKQLHTTLHAKSVEFKDIVKIGRT  214



>ref|XP_011458750.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 199/221 (90%), Gaps = 8/221 (4%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRY--TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQT  300
            MAM + +RRVT GST        RY  T CWR +STSFREERDTFGPI VPSDKLWGAQT
Sbjct  1    MAMYVISRRVTAGST------PFRYAATTCWRNYSTSFREERDTFGPILVPSDKLWGAQT  54

Query  301  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  480
            QRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+ SIGKA+MQAAQEVAEGKL
Sbjct  55   QRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDQSIGKAIMQAAQEVAEGKL  114

Query  481  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPT  660
            N HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPT
Sbjct  115  NQHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPT  174

Query  661  VMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            VMHIA+AMEIN RL+PNLK LH+SLHSKS EFKDI+KIGRT
Sbjct  175  VMHIASAMEINSRLIPNLKALHSSLHSKSDEFKDIVKIGRT  215



>ref|XP_011458749.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/221 (84%), Positives = 199/221 (90%), Gaps = 8/221 (4%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRY--TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQT  300
            MAM + +RRVT GST        RY  T CWR +STSFREERDTFGPI VPSDKLWGAQT
Sbjct  1    MAMYVISRRVTAGST------PFRYAATTCWRNYSTSFREERDTFGPILVPSDKLWGAQT  54

Query  301  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  480
            QRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+ SIGKA+MQAAQEVAEGKL
Sbjct  55   QRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDQSIGKAIMQAAQEVAEGKL  114

Query  481  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPT  660
            N HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPT
Sbjct  115  NQHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPT  174

Query  661  VMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            VMHIA+AMEIN RL+PNLK LH+SLHSKS EFKDI+KIGRT
Sbjct  175  VMHIASAMEINSRLIPNLKALHSSLHSKSDEFKDIVKIGRT  215



>ref|NP_001275422.1| fumarate hydratase 1, mitochondrial-like [Solanum tuberosum]
 emb|CAA62817.1| fumarase [Solanum tuberosum]
Length=493

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 202/219 (92%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAML AARR++ GS  S   +SLRYT  WR+FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLNAARRLSAGSALS---DSLRYTSSWRFFSTSFREERDTFGPILVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGGDRERMPEPIIRAFGI+KKCAAKVNM+YGL+ SIGKA+MQAA+EVAEGKLND
Sbjct  58   SLQNFEIGGDRERMPEPIIRAFGIIKKCAAKVNMDYGLDQSIGKAIMQAAEEVAEGKLND  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH RG+K VHPNDHVN+SQSSNDTF TVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHNRGDKHVHPNDHVNKSQSSNDTFSTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAME+NKRL+PNL+ +  SL+SKSVEFKDIIKIGRT
Sbjct  178  HIAAAMELNKRLVPNLETVAYSLNSKSVEFKDIIKIGRT  216



>ref|XP_010259454.1| PREDICTED: fumarate hydratase 1, mitochondrial [Nelumbo nucifera]
Length=495

 Score =   389 bits (999),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/220 (85%), Positives = 203/220 (92%), Gaps = 3/220 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCW-RYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MAML A+RR++C ST S    +LR    W R FSTSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  1    MAMLTASRRLSCASTTSPLVWNLR--AAWLRSFSTSFREERDTFGPILVPSDKLWGAQTQ  58

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEV+EGKLN
Sbjct  59   RSLQNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVSEGKLN  118

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  119  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKLVHPNDHVNRSQSSNDTFPTV  178

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAA+EIN R +P+LKQLHTSL+SKS+EFKDIIKIGRT
Sbjct  179  MHIAAAVEINSRFIPSLKQLHTSLNSKSLEFKDIIKIGRT  218



>ref|XP_010069886.1| PREDICTED: fumarate hydratase 1, mitochondrial [Eucalyptus grandis]
 gb|KCW58394.1| hypothetical protein EUGRSUZ_H01081 [Eucalyptus grandis]
Length=497

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTR-SISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MA  + +RR++ GS   S  + +LRY  CWR +ST FREERDTFGPI VPSD+LWGAQTQ
Sbjct  1    MAAYVVSRRLSSGSAAPSHLAGALRYAACWRSYSTGFREERDTFGPILVPSDRLWGAQTQ  60

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVN+EYGL+PSIG+A+MQAAQEVAEGKLN
Sbjct  61   RSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNLEYGLDPSIGEAIMQAAQEVAEGKLN  120

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  121  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGRKRGEKFVHPNDHVNRSQSSNDTFPTV  180

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAAMEIN RLLP+L  LH+SLHSKS+EFKDI+KIGRT
Sbjct  181  MHIAAAMEINSRLLPSLGNLHSSLHSKSIEFKDIVKIGRT  220



>emb|CDY57717.1| BnaC04g51900D [Brassica napus]
Length=483

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 200/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ +A+RR++ G+    ++ +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSSGT----AAATLRYATAMRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LHT+L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHTTLDSKSFEFKDIVKIGRT  215



>ref|XP_006397946.1| hypothetical protein EUTSA_v10001422mg [Eutrema salsugineum]
 gb|ESQ39399.1| hypothetical protein EUTSA_v10001422mg [Eutrema salsugineum]
Length=492

 Score =   387 bits (993),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 200/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ +A+RR++ G+T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSGGTT----AAALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  215



>emb|CDP17101.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 7/219 (3%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAML+A+RR++ GS R+++      T  +R FSTSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMLVASRRLSIGS-RTVT------TSLFRCFSTSFREERDTFGPILVPSDKLWGAQTQR  53

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+P I KA+MQAAQEVAEGKLND
Sbjct  54   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPVIAKAIMQAAQEVAEGKLND  113

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  114  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  173

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+E+N RL+PNLKQL TSLHSKS+EFKDI+KIGRT
Sbjct  174  HIAAAVEVNLRLIPNLKQLQTSLHSKSIEFKDIVKIGRT  212



>ref|XP_004240578.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Solanum 
lycopersicum]
Length=488

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 201/219 (92%), Gaps = 8/219 (4%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAML+A+RR        +S+  +RY+   R+ STSFREERDTFGPI VP DKLWGAQTQR
Sbjct  1    MAMLVASRR--------LSTIIVRYSSSSRFCSTSFREERDTFGPILVPDDKLWGAQTQR  52

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKAVMQAAQEVAEGKLND
Sbjct  53   SLQNFEIGGERERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAVMQAAQEVAEGKLND  112

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  113  HFPLVVWQTGSGTQSNMNANEVIANRASEILGHKRGEKHVHPNDHVNRSQSSNDTFPTVM  172

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEINKRL+PNLKQLHTSLHSKS EFKDIIKIGRT
Sbjct  173  HIAAAMEINKRLVPNLKQLHTSLHSKSAEFKDIIKIGRT  211



>ref|XP_009142525.1| PREDICTED: fumarate hydratase 1, mitochondrial [Brassica rapa]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 199/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ +A+RR++  +T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSARTT----AATLRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LHT+L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHTTLDSKSFEFKDIVKIGRT  215



>ref|XP_002880309.1| hypothetical protein ARALYDRAFT_483931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56568.1| hypothetical protein ARALYDRAFT_483931 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 200/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSGGTTAT----ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEG+LND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGQLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  215



>ref|XP_008386708.1| PREDICTED: fumarate hydratase 1, mitochondrial [Malus domestica]
Length=571

 Score =   387 bits (995),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 198/226 (88%), Gaps = 3/226 (1%)
 Frame = +1

Query  106  SSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKL  285
            S +   QMAM I +RR   GST      +LRY    R +ST FREERDTFGPI VPSDKL
Sbjct  72   SELNHLQMAMYIVSRRAAGGST---PMAALRYATSLRPYSTKFREERDTFGPINVPSDKL  128

Query  286  WGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEV  465
            WGAQTQRSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKAVMQAAQEV
Sbjct  129  WGAQTQRSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAVMQAAQEV  188

Query  466  AEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSN  645
            AEGKLN+HFPLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSN
Sbjct  189  AEGKLNEHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSN  248

Query  646  DTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            DTFPTVMHIA+AMEIN RL+PNL  LH +LHSKS EFKDI+KIGRT
Sbjct  249  DTFPTVMHIASAMEINSRLIPNLXTLHAALHSKSEEFKDIVKIGRT  294



>ref|NP_182273.1| fumarate hydratase 1 [Arabidopsis thaliana]
 ref|NP_001078075.1| fumarate hydratase 1 [Arabidopsis thaliana]
 sp|P93033.2|FUM1_ARATH RecName: Full=Fumarate hydratase 1, mitochondrial; Short=Fumarase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB71399.1| fumarase [Arabidopsis thaliana]
 gb|AAC62859.1| putative fumarase [Arabidopsis thaliana]
 gb|AAL06911.1| At2g47510/T30B22.19 [Arabidopsis thaliana]
 gb|AAL32538.1| putative fumarase [Arabidopsis thaliana]
 gb|AAO29979.1| putative fumarase [Arabidopsis thaliana]
 gb|AEC10852.1| fumarate hydratase 1 [Arabidopsis thaliana]
 gb|AEC10853.1| fumarate hydratase 1 [Arabidopsis thaliana]
Length=492

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 200/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            M++ +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MSIYVASRRLSGGTTVT----ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  215



>ref|XP_010680310.1| PREDICTED: fumarate hydratase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=490

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 198/219 (90%), Gaps = 6/219 (3%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM +A RR+T GS     S +LR    +R++S+SFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYLANRRLTTGS-----SAALR-CAWFRFYSSSFREERDTFGPIHVPSDKLWGAQTQR  54

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFGILKKCAAKVNMEYGL+P+IG AVMQAAQEVAEGKLND
Sbjct  55   SLQNFEIGGERERMPEPIVRAFGILKKCAAKVNMEYGLDPTIGNAVMQAAQEVAEGKLND  114

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  115  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  174

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN R LP LK LH+SLH+KSVEFKDIIKIGRT
Sbjct  175  HIAAAMEINSRFLPKLKNLHSSLHAKSVEFKDIIKIGRT  213



>emb|CDX80112.1| BnaA05g00440D [Brassica napus]
Length=487

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 199/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ +A+RR++  +T    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVASRRLSARTT----AATLRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+M+AAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMEAAQEVAEGKLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LHT+L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHTTLDSKSFEFKDIVKIGRT  215



>dbj|BAH19491.1| AT2G47510 [Arabidopsis thaliana]
Length=492

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 200/219 (91%), Gaps = 4/219 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            M++ +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MSIYVASRRLSGGTTVT----ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  56

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  57   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  116

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  117  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVM  176

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  177  HIAAATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  215



>ref|XP_010523964.1| PREDICTED: fumarate hydratase 1, mitochondrial [Tarenaya hassleriana]
 ref|XP_010523965.1| PREDICTED: fumarate hydratase 1, mitochondrial [Tarenaya hassleriana]
Length=493

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 200/219 (91%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ + +RR++ GST    + +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAIYVLSRRLSGGST---PAAALRYANALRSYSTSFREERDTFGPIQVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLND
Sbjct  58   SLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLND  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKFVHPNDHVNRSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P+LK LH++L SKS+EFKDI+KIGRT
Sbjct  178  HIAAATEINSRLIPSLKTLHSTLDSKSLEFKDIVKIGRT  216



>ref|XP_010507880.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Camelina 
sativa]
 ref|XP_010507881.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Camelina 
sativa]
Length=493

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = +1

Query  139  IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  318
            +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGTTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  319  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  498
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  499  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAA  678
            V+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  679  AMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            A EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  182  ATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  216



>ref|XP_006296086.1| hypothetical protein CARUB_v10025236mg [Capsella rubella]
 gb|EOA28984.1| hypothetical protein CARUB_v10025236mg [Capsella rubella]
Length=493

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 196/215 (91%), Gaps = 4/215 (2%)
 Frame = +1

Query  139  IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  318
            +A+RR+  G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLPGGTTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  319  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  498
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  499  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAA  678
            V+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  679  AMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            A EIN RL+P+LK LH+SL SKS EFKDI+KIGRT
Sbjct  182  ATEINSRLIPSLKTLHSSLESKSFEFKDIVKIGRT  216



>ref|XP_010506787.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Camelina 
sativa]
Length=493

 Score =   382 bits (980),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 196/215 (91%), Gaps = 4/215 (2%)
 Frame = +1

Query  139  IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  318
            +A+RR++ G T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGKTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  319  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  498
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  499  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAA  678
            V+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  679  AMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            A EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  182  ATEINSRLIPSLKSLHSTLESKSFEFKDIVKIGRT  216



>ref|XP_002283168.2| PREDICTED: fumarate hydratase 1, mitochondrial [Vitis vinifera]
 emb|CBI39552.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   382 bits (980),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 196/222 (88%), Gaps = 7/222 (3%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISS---ESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  297
            MAML A R   CGS RS+     E LRY  C R FSTSFREE+DT G + VP DKLWGAQ
Sbjct  1    MAMLRAYR---CGSYRSLMPQFMEMLRYD-CLRAFSTSFREEKDTLGTVLVPDDKLWGAQ  56

Query  298  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  477
            TQRSLQNFEIGG+ ERMPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGK
Sbjct  57   TQRSLQNFEIGGESERMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGK  116

Query  478  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFP  657
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFP
Sbjct  117  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFP  176

Query  658  TVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            TVMHIAA +EIN R +P LKQLHTSLHSKS+EFKDIIKIGRT
Sbjct  177  TVMHIAAGVEINSRFIPKLKQLHTSLHSKSLEFKDIIKIGRT  218



>ref|XP_010245463.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nelumbo 
nucifera]
Length=553

 Score =   384 bits (985),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 197/220 (90%), Gaps = 1/220 (0%)
 Frame = +1

Query  124  QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            +MAM   +RR+ C ST   S  +LR   C R  STSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  58   EMAMFTVSRRLPCASTTLRSVWALR-AACLRSISTSFREERDTFGPILVPSDKLWGAQTQ  116

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGGDRE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEV+EGKLN
Sbjct  117  RSLQNFDIGGDREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVSEGKLN  176

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  177  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTV  236

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAA+EIN R +P+LKQLH SL SKS+EFK IIKIGRT
Sbjct  237  MHIAAAVEINSRFIPSLKQLHASLDSKSLEFKVIIKIGRT  276



>ref|XP_002273033.1| PREDICTED: fumarate hydratase 1, mitochondrial [Vitis vinifera]
 emb|CBI36898.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +1

Query  133  MLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSL  312
            M+ AA R  CG +       LRY +C R  STSFREE+DTFGPI VPSDKLWGAQTQRSL
Sbjct  2    MMYAASRRLCGGSAGSPLLGLRY-MCLRSLSTSFREEKDTFGPILVPSDKLWGAQTQRSL  60

Query  313  QNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHF  492
            QNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEV+EGKLNDHF
Sbjct  61   QNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVSEGKLNDHF  120

Query  493  PLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHI  672
            PLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPTVMHI
Sbjct  121  PLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKYVHPNDHVNRSQSSNDTFPTVMHI  180

Query  673  AAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            AAA EIN RL+P+LK L T+LHSKS+EFKDIIKIGRT
Sbjct  181  AAATEINSRLIPSLKHLETALHSKSIEFKDIIKIGRT  217



>ref|XP_010507882.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X3 [Camelina 
sativa]
Length=493

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = +1

Query  139  IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  318
            +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGTTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  319  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  498
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  499  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAA  678
            V+WQTGSGTQSNMNANEVIANRAAEILG +RGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRRRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  679  AMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            A EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  182  ATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  216



>ref|XP_010518455.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Camelina 
sativa]
Length=493

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = +1

Query  139  IAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  318
            +A+RR++ G+T +    +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQN
Sbjct  6    VASRRLSGGTTAT----ALRYATALRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQN  61

Query  319  FEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPL  498
            FEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPL
Sbjct  62   FEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPL  121

Query  499  VIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAA  678
            V+WQTGSGTQSNMNANEVIANRAAEILG +RGEK VHPNDHVNRSQSSNDTFPTVMHIAA
Sbjct  122  VVWQTGSGTQSNMNANEVIANRAAEILGRRRGEKCVHPNDHVNRSQSSNDTFPTVMHIAA  181

Query  679  AMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            A EIN RL+P+LK LH++L SKS EFKDI+KIGRT
Sbjct  182  ATEINSRLIPSLKTLHSTLESKSFEFKDIVKIGRT  216



>ref|XP_002302734.1| Fumarate hydratase 1 family protein [Populus trichocarpa]
 gb|EEE82007.1| Fumarate hydratase 1 family protein [Populus trichocarpa]
Length=490

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 196/219 (89%), Gaps = 6/219 (3%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RR++ GST      + RY    R +ST+FREERDTFGPI VP+DKLWGAQTQR
Sbjct  1    MAMYIVSRRLSTGST------TWRYGNWLRSYSTAFREERDTFGPISVPADKLWGAQTQR  54

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGGDRERMPEPIIRAFGILKKCAAKVNM+YGL+PSIGKA+MQAA EVAEGKL+D
Sbjct  55   SLQNFDIGGDRERMPEPIIRAFGILKKCAAKVNMQYGLDPSIGKAIMQAAHEVAEGKLSD  114

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  115  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVM  174

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P LK LH +LHSKSVEFKDI+KIGRT
Sbjct  175  HIAAATEINSRLIPKLKTLHLTLHSKSVEFKDIVKIGRT  213



>ref|XP_011007799.1| PREDICTED: fumarate hydratase 1, mitochondrial [Populus euphratica]
Length=490

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 196/219 (89%), Gaps = 6/219 (3%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RR++ GST      + RY    R +ST+FREERDTFGPI VP+DKLWGAQTQR
Sbjct  1    MAMYIVSRRLSTGST------TWRYGNWLRSYSTAFREERDTFGPINVPADKLWGAQTQR  54

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGGDRERMPEPIIRAFGILKKCAAKVN+EYGL+PSIGKA+MQAA EVAEGKL+D
Sbjct  55   SLQNFDIGGDRERMPEPIIRAFGILKKCAAKVNIEYGLDPSIGKAIMQAAHEVAEGKLSD  114

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  115  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVM  174

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA EIN RL+P LK LH +LHSKSVEFKDI+KIGRT
Sbjct  175  HIAAATEINSRLIPKLKTLHLTLHSKSVEFKDIVKIGRT  213



>ref|XP_009346608.1| PREDICTED: fumarate hydratase 1, mitochondrial [Pyrus x bretschneideri]
Length=493

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 196/219 (89%), Gaps = 3/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ + +RR   GST      +LRY    R +ST FREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAVYLVSRRAAGGST---PLAALRYATSLRPYSTKFREERDTFGPINVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMPEPI+RAFG+LKKCAA+VNMEYGL+P+IGKAVMQAAQEVAEGKLN+
Sbjct  58   SLQNFDIGGERERMPEPIVRAFGVLKKCAAEVNMEYGLDPTIGKAVMQAAQEVAEGKLNE  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  118  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSNDTFPTVM  177

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIA+AMEIN RL+PNL+ LH +LHSKS EFKDI+KIGRT
Sbjct  178  HIASAMEINSRLIPNLQTLHAALHSKSEEFKDIVKIGRT  216



>ref|XP_008790868.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=498

 Score =   379 bits (973),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 199/222 (90%), Gaps = 4/222 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSIS---SESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  297
            MAM++ A R   G + + S   +  LR  +C R  ST+FREERDTFGPI VP+DKLWGAQ
Sbjct  1    MAMMVGASRRLAGRSNAASMLVAGMLRSALC-RPISTAFREERDTFGPIMVPADKLWGAQ  59

Query  298  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  477
            TQRSLQNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGK
Sbjct  60   TQRSLQNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGK  119

Query  478  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFP  657
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK GEK VHPNDHVNR+QSSNDTFP
Sbjct  120  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKHGEKFVHPNDHVNRAQSSNDTFP  179

Query  658  TVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            TVMHIAAA+EIN R +P+LKQLH+SLHSKSVEFKDIIKIGRT
Sbjct  180  TVMHIAAAVEINSRFIPSLKQLHSSLHSKSVEFKDIIKIGRT  221



>ref|XP_010938348.1| PREDICTED: fumarate hydratase 1, mitochondrial [Elaeis guineensis]
Length=498

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 199/222 (90%), Gaps = 4/222 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISS---ESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  297
            MAM++ A R   G + + S+     LR  +C R  ST+FREERDTFGPI VP+DKLWGAQ
Sbjct  1    MAMMVGASRRLAGRSNAASALLAGMLRSALC-RPISTAFREERDTFGPIMVPADKLWGAQ  59

Query  298  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  477
            TQRSLQNF+IGG+RE+MPEPIIRAFGILKKCAAKVNMEYGL+PSIGKA+MQAAQEVAEGK
Sbjct  60   TQRSLQNFDIGGEREQMPEPIIRAFGILKKCAAKVNMEYGLDPSIGKAIMQAAQEVAEGK  119

Query  478  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFP  657
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK GEK VHPNDHVNR+QSSNDTFP
Sbjct  120  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKCGEKFVHPNDHVNRAQSSNDTFP  179

Query  658  TVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            TVMHIAAA+EIN R +P+LKQLH+SLHSKSVEFKDIIKIGRT
Sbjct  180  TVMHIAAAVEINSRFIPSLKQLHSSLHSKSVEFKDIIKIGRT  221



>ref|XP_007145184.1| hypothetical protein PHAVU_007G217600g [Phaseolus vulgaris]
 gb|ESW17178.1| hypothetical protein PHAVU_007G217600g [Phaseolus vulgaris]
Length=495

 Score =   376 bits (966),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 201/219 (92%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+  A+RR++ GS  S +  +LR+    R +S+SFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MALYAASRRLSTGS-NSTTLLALRFASSSRSYSSSFREERDTFGPIQVPSDKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG RERMPEPI+RAFG+LKKCAAKVNMEYGL+P++GKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFDIGGPRERMPEPIVRAFGVLKKCAAKVNMEYGLDPNVGKAIMQAAQEVAEGKLND  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKVVHPNDHVNRSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN RL+P+LK LH +L+SKS+EFKDI+KIGRT
Sbjct  180  HIAAAMEINSRLIPSLKTLHGTLNSKSIEFKDIVKIGRT  218



>ref|XP_008345222.1| PREDICTED: fumarate hydratase 1, mitochondrial [Malus domestica]
Length=495

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 194/220 (88%), Gaps = 3/220 (1%)
 Frame = +1

Query  124  QMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            QMAM I +RR   G    +++   RY    R +STSFREERDTFGPI VPSDKLWGAQTQ
Sbjct  2    QMAMYIVSRRA-AGELTPLAA--FRYATSSRAYSTSFREERDTFGPINVPSDKLWGAQTQ  58

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLN
Sbjct  59   RSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLN  118

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
             HFPLVIWQTGSGTQSNMN NEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  119  QHFPLVIWQTGSGTQSNMNVNEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSNDTFPTV  178

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIA+A EIN RL+PNL+ LH +LHSKS EFKDI+KIGRT
Sbjct  179  MHIASAKEINSRLIPNLQTLHAALHSKSEEFKDIVKIGRT  218



>gb|AAB39989.1| fumarase [Arabidopsis thaliana]
Length=491

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  190  SLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRA  369
            +LRY    R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG+RERMPEPI+RA
Sbjct  17   ALRYATSLRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGERERMPEPIVRA  76

Query  370  FGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANE  549
            FG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANE
Sbjct  77   FGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANE  136

Query  550  VIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHT  729
            VIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN RL+P+LK LH 
Sbjct  137  VIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRLIPSLKTLHR  196

Query  730  SLHSKSVEFKDIIKIGRT  783
            +L SKS EFKDI+KIGRT
Sbjct  197  TLESKSFEFKDIVKIGRT  214



>ref|XP_009378742.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Pyrus x bretschneideri]
Length=566

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 195/226 (86%), Gaps = 3/226 (1%)
 Frame = +1

Query  106  SSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKL  285
            S     QMAM + +RR   G T      + RY    R +STSFREERDTFGPI VPSDKL
Sbjct  67   SEFYHQQMAMYVVSRRAAGGLT---PLAAFRYATSLRAYSTSFREERDTFGPINVPSDKL  123

Query  286  WGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEV  465
            WGAQTQRSLQNF+IGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQEV
Sbjct  124  WGAQTQRSLQNFDIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQEV  183

Query  466  AEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSN  645
            AEGKLN HFPLVIWQTGSGTQSNMNANEVI+NRAAEILGH+RGEK VHPNDHVNRSQSSN
Sbjct  184  AEGKLNQHFPLVIWQTGSGTQSNMNANEVISNRAAEILGHQRGEKFVHPNDHVNRSQSSN  243

Query  646  DTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            DTFPTVMHIA+A EIN RL+PNL+ LH +LHSKS EFKDI+KIGRT
Sbjct  244  DTFPTVMHIASAKEINSRLIPNLQTLHAALHSKSEEFKDIVKIGRT  289



>ref|XP_009384520.1| PREDICTED: fumarate hydratase 1, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   371 bits (953),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 202/222 (91%), Gaps = 4/222 (2%)
 Frame = +1

Query  127  MAMLIAA-RRVT--CGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  297
            MAM++AA RR+    G+  ++S+  LR +   +  + +FREERDTFGPI VP+D+LWGAQ
Sbjct  1    MAMMVAAARRLAGRSGAAPALSNVVLR-SATLQTMAGAFREERDTFGPIMVPADRLWGAQ  59

Query  298  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  477
            TQRSLQNF+IGG+RE+MPEPIIRAFG+LKKCAAKVNMEYGL+P++GKA+MQAAQEVAEGK
Sbjct  60   TQRSLQNFDIGGEREQMPEPIIRAFGVLKKCAAKVNMEYGLDPTVGKAIMQAAQEVAEGK  119

Query  478  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFP  657
            LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFP
Sbjct  120  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSSNDTFP  179

Query  658  TVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            TVMHIAAA+EIN R +P+LKQLH+SLH+KS+EFKDI+KIGRT
Sbjct  180  TVMHIAAAVEINSRFIPSLKQLHSSLHTKSLEFKDIVKIGRT  221



>ref|XP_008454312.1| PREDICTED: fumarate hydratase 1, mitochondrial [Cucumis melo]
Length=494

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  196  RY-TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  372
            RY T   R +STSFREERDTFGPI VPSD+LWGAQTQRSLQNFEIGGDRERMPEPIIRAF
Sbjct  21   RYATTSLRSYSTSFREERDTFGPINVPSDRLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  80

Query  373  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  552
            G+LKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEV
Sbjct  81   GVLKKCAAKVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEV  140

Query  553  IANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            IANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN + +P LK LH+S
Sbjct  141  IANRASEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSKFIPKLKTLHSS  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L+SKS+EFKDI+KIGRT
Sbjct  201  LYSKSIEFKDIVKIGRT  217



>ref|XP_009802913.1| PREDICTED: fumarate hydratase 1, mitochondrial [Nicotiana sylvestris]
Length=465

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
             +TSFREE+DTFGPI VPSDKLWGAQTQRSLQNF+IGG+RERMPEPIIRAFGILKKCAAK
Sbjct  1    MATSFREEKDTFGPILVPSDKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGILKKCAAK  60

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+ SIGKA+MQAA+EVAEGKLNDHFPLV+WQTGSGT SNMNANEVIANRAAEIL
Sbjct  61   VNMEYGLDRSIGKAIMQAAEEVAEGKLNDHFPLVVWQTGSGTHSNMNANEVIANRAAEIL  120

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GHKRG+K VHPNDHVNRSQSSNDTFPTVMHIA AME+NKRLLPNLKQLHTSLHSKSVEFK
Sbjct  121  GHKRGDKHVHPNDHVNRSQSSNDTFPTVMHIAVAMELNKRLLPNLKQLHTSLHSKSVEFK  180

Query  760  DIIKIGRT  783
            DIIKIGRT
Sbjct  181  DIIKIGRT  188



>ref|XP_004152237.1| PREDICTED: fumarate hydratase 1, mitochondrial [Cucumis sativus]
 gb|KGN52832.1| hypothetical protein Csa_4G001990 [Cucumis sativus]
Length=495

 Score =   369 bits (947),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  196  RY-TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  372
            RY T   R +STSFREERDTFGPI VPSD+LWGAQTQRSLQNFEIGGDRERMPEPIIRAF
Sbjct  21   RYATTSLRSYSTSFREERDTFGPINVPSDRLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  80

Query  373  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  552
            G+LKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEV
Sbjct  81   GVLKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEV  140

Query  553  IANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            IANRA+EILGHKRG+K VHPNDHVNRSQSSNDTFPTVMHIAAA EIN + +P LK LH+S
Sbjct  141  IANRASEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSKFIPKLKTLHSS  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L+SKS+EFKDI+KIGRT
Sbjct  201  LYSKSIEFKDIVKIGRT  217



>ref|XP_010482421.1| PREDICTED: fumarate hydratase 2, chloroplastic-like [Camelina 
sativa]
Length=499

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            RY+S+SFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPIIRAFG+LKKCA
Sbjct  33   RYYSSSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIIRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS E
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKILHSTLESKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>ref|XP_010442577.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X2 
[Camelina sativa]
Length=491

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIVRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS E
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKILHSTLVSKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>ref|XP_010442576.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X1 
[Camelina sativa]
Length=499

 Score =   367 bits (942),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIVRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS E
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKILHSTLVSKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>emb|CDY27481.1| BnaC04g51220D [Brassica napus]
Length=487

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 197/220 (90%), Gaps = 11/220 (5%)
 Frame = +1

Query  127  MAMLIAARRVTCGST-RSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MA+ +A+RR++ G+  R++ S          Y ++SFREERDTFGPIQVPSDKLWGAQTQ
Sbjct  1    MAIYVASRRLSSGTALRAMRS----------YSTSSFREERDTFGPIQVPSDKLWGAQTQ  50

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNFEIGG+RERMPEPI+RAFG+LKKCAAKVNMEYGL+P+IGKA+M+AAQEVAEGKL+
Sbjct  51   RSLQNFEIGGERERMPEPIVRAFGVLKKCAAKVNMEYGLDPTIGKAIMEAAQEVAEGKLS  110

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
             HFPLV+WQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTV
Sbjct  111  HHFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNRSQSSNDTFPTV  170

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAA EIN RL+P+LK LH++LHSKS +FKDI+KIGRT
Sbjct  171  MHIAAATEINSRLIPSLKTLHSTLHSKSFDFKDIVKIGRT  210



>ref|NP_199908.1| fumarate hydratase 2 [Arabidopsis thaliana]
 sp|Q9FI53.1|FUM2_ARATH RecName: Full=Fumarate hydratase 2, chloroplastic; Short=Fumarase 
2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08741.1| fumarate hydratase [Arabidopsis thaliana]
 gb|AAK97668.1| AT5g50950/K3K7_11 [Arabidopsis thaliana]
 gb|AAM47378.1| AT5g50950/K3K7_11 [Arabidopsis thaliana]
 gb|AED96015.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=499

 Score =   366 bits (940),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            R +ST FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH+SL SKS E
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKNLHSSLESKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>ref|XP_010442609.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X1 
[Camelina sativa]
Length=499

 Score =   366 bits (940),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPIIRAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIIRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILG+KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS E
Sbjct  153  ILGYKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITTRLIPSLKFLHSTLESKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>ref|XP_010442613.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X2 
[Camelina sativa]
Length=491

 Score =   366 bits (939),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            RY+STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPIIRAFG+LKKCA
Sbjct  33   RYYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERMPEPIIRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQ+NMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPTIGEAIMKAAQEVAEGKLNDHFPLVVWQTGSGTQTNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILG+KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS E
Sbjct  153  ILGYKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITTRLIPSLKFLHSTLESKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>ref|XP_004495932.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cicer arietinum]
Length=493

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = +1

Query  217  YFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAA  396
            Y S+SFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGG RERMPEPI+RAFGILKKCAA
Sbjct  28   YSSSSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGPRERMPEPIVRAFGILKKCAA  87

Query  397  KVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEI  576
            KVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRA+EI
Sbjct  88   KVNMEYGLDPTIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRASEI  147

Query  577  LGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEF  756
            LGH RGEK VHPNDHVNRSQSSNDTFPTVMHIAA MEIN RL+P+LK LH +L+SKS+EF
Sbjct  148  LGHMRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAGMEINSRLIPSLKTLHATLNSKSIEF  207

Query  757  KDIIKIGRT  783
            KDI+KIGRT
Sbjct  208  KDIVKIGRT  216



>ref|XP_006280350.1| hypothetical protein CARUB_v10026277mg [Capsella rubella]
 gb|EOA13248.1| hypothetical protein CARUB_v10026277mg [Capsella rubella]
Length=498

 Score =   366 bits (939),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
            +STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG+LKKCAAK
Sbjct  34   YSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGVLKKCAAK  93

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P+IG+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  94   VNMEYGLDPTIGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  153

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GH+RGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN RL+P+LK L ++L SKS EFK
Sbjct  154  GHERGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRLIPSLKNLLSTLESKSFEFK  213

Query  760  DIIKIGRT  783
            DI+KIGRT
Sbjct  214  DIVKIGRT  221



>ref|NP_851166.1| fumarate hydratase 2 [Arabidopsis thaliana]
 dbj|BAH19582.1| AT5G50950 [Arabidopsis thaliana]
 gb|AED96014.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=510

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            R +ST FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH+SL SKS E
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKNLHSSLESKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>ref|XP_010442599.1| PREDICTED: fumarate hydratase 2, chloroplastic [Camelina sativa]
Length=498

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
            +STSFREERDTFGPIQVPSDKLWGAQTQRSL+NFEIGG+RERMPEPIIRAFG+LKKCAAK
Sbjct  34   YSTSFREERDTFGPIQVPSDKLWGAQTQRSLRNFEIGGNRERMPEPIIRAFGVLKKCAAK  93

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P+IG+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  94   VNMEYGLDPTIGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  153

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS EFK
Sbjct  154  GHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKNLHSTLESKSFEFK  213

Query  760  DIIKIGRT  783
            DI+KIGRT
Sbjct  214  DIVKIGRT  221



>ref|XP_002864085.1| hypothetical protein ARALYDRAFT_495160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40344.1| hypothetical protein ARALYDRAFT_495160 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            R +STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFKIGGDRERMPEPIVRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A EI  RL+P+LK LH+SL SKS E
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAVATEITSRLIPSLKNLHSSLESKSFE  212

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  213  FKDIVKIGRT  222



>gb|ACJ85812.1| unknown [Medicago truncatula]
Length=352

 Score =   359 bits (922),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 193/221 (87%), Gaps = 9/221 (4%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFS--TSFREERDTFGPIQVPSDKLWGAQT  300
            MA+ + +RR+   ST+S S     +    RYFS  T+FREERDTFGPIQ PSDKLWGAQT
Sbjct  1    MALYVLSRRL---STKSTSPTPFTF----RYFSSTTTFREERDTFGPIQAPSDKLWGAQT  53

Query  301  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  480
            QRSLQNF+IGG RERMPEPIIR+FGILKKCAAKVNMEYGL+P+IGKA+M+AAQEVA+GK 
Sbjct  54   QRSLQNFDIGGPRERMPEPIIRSFGILKKCAAKVNMEYGLDPTIGKAIMKAAQEVADGKH  113

Query  481  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPT  660
            NDHFPLV+WQTGSGTQSNMNANEVIANRA+EILGHKRGEK VHPNDHVN SQSSNDTFPT
Sbjct  114  NDHFPLVVWQTGSGTQSNMNANEVIANRASEILGHKRGEKFVHPNDHVNMSQSSNDTFPT  173

Query  661  VMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            VMHIAA  EIN RL+P+LK LH +L +KS+EFKDI+KIGRT
Sbjct  174  VMHIAAGTEINSRLIPSLKTLHATLDAKSIEFKDIVKIGRT  214



>ref|XP_003557953.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=494

 Score =   364 bits (934),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 198/220 (90%), Gaps = 4/220 (2%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRY-TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQ  303
            MAM++  RR+  G++ S S+ +L +     R  ST FREERDTFGPI+VPSDKLWGAQTQ
Sbjct  1    MAMVL--RRL-AGASGSPSAAALLFRPALTRPISTGFREERDTFGPIRVPSDKLWGAQTQ  57

Query  304  RSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLN  483
            RSLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+
Sbjct  58   RSLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLD  117

Query  484  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTV  663
            DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTV
Sbjct  118  DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTV  177

Query  664  MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            MHIAAA+EIN R +P+L+QLH SLHSKS EFKDIIKIGRT
Sbjct  178  MHIAAAVEINSRFIPSLEQLHKSLHSKSDEFKDIIKIGRT  217



>ref|XP_003518952.1| PREDICTED: fumarate hydratase 1, mitochondrial [Glycine max]
 gb|KHN08664.1| Fumarate hydratase 1, mitochondrial [Glycine soja]
Length=495

 Score =   363 bits (933),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 198/219 (90%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ + +RR++ GS  S +  +LR+    R +S+SFREERDTFG IQVPS+KLWGAQTQR
Sbjct  1    MALYVLSRRLSAGS-NSTTLLALRFVSSTRSYSSSFREERDTFGAIQVPSEKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG RERMPEPIIRAFG+LKKCAAKVNMEYGL+P++GKA+MQAAQEVAEGKLND
Sbjct  60   SLQNFDIGGPRERMPEPIIRAFGVLKKCAAKVNMEYGLDPAVGKAIMQAAQEVAEGKLND  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEIL HKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILWHKRGGKLVHPNDHVNRSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAAMEIN RL+P+LK LH +L+SKS+EFKDI+KIGRT
Sbjct  180  HIAAAMEINSRLIPSLKTLHGTLNSKSIEFKDIVKIGRT  218



>ref|XP_003591472.1| Fumarate hydratase [Medicago truncatula]
 gb|AES61723.1| fumarate hydratase [Medicago truncatula]
Length=491

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 195/221 (88%), Gaps = 9/221 (4%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFS--TSFREERDTFGPIQVPSDKLWGAQT  300
            MA+ + +RR++  ST    S +L     +RYFS  T+FREERDTFGPIQVPSDKLWGAQT
Sbjct  1    MALYVLSRRLSTKST----SPTL---FTFRYFSSTTTFREERDTFGPIQVPSDKLWGAQT  53

Query  301  QRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKL  480
            QRSLQNF+IGG RERMPEPIIR+FGILKKCAAKVNMEYGL+P+IGKA+M+AAQEVA+GK 
Sbjct  54   QRSLQNFDIGGPRERMPEPIIRSFGILKKCAAKVNMEYGLDPTIGKAIMKAAQEVADGKH  113

Query  481  NDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPT  660
            NDHFPLV+WQTGSGTQSNMNANEVIANRA+EILGHKRGEK VHPNDHVN SQSSNDTFPT
Sbjct  114  NDHFPLVVWQTGSGTQSNMNANEVIANRASEILGHKRGEKFVHPNDHVNMSQSSNDTFPT  173

Query  661  VMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            VMHIAA  EIN RL+P+LK LH +L +KS+EFKDI+KIGRT
Sbjct  174  VMHIAAGTEINSRLIPSLKTLHATLDAKSIEFKDIVKIGRT  214



>ref|XP_008795801.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Phoenix dactylifera]
Length=474

 Score =   361 bits (926),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 183/197 (93%), Gaps = 1/197 (1%)
 Frame = +1

Query  193  LRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  372
            L+  +C R  ST FREER  FGP+ VP+DKLWGAQTQRSLQNF+IGG RE+MPEPIIRAF
Sbjct  2    LQSALC-RPLSTVFREERXPFGPMMVPADKLWGAQTQRSLQNFDIGGQREQMPEPIIRAF  60

Query  373  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  552
            GILKKCAAKVNMEYGL+PSIG+A+MQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV
Sbjct  61   GILKKCAAKVNMEYGLDPSIGRAIMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  120

Query  553  IANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            IANRAAEILGHK GEK VHPNDHVNR+QSSNDTFPTVMHIAAA+EIN + +PNLKQLH+S
Sbjct  121  IANRAAEILGHKHGEKFVHPNDHVNRAQSSNDTFPTVMHIAAAVEINSKFIPNLKQLHSS  180

Query  733  LHSKSVEFKDIIKIGRT  783
            LHSKSV+FKDIIKIGRT
Sbjct  181  LHSKSVDFKDIIKIGRT  197



>gb|EMT27288.1| Fumarate hydratase 2, chloroplastic [Aegilops tauschii]
Length=494

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 193/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM++  RR+   S    ++  L      R  ST FREERDTFGPI+VP+DKLWGAQTQR
Sbjct  1    MAMVL--RRLAGASGSPSAAALLLRPALTRPISTGFREERDTFGPIRVPNDKLWGAQTQR  58

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+D
Sbjct  59   SLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLDD  118

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  178

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+EIN R +P+L+QLH SLHSKS EFKDIIKIGRT
Sbjct  179  HIAAAVEINSRFIPSLEQLHKSLHSKSDEFKDIIKIGRT  217



>gb|EMS52788.1| Fumarate hydratase 2, chloroplastic [Triticum urartu]
Length=494

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 193/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM++  RR+   S    ++  L      R  ST FREERDTFGPI+VP+DKLWGAQTQR
Sbjct  1    MAMVL--RRLAGASGSPSAAALLLRPALTRPISTGFREERDTFGPIRVPNDKLWGAQTQR  58

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+D
Sbjct  59   SLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLDD  118

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGDKFVHPNDHVNRSQSSNDTFPTVM  178

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+EIN R +P+L+QLH SLHSKS EFKDIIKIGRT
Sbjct  179  HIAAAVEINSRFIPSLEQLHKSLHSKSDEFKDIIKIGRT  217



>ref|XP_006281482.1| hypothetical protein CARUB_v10027566mg [Capsella rubella]
 gb|EOA14380.1| hypothetical protein CARUB_v10027566mg [Capsella rubella]
Length=481

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            RY STSFREERDTFGPIQVPSDKLWGAQTQRSLQNF+IGGDRER+PEPIIRAFG+LKKCA
Sbjct  21   RYDSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGDRERVPEPIIRAFGVLKKCA  80

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P+IG+A+M+AAQEVAEGKLN+HFPLV+WQTGSGTQ+NMNANEVIANR AE
Sbjct  81   AKVNMEYGLDPTIGEAIMEAAQEVAEGKLNEHFPLVVWQTGSGTQTNMNANEVIANRTAE  140

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A EI  RL+P+LK LH +L SKS+E
Sbjct  141  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAVATEITSRLIPSLKMLHGTLESKSLE  200

Query  754  FKDIIKIGRT  783
            FKDI+KIGRT
Sbjct  201  FKDIVKIGRT  210



>ref|XP_004984441.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Setaria 
italica]
Length=496

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 192/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  133  MLIAARRV--TCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            M +A RR+    GS  + ++  L      R  ST FREERDTFGPIQVP+DKLWGAQTQR
Sbjct  1    MAMALRRLAGVSGSPSAAAAALLLRPALTRPISTGFREERDTFGPIQVPNDKLWGAQTQR  60

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKL+D
Sbjct  61   SLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLDD  120

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  121  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  180

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+EIN + +P+L+QLH SLH+KSVEF DIIKIGRT
Sbjct  181  HIAAAVEINSKFIPSLQQLHDSLHAKSVEFIDIIKIGRT  219



>ref|XP_010026118.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Eucalyptus 
grandis]
Length=479

 Score =   358 bits (918),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  223  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  402
            ST FREERDTFGPI VP++KLWGAQTQRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKV
Sbjct  15   STGFREERDTFGPILVPANKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKV  74

Query  403  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  582
            NMEYGL+PSIG A+MQAA+EVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG
Sbjct  75   NMEYGLDPSIGGAIMQAAEEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  134

Query  583  HKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKD  762
             KRGEK+VHPNDHVNRSQSSNDTFPTVMHIAA MEIN RLLP+L  LH+SL SKS+EFKD
Sbjct  135  RKRGEKSVHPNDHVNRSQSSNDTFPTVMHIAAVMEINSRLLPSLGNLHSSLQSKSIEFKD  194

Query  763  IIKIGRT  783
            I+KIGRT
Sbjct  195  IVKIGRT  201



>gb|KCW58396.1| hypothetical protein EUGRSUZ_H01083 [Eucalyptus grandis]
Length=478

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  223  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  402
            ST FREERDTFGPI VP++KLWGAQTQRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKV
Sbjct  15   STGFREERDTFGPILVPANKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKV  74

Query  403  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  582
            NMEYGL+PSIG A+MQAA+EVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG
Sbjct  75   NMEYGLDPSIGGAIMQAAEEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  134

Query  583  HKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKD  762
             KRGEK+VHPNDHVNRSQSSNDTFPTVMHIAA MEIN RLLP+L  LH+SL SKS+EFKD
Sbjct  135  RKRGEKSVHPNDHVNRSQSSNDTFPTVMHIAAVMEINSRLLPSLGNLHSSLQSKSIEFKD  194

Query  763  IIKIGRT  783
            I+KIGRT
Sbjct  195  IVKIGRT  201



>gb|KHN08665.1| Fumarate hydratase 2, chloroplastic [Glycine soja]
Length=466

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
             + SFREERDTFG IQVPS+KLWGAQTQRSLQNF+IGG RERMPEPIIRAFG+LKKCAAK
Sbjct  1    MALSFREERDTFGAIQVPSEKLWGAQTQRSLQNFDIGGPRERMPEPIIRAFGVLKKCAAK  60

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P++G+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  61   VNMEYGLDPNVGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  120

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN RL+P+LK LH +L+SKSVEFK
Sbjct  121  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRLIPSLKTLHDTLNSKSVEFK  180

Query  760  DIIKIGRT  783
            DI+KIGRT
Sbjct  181  DIVKIGRT  188



>ref|XP_003518957.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Glycine 
max]
Length=465

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
             + SFREERDTFG IQVPS+KLWGAQTQRSLQNF+IGG RERMPEPIIRAFG+LKKCAAK
Sbjct  1    MALSFREERDTFGAIQVPSEKLWGAQTQRSLQNFDIGGPRERMPEPIIRAFGVLKKCAAK  60

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P++G+A+MQAAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  61   VNMEYGLDPNVGEAIMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  120

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN RL+P+LK LH +L+SKSVEFK
Sbjct  121  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRLIPSLKTLHDTLNSKSVEFK  180

Query  760  DIIKIGRT  783
            DI+KIGRT
Sbjct  181  DIVKIGRT  188



>ref|XP_006651566.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Oryza brachyantha]
Length=491

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            R  ST FREERDTFGPI+VP DKLWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCA
Sbjct  25   RPISTGFREERDTFGPIRVPDDKLWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCA  84

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P IGKA++QAAQEVAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAE
Sbjct  85   AKVNMEYGLDPKIGKAIIQAAQEVAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAE  144

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVE  753
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN + +P+L+QLH SL+SKSVE
Sbjct  145  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEINSKFVPSLQQLHKSLYSKSVE  204

Query  754  FKDIIKIGRT  783
            F+DIIKIGRT
Sbjct  205  FQDIIKIGRT  214



>ref|XP_010103413.1| Fumarate hydratase 1 [Morus notabilis]
 gb|EXB95732.1| Fumarate hydratase 1 [Morus notabilis]
Length=494

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 192/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM   +RR+  GS+  + S     ++  RY +TSFREERDTFGPI VPSDK WGAQTQR
Sbjct  1    MAMYTISRRIQNGSSTVVVSR-FATSLNLRY-ATSFREERDTFGPILVPSDKYWGAQTQR  58

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPII+AFG LKKCAAKVN+EYGL+P+IGKA++QAAQEVA+GKLND
Sbjct  59   SLQNFEIGGERERMPEPIIQAFGTLKKCAAKVNLEYGLDPTIGKAIIQAAQEVADGKLND  118

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILG K G+K VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGRKCGDKFVHPNDHVNRSQSSNDTFPTVM  178

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+EIN RL+PNLK L+ +L SKS+EF DI+KIGRT
Sbjct  179  HIAAALEINSRLIPNLKTLYNTLDSKSIEFGDIVKIGRT  217



>gb|EEC75213.1| hypothetical protein OsI_11478 [Oryza sativa Indica Group]
Length=502

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
             ST FREERDTFGPI+VP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCAAK
Sbjct  38   ISTGFREERDTFGPIRVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAK  97

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P+IGKA+MQAAQEVAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAEIL
Sbjct  98   VNMEYGLDPTIGKAIMQAAQEVAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  157

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN R +P+L+QLH SL SKSVEF+
Sbjct  158  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRFVPSLQQLHKSLDSKSVEFQ  217

Query  760  DIIKIGRT  783
            DIIKIGRT
Sbjct  218  DIIKIGRT  225



>gb|ABF95833.1| Fumarate hydratase 1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01638.1| unnamed protein product [Oryza sativa Japonica Group]
Length=502

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
             ST FREERDTFGPI+VP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCAAK
Sbjct  38   ISTGFREERDTFGPIRVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAK  97

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P+IGKA+MQAAQEVAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAEIL
Sbjct  98   VNMEYGLDPTIGKAIMQAAQEVAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  157

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            GHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EIN R +P+L+QLH SL SKSVEF+
Sbjct  158  GHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAATEINSRFVPSLQQLHKSLDSKSVEFQ  217

Query  760  DIIKIGRT  783
            DIIKIGRT
Sbjct  218  DIIKIGRT  225



>ref|XP_008359427.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Malus domestica]
Length=499

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 192/225 (85%), Gaps = 9/225 (4%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA+ I +R     ST      +LR+    R +ST FREERDTFGP  VPSDKLWGAQTQR
Sbjct  1    MAIYIVSRWAAGVST---PLPALRFATSLRPYSTKFREERDTFGPXNVPSDKLWGAQTQR  57

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+RERMP+PI+ AFG+LKKCAAKVNMEYGL+P+IGKAVMQAAQEVAEGKLN+
Sbjct  58   SLQNFDIGGERERMPQPIVCAFGVLKKCAAKVNMEYGLDPTIGKAVMQAAQEVAEGKLNE  117

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPT--  660
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDH+N+SQSSNDTFPT  
Sbjct  118  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHINKSQSSNDTFPTVV  177

Query  661  ----VMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
                VMHIA+A+EIN RL+PNL+ LH +LHSKS EFKDI+KIGRT
Sbjct  178  CYFQVMHIASAVEINSRLIPNLQTLHAALHSKSEEFKDIVKIGRT  222



>ref|NP_001146296.1| uncharacterized protein LOC100279871 [Zea mays]
 gb|ACN32151.1| unknown [Zea mays]
 tpg|DAA45270.1| TPA: hypothetical protein ZEAMMB73_835410 [Zea mays]
Length=498

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  193  LRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  372
            L  +   R  ST FREERDTFGPIQVP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAF
Sbjct  25   LLRSALTRPISTGFREERDTFGPIQVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAF  84

Query  373  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  552
            G+LKKCAAKVNM+YGL+P+IGKA++QAA+EVAEGKL+DHFPLVIWQTGSGTQSNMNANEV
Sbjct  85   GVLKKCAAKVNMDYGLDPTIGKAIIQAAEEVAEGKLDDHFPLVIWQTGSGTQSNMNANEV  144

Query  553  IANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            IANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A+EI+ R +P+L+QLH S
Sbjct  145  IANRASEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIATAVEIHSRFIPSLQQLHDS  204

Query  733  LHSKSVEFKDIIKIGRT  783
            LHSK++EFKDIIKIGRT
Sbjct  205  LHSKTIEFKDIIKIGRT  221



>gb|ACL53645.1| unknown [Zea mays]
Length=498

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  193  LRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  372
            L  +   R  ST FREERDTFGPIQVP+DKLWGAQTQRSLQNF+IGG+RERMP PIIRAF
Sbjct  25   LLRSALTRPISTGFREERDTFGPIQVPNDKLWGAQTQRSLQNFDIGGERERMPVPIIRAF  84

Query  373  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  552
            G+LKKCAAKVNM+YGL+P+IGKA++QAA+EVAEGKL+DHFPLVIWQTGSGTQSNMNANEV
Sbjct  85   GVLKKCAAKVNMDYGLDPTIGKAIIQAAEEVAEGKLDDHFPLVIWQTGSGTQSNMNANEV  144

Query  553  IANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            IANRA+EILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIA A+EI+ R +P+L+QLH S
Sbjct  145  IANRASEILGHKRGEKFVHPNDHVNRSQSSNDTFPTVMHIATAVEIHSRFIPSLQQLHDS  204

Query  733  LHSKSVEFKDIIKIGRT  783
            LHSK++EFKDIIKIGRT
Sbjct  205  LHSKTIEFKDIIKIGRT  221



>ref|XP_003536023.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Glycine 
max]
Length=495

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 197/219 (90%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA  + +RR++ GS  S +  +LR+    R FS+SFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAFYVLSRRLSAGS-NSTTLLALRFASSSRSFSSSFREERDTFGPIQVPSDKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG RERMPEPIIRAFG+LKKCAAKVNMEYGL+P +G+A+MQAAQEVAEGKLN+
Sbjct  60   SLQNFDIGGPRERMPEPIIRAFGVLKKCAAKVNMEYGLDPIVGEAIMQAAQEVAEGKLNE  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAA MEIN RL+P+LK LH +L+SKS+EFKDI+KIGRT
Sbjct  180  HIAATMEINSRLIPSLKTLHGTLNSKSIEFKDIVKIGRT  218



>gb|KHN30668.1| Fumarate hydratase 1, mitochondrial [Glycine soja]
Length=495

 Score =   354 bits (908),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 197/219 (90%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA  + +RR++ GS  S +  +LR+    R FS+SFREERDTFGPIQVPSDKLWGAQTQR
Sbjct  1    MAFYVLSRRLSAGS-NSTTLLALRFASSSRSFSSSFREERDTFGPIQVPSDKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG RERMPEPIIRAFG+LKKCAAKVNMEYGL+P +G+A+MQAAQEVAEGKLN+
Sbjct  60   SLQNFDIGGPRERMPEPIIRAFGVLKKCAAKVNMEYGLDPIVGEAIMQAAQEVAEGKLNE  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEI+GHKRG K VHPNDHVNRSQSSNDTFPTVM
Sbjct  120  HFPLVVWQTGSGTQSNMNANEVIANRAAEIIGHKRGGKFVHPNDHVNRSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAA MEIN RL+P+LK LH +L+SKS+EFKDI+KIGRT
Sbjct  180  HIAATMEINSRLIPSLKTLHGTLNSKSIEFKDIVKIGRT  218



>ref|XP_010482423.1| PREDICTED: fumarate hydratase 2, chloroplastic-like [Camelina 
sativa]
Length=498

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
            ++TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG+RERMPEPIIRAFG+LKKCAAK
Sbjct  34   YATSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGNRERMPEPIIRAFGVLKKCAAK  93

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VNMEYGL+P+IG+A+ QAAQEVAEGKLN HFPLV+WQTGSGTQSNMNANEVIANRAAEIL
Sbjct  94   VNMEYGLDPTIGEAIRQAAQEVAEGKLNGHFPLVVWQTGSGTQSNMNANEVIANRAAEIL  153

Query  580  GHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            G+KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH++L SKS EF+
Sbjct  154  GYKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKNLHSTLESKSFEFR  213

Query  760  DIIKIGRT  783
             I+KIGRT
Sbjct  214  GIVKIGRT  221



>gb|KFK37522.1| hypothetical protein AALP_AA4G268000 [Arabis alpina]
Length=487

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +1

Query  223  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  402
            S+ FREERDTFGPIQVPSDKLWGAQTQRSL+NF+IGG+RERMPEPI+RAFG+LKKCAAKV
Sbjct  24   SSLFREERDTFGPIQVPSDKLWGAQTQRSLENFDIGGERERMPEPIVRAFGVLKKCAAKV  83

Query  403  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  582
            NMEYGL+ +IG+A+M+AAQEVAEGKLN+HFPLV+WQTGSGTQSNMNANEVIANRAAEILG
Sbjct  84   NMEYGLDSTIGEAIMEAAQEVAEGKLNEHFPLVVWQTGSGTQSNMNANEVIANRAAEILG  143

Query  583  HKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKD  762
            HKRGEK VHPNDHVNRSQSSNDTFPTVMHIAA  EI  RL+P+LK LH+SL SKS+EFKD
Sbjct  144  HKRGEKCVHPNDHVNRSQSSNDTFPTVMHIAAVTEITSRLIPSLKTLHSSLESKSLEFKD  203

Query  763  IIKIGRT  783
            I+KIGRT
Sbjct  204  IVKIGRT  210



>gb|AAL62385.1| fumarate hydratase [Arabidopsis thaliana]
Length=214

 Score =   342 bits (878),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  214  RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCA  393
            R +ST FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI+RAFG+LKKCA
Sbjct  33   RSYSTPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCA  92

Query  394  AKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAE  573
            AKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGTQSNMNANEVIANRAAE
Sbjct  93   AKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAE  152

Query  574  ILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSK  744
            ILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+P+LK LH+SL SK
Sbjct  153  ILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLIPSLKNLHSSLESK  209



>gb|ABK24782.1| unknown [Picea sitchensis]
 gb|ABR17637.1| unknown [Picea sitchensis]
Length=495

 Score =   350 bits (899),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 192/219 (88%), Gaps = 1/219 (0%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MA++ A RR    ST S    ++ +T   R  ST+FREERDTFGPI VP+DKLWGAQTQR
Sbjct  1    MAIISAYRRHLSISTASSLMHNISFTYS-RSLSTAFREERDTFGPINVPADKLWGAQTQR  59

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RE+MPE II++FG+LKKCAAKVNM+YGL+P+IGKA+MQAAQEVAEGKLN 
Sbjct  60   SLQNFEIGGEREQMPEQIIQSFGVLKKCAAKVNMDYGLDPTIGKAIMQAAQEVAEGKLNS  119

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVN SQSSNDTFPTVM
Sbjct  120  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGRKRGEKCVHPNDHVNMSQSSNDTFPTVM  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+E+N + +P+L+QLH++L +KS EFKDI+KIGRT
Sbjct  180  HIAAAVEMNSKFIPSLRQLHSTLEAKSNEFKDIVKIGRT  218



>gb|KHG29130.1| Fumarate hydratase 1, mitochondrial -like protein [Gossypium 
arboreum]
Length=461

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 179/219 (82%), Gaps = 25/219 (11%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            MAM I +RR++ GST S    SLRY  CWR F TSFREERDTFGPI VPSDKLWGAQTQR
Sbjct  1    MAMYIVSRRLSAGSTTSQLVTSLRYATCWRSFFTSFREERDTFGPINVPSDKLWGAQTQR  60

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNFEIGG+RERMPEPIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAA+EVAEGKLND
Sbjct  61   SLQNFEIGGERERMPEPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAEEVAEGKLND  120

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLV+WQTGSGTQSNMNANEVIANRAAEILGH+RGEK VHPNDHVNRSQSSNDTFPT+ 
Sbjct  121  HFPLVVWQTGSGTQSNMNANEVIANRAAEILGHQRGEKFVHPNDHVNRSQSSNDTFPTL-  179

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
                                    S S+EFKDI+KIGRT
Sbjct  180  ------------------------STSIEFKDIVKIGRT  194



>gb|ERN02044.1| hypothetical protein AMTR_s00045p00124970 [Amborella trichopoda]
Length=494

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 187/219 (85%), Gaps = 2/219 (1%)
 Frame = +1

Query  127  MAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQR  306
            M ML + RR+            LR T  +    +SFREE+DTFG I VP+DKLWGAQTQR
Sbjct  1    MTMLSSTRRIPHQLLAGPLVGLLRST--YSRLISSFREEKDTFGSILVPADKLWGAQTQR  58

Query  307  SLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLND  486
            SLQNF+IGG+ E+MPEPIIRAFG+LKKC+AKVNMEYGL+PSIGKA+MQAAQEVA+G+LND
Sbjct  59   SLQNFDIGGECEQMPEPIIRAFGVLKKCSAKVNMEYGLDPSIGKAIMQAAQEVADGQLND  118

Query  487  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVM  666
            HFPLVIWQTGSGTQSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVM
Sbjct  119  HFPLVIWQTGSGTQSNMNANEVIANRAAEILGKKRGEKFVHPNDHVNRSQSSNDTFPTVM  178

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA+E N R +P+LKQLH SL +K++EFKDIIKIGRT
Sbjct  179  HIAAAVETNSRFIPSLKQLHASLDAKTIEFKDIIKIGRT  217



>ref|XP_004290822.2| PREDICTED: fumarate hydratase 1, mitochondrial isoform X3 [Fragaria 
vesca subsp. vesca]
Length=469

 Score =   342 bits (877),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  223  STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  402
            S SFREERDTFGPI VPSDKLWGAQTQRSLQNF+IGG+RERMPEPIIRAFGILKKCAAKV
Sbjct  5    SGSFREERDTFGPINVPSDKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGILKKCAAKV  64

Query  403  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  582
            NMEYGL+ SIGKA+M+AAQEVAEGKLN HFPLV+WQTGSGTQSNMNANEVIANRAAEILG
Sbjct  65   NMEYGLDQSIGKAIMEAAQEVAEGKLNQHFPLVVWQTGSGTQSNMNANEVIANRAAEILG  124

Query  583  HKRGEKAVHPNDHVNRSQSSNDTFPTV-MHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
            HKRGEK VHPNDHVN+SQSSNDTFPTV  +IA AME+N RL+P+LK LH +L SK+ EFK
Sbjct  125  HKRGEKFVHPNDHVNKSQSSNDTFPTVHCYIATAMELNSRLIPSLKVLHAALDSKANEFK  184

Query  760  DIIKIGRT  783
            DI+KIGRT
Sbjct  185  DIVKIGRT  192



>ref|XP_007145185.1| hypothetical protein PHAVU_007G217700g [Phaseolus vulgaris]
 gb|ESW17179.1| hypothetical protein PHAVU_007G217700g [Phaseolus vulgaris]
Length=461

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +1

Query  232  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  411
             REE D+FG ++VPSDKLWGAQTQRSL NF+IGG  ERMP+PIIRAFGILKKCAAKVNME
Sbjct  1    MREETDSFGSVEVPSDKLWGAQTQRSLHNFDIGGLSERMPQPIIRAFGILKKCAAKVNME  60

Query  412  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  591
            YGL+P++G+A+MQAAQEVAEGKLN+HFPLV+WQTGSGTQ+NMNANEVIANRAAEILGHKR
Sbjct  61   YGLDPNVGEAIMQAAQEVAEGKLNEHFPLVVWQTGSGTQTNMNANEVIANRAAEILGHKR  120

Query  592  GEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIK  771
            GEK VHPNDHVNRSQSSNDTFPTVMHIAAA+EIN RL+P+LK L  +L+SKS+EF+DI+K
Sbjct  121  GEKFVHPNDHVNRSQSSNDTFPTVMHIAAAIEINSRLIPSLKILLGALNSKSIEFEDIVK  180

Query  772  IGRT  783
            IGRT
Sbjct  181  IGRT  184



>gb|EPS58214.1| hypothetical protein M569_16601, partial [Genlisea aurea]
Length=302

 Score =   319 bits (818),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +1

Query  283  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  462
            LWGAQTQRSLQNFEIGG+RERMPE IIRAFGILKKCAAKVN+EYGL+PSIGKA+M+AAQE
Sbjct  1    LWGAQTQRSLQNFEIGGERERMPEQIIRAFGILKKCAAKVNIEYGLDPSIGKAIMEAAQE  60

Query  463  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSS  642
            VAEGKL++HFPLV+WQTGSGTQSNMNANEVIANRAAE+LGHKRGEK VHPNDHVNRSQSS
Sbjct  61   VAEGKLSEHFPLVVWQTGSGTQSNMNANEVIANRAAELLGHKRGEKFVHPNDHVNRSQSS  120

Query  643  NDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            NDTFPTVMHIAAA+EIN  LLP LKQLHT+LHSK++EF DI+KIGRT
Sbjct  121  NDTFPTVMHIAAALEINSSLLPKLKQLHTTLHSKTIEFYDIVKIGRT  167



>gb|EEE59021.1| hypothetical protein OsJ_10766 [Oryza sativa Japonica Group]
Length=480

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 160/184 (87%), Gaps = 17/184 (9%)
 Frame = +1

Query  283  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  462
            LWGAQTQRSLQNF+IGG+RERMP PIIRAFG+LKKCAAKVNMEYGL+P+IGKA+MQAAQE
Sbjct  20   LWGAQTQRSLQNFDIGGERERMPVPIIRAFGVLKKCAAKVNMEYGLDPTIGKAIMQAAQE  79

Query  463  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSS  642
            VAEG+L+DHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSS
Sbjct  80   VAEGQLDDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKFVHPNDHVNRSQSS  139

Query  643  NDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSK-----------------SVEFKDIIK  771
            NDTFPTVMHIAAA EIN R +P+L+QLH SL SK                 SVEF+DIIK
Sbjct  140  NDTFPTVMHIAAATEINSRFVPSLQQLHKSLDSKVKYGIDRIVCTLPRMYQSVEFQDIIK  199

Query  772  IGRT  783
            IGRT
Sbjct  200  IGRT  203



>gb|KJB22510.1| hypothetical protein B456_004G051500 [Gossypium raimondii]
Length=436

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 155/185 (84%), Gaps = 28/185 (15%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFREERDTFGPI VPSDKLWGAQTQRSLQNF+IGG+RERMPEPIIRAFG+LKKCAAKVNM
Sbjct  3    SFREERDTFGPINVPSDKLWGAQTQRSLQNFDIGGERERMPEPIIRAFGVLKKCAAKVNM  62

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+ SIGKA+MQAAQEVAEGKLNDHFPL++WQTGSGTQSNMNANEVI+NRAAEI+GHK
Sbjct  63   EYGLDQSIGKAIMQAAQEVAEGKLNDHFPLLVWQTGSGTQSNMNANEVISNRAAEIMGHK  122

Query  589  RGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDII  768
            RGEK+VHPNDHVN+SQSSNDTFPT                            SVEFKDI+
Sbjct  123  RGEKSVHPNDHVNKSQSSNDTFPT----------------------------SVEFKDIV  154

Query  769  KIGRT  783
            KIGRT
Sbjct  155  KIGRT  159



>emb|CDW80164.1| fumarate mitochondrial-like [Stylonychia lemnae]
Length=498

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = +1

Query  235  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  414
            R+E+DTFGPI+VP DK WGAQTQRSLQNF+IGG+RERMP P++RAFG+LKK AA+ NM Y
Sbjct  36   RQEKDTFGPIEVPGDKYWGAQTQRSLQNFKIGGERERMPIPVVRAFGLLKKAAAQANMSY  95

Query  415  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  594
            GLE  + KA++QA+ EVA+GKL++HFPLV+WQTGSGTQSNMNANEVIANRA EILG   G
Sbjct  96   GLEEKVAKAIIQASDEVAQGKLDEHFPLVVWQTGSGTQSNMNANEVIANRAIEILGGDLG  155

Query  595  EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKI  774
             K VHPNDHVNRSQSSND+FPTVMH+A  ME+N RL+P+LK+L  SL +KS EFKDIIKI
Sbjct  156  SKLVHPNDHVNRSQSSNDSFPTVMHVATVMEVNHRLIPHLKELTASLKAKSEEFKDIIKI  215

Query  775  GRT  783
            GRT
Sbjct  216  GRT  218



>gb|EJY71120.1| Fumarate hydratase [Oxytricha trifallax]
Length=498

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = +1

Query  235  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  414
            R+E+DTFGPI+VP DK WGAQTQRSLQNF+IGG+RERMP P++RAFG+LKK AA+ N  +
Sbjct  36   RQEKDTFGPIEVPGDKYWGAQTQRSLQNFKIGGERERMPVPVVRAFGLLKKAAAQANTSF  95

Query  415  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  594
            GLE  + +A++QA+ EVA+GKL++HFPLV+WQTGSGTQSNMNANEVIANRA EILG   G
Sbjct  96   GLEAKVAQAIIQASDEVAQGKLDEHFPLVVWQTGSGTQSNMNANEVIANRAIEILGGDLG  155

Query  595  EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKI  774
             K VHPNDHVNRSQSSND+FPTVMH+A  +E+N RL+P+LK L  SL  KS EFKDIIKI
Sbjct  156  SKLVHPNDHVNRSQSSNDSFPTVMHVATVIEVNSRLIPHLKDLTESLRKKSHEFKDIIKI  215

Query  775  GRT  783
            GRT
Sbjct  216  GRT  218



>gb|KDO87117.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87118.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=423

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  346  MPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGT  525
            MPEPI+RAFGILKKCAAKVNMEYGL+P+IGKA+MQAAQEVAEGKLNDHFPLV+WQTGSGT
Sbjct  1    MPEPIVRAFGILKKCAAKVNMEYGLDPAIGKAIMQAAQEVAEGKLNDHFPLVVWQTGSGT  60

Query  526  QSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLL  705
            QSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAAME N RL+
Sbjct  61   QSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAAMETNSRLI  120

Query  706  PNLKQLHTSLHSKSVEFKDIIKIGRT  783
            PNLK LH SLHSKSVEFKDI+KIGRT
Sbjct  121  PNLKVLHNSLHSKSVEFKDIVKIGRT  146



>ref|XP_005850869.1| hypothetical protein CHLNCDRAFT_34079 [Chlorella variabilis]
 gb|EFN58767.1| hypothetical protein CHLNCDRAFT_34079 [Chlorella variabilis]
Length=490

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 166/214 (78%), Gaps = 4/214 (2%)
 Frame = +1

Query  148  RRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEI  327
            R+ T   +  +S   +      R   T  R E DTFGP++VP DKLWGAQTQRS+QNF+I
Sbjct  3    RKTTQSLSSKLSGGQVALPALVRAMGT--RTEYDTFGPLEVPEDKLWGAQTQRSIQNFKI  60

Query  328  GGDRERMPEPIIRAFGILKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVI  504
            GG  ERMPEP++RAFG+LK  AAKVNM+ G L+P IG AV+QAAQEVAEGKL+D+FPLV+
Sbjct  61   GGPTERMPEPVVRAFGVLKGAAAKVNMDLGVLDPKIGNAVVQAAQEVAEGKLSDNFPLVV  120

Query  505  WQTGSGTQSNMNANEVIANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAA  681
            WQTGSGTQSNMNANEVIANRA ++LG   G+K  VHPNDHVN+ QSSNDTFPTVM+IA  
Sbjct  121  WQTGSGTQSNMNANEVIANRAIQLLGGSLGDKGVVHPNDHVNKGQSSNDTFPTVMYIAGV  180

Query  682  MEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
             EI++RLLP LK LH +L +KS EF  IIKIGRT
Sbjct  181  TEIHERLLPGLKHLHGTLDAKSKEFDKIIKIGRT  214



>ref|XP_001761516.1| predicted protein [Physcomitrella patens]
 gb|EDQ73584.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +1

Query  232  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  411
            FREERDTFG IQVP+D+ WGAQTQRS+QNFEIGG+ ERMP+ ++ A GILKKCAA VNME
Sbjct  41   FREERDTFGLIQVPNDRYWGAQTQRSVQNFEIGGESERMPKQLVEALGILKKCAAIVNME  100

Query  412  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  591
            YGL+   G+A+++AA EVA+GKL DHFPLV+WQTGSGTQSNMNANEVIANRA EI+G   
Sbjct  101  YGLDKKFGEAIVKAASEVAQGKLTDHFPLVVWQTGSGTQSNMNANEVIANRAGEIIGIPI  160

Query  592  GEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIK  771
            G K VHPNDHVN SQSSNDTFPT MHIAAA+E   RLLP+L  LH +L  K  +F DI+K
Sbjct  161  GSKGVHPNDHVNMSQSSNDTFPTAMHIAAAIEATSRLLPHLHALHEALIEKQNDFSDIVK  220

Query  772  IGRT  783
            IGRT
Sbjct  221  IGRT  224



>emb|CCG81126.1| Fumarate hydratase, mitochondrial [Taphrina deformans PYCC 5710]
Length=469

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            S+REE DTFGP++V SD+ WGAQTQRSL NF+IGGD ER+P P+I+AFGILKK AA VNM
Sbjct  6    SYREEADTFGPLKVASDRYWGAQTQRSLMNFDIGGDTERLPPPLIKAFGILKKAAATVNM  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P +GKA+ +AA EV  GKL  HFPLV++QTGSGTQSNMNANEVI+NRA EILG +
Sbjct  66   EYGLDPKVGKAIQEAADEVISGKLLSHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGE  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN SQSSNDTFPT MHIAA MEI   L+P LK+LH ++ +K  EFKDI
Sbjct  126  LGSKKPVHPNDHVNMSQSSNDTFPTAMHIAAVMEITNNLVPALKELHEAMDAKGQEFKDI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>emb|CEG73219.1| Putative AaceriACR013Cp [Rhizopus microsporus]
Length=494

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 157/197 (80%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASAVLQKFRTERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPGERMPEPLIRAFG  80

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YGL+P IG+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGLDPKIGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI  RL+P L  L  +
Sbjct  141  SNRAIELLGGELGTKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIYHRLIPALTTLRDA  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EFKDIIKIGRT
Sbjct  201  LQAKSDEFKDIIKIGRT  217



>ref|XP_009701525.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Cariama 
cristata]
Length=265

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  13   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  72

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  73   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  132

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  133  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  192

Query  766  IKIGRT  783
            IKIGRT
Sbjct  193  IKIGRT  198



>gb|KFP59440.1| hypothetical protein N322_00331, partial [Cariama cristata]
Length=258

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_008333578.1| PREDICTED: fumarate hydratase, mitochondrial [Cynoglossus semilaevis]
Length=499

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 172/240 (72%), Gaps = 19/240 (8%)
 Frame = +1

Query  67   WRQRRLLSAFGCGSSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREER  246
             R  RL+  F C           L+ ++R T  S   +S+         R  ST +R ER
Sbjct  2    LRSLRLVQQFNC----------TLLTSQRFTLNSKVLLSTS--------RMASTEYRIER  43

Query  247  DTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEP  426
            DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP  +I+AFGILKK AA+VN +YGL P
Sbjct  44   DTFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQVIKAFGILKKAAAEVNKDYGLSP  103

Query  427  SIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-A  603
            SI  A++QAA EV+ GKL+DHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG K G K  
Sbjct  104  SIADAIIQAADEVSAGKLDDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGKLGSKDP  163

Query  604  VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP LK LH +L +K+ EFKDIIKIGRT
Sbjct  164  VHPNDHVNKSQSSNDTFPTAMHIAAATEVHQVLLPALKTLHDALAAKAEEFKDIIKIGRT  223



>ref|XP_009489604.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Pelecanus 
crispus]
Length=257

 Score =   273 bits (699),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 151/185 (82%), Gaps = 1/185 (1%)
 Frame = +1

Query  232  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  411
            FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN +
Sbjct  6    FRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQD  65

Query  412  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  591
            YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K 
Sbjct  66   YGLDPKIANAIVKAATEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGKL  125

Query  592  GEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDII  768
            G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  II
Sbjct  126  GSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQII  185

Query  769  KIGRT  783
            KIGRT
Sbjct  186  KIGRT  190



>gb|KFQ55579.1| hypothetical protein N334_00310, partial [Pelecanus crispus]
Length=259

 Score =   273 bits (699),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 151/185 (82%), Gaps = 1/185 (1%)
 Frame = +1

Query  232  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  411
            FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN +
Sbjct  7    FRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQD  66

Query  412  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  591
            YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K 
Sbjct  67   YGLDPKIANAIVKAATEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGKL  126

Query  592  GEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDII  768
            G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  II
Sbjct  127  GSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQII  186

Query  769  KIGRT  783
            KIGRT
Sbjct  187  KIGRT  191



>gb|EIE78369.1| fumarate hydratase [Rhizopus delemar RA 99-880]
Length=479

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 158/197 (80%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  6    RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  65

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  66   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  125

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G KA VHPNDHVN SQSSNDTFPT MH+AA +EI+ RL+P L  L  +
Sbjct  126  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIHGRLIPALTTLRDA  185

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF+ IIKIGRT
Sbjct  186  LQAKSAEFEHIIKIGRT  202



>pir||JC4293 fumarate hydratase (EC 4.2.1.2) precursor - Rhizopus oryzae
 gb|ADG65260.1| fumarase [Rhizopus oryzae]
Length=494

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 158/197 (80%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  80

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G KA VHPNDHVN SQSSNDTFPT MH+AA +EI+ RL+P L  L  +
Sbjct  141  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIHGRLIPALTTLRDA  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF+ IIKIGRT
Sbjct  201  LQAKSAEFEHIIKIGRT  217



>emb|CDH55360.1| fumarate hydratase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=492

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 156/197 (79%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTSF------REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FSTSF      R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG RERMPEP+I+AFG
Sbjct  20   RAFSTSFIAMQKFRSERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPRERMPEPLIQAFG  79

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA+VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQSNMN NEVI
Sbjct  80   VLKKAAAQVNMTYGLDPKVGEAIQKAADEVIDGTLLDHFPLVVWQTGSGTQSNMNVNEVI  139

Query  556  ANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA  EI  RL+P L  L  +
Sbjct  140  SNRAIELLGGELGSKNPVHPNDHVNMSQSSNDTFPTAMHVAAVTEITSRLIPALTTLRDA  199

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF  IIKIGRT
Sbjct  200  LKAKSDEFNHIIKIGRT  216



>emb|CDS07604.1| Putative Fumarase [Absidia idahoensis var. thermophila]
Length=492

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 156/197 (79%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTSF------REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FSTSF      R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG RERMPEP+I+AFG
Sbjct  20   RVFSTSFTAMQKFRSERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPRERMPEPLIQAFG  79

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA+VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQSNMN NEVI
Sbjct  80   VLKKAAAQVNMTYGLDPKVGEAIQKAADEVIDGTLLDHFPLVVWQTGSGTQSNMNVNEVI  139

Query  556  ANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA  EI  RL+P L  L  +
Sbjct  140  SNRAIELLGGELGSKNPVHPNDHVNMSQSSNDTFPTAMHVAAVTEITNRLIPALTTLRDA  199

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF  IIKIGRT
Sbjct  200  LKAKSDEFNHIIKIGRT  216



>ref|XP_001753417.1| predicted protein [Physcomitrella patens]
 gb|EDQ81640.1| predicted protein [Physcomitrella patens]
Length=470

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  226  TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVN  405
            T   EERDTFGPIQVP D+ WGAQTQRS+QNFEIG + ERMP+ ++ A GILKK AA VN
Sbjct  5    TKMAEERDTFGPIQVPDDRYWGAQTQRSVQNFEIGDESERMPKQLVEALGILKKAAAIVN  64

Query  406  MEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  585
            MEYGL+   G+A+++AA EVAEGKL DHFPLV+WQTGSGTQ+NMN+NEVIANRA EILG 
Sbjct  65   MEYGLDKKYGEAIVKAASEVAEGKLTDHFPLVVWQTGSGTQTNMNSNEVIANRAGEILGI  124

Query  586  KRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
              G K VHPNDHVN SQSSNDTFPT MHIAAA E + RL+P+L+ LH +L  K  EF DI
Sbjct  125  PIGSKGVHPNDHVNMSQSSNDTFPTAMHIAAAREASSRLIPHLRGLHEALIQKQNEFNDI  184

Query  766  IKIGRT  783
            +KIGRT
Sbjct  185  VKIGRT  190



>emb|CEP15950.1| hypothetical protein [Parasitella parasitica]
Length=494

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 156/197 (79%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+DK WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASIALQKFRAERDTFGDLQVPADKYWGAQTQRSLQNFDIGGKNERMPEPLIRAFG  80

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YG++P +G A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGMDPKVGDAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI  RL+P LK L  +
Sbjct  141  SNRAIELLGGELGSKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEITHRLIPALKTLRDA  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF+ IIKIGRT
Sbjct  201  LDAKSKEFEHIIKIGRT  217



>emb|CCA67859.1| probable FUM1-fumarate hydratase [Piriformospora indica DSM 11827]
Length=500

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 168/225 (75%), Gaps = 5/225 (2%)
 Frame = +1

Query  112  IRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWG  291
            +R +  ++ +A   V    T + +  + R T+     +  FR+ERDTFG +QVP+D+ WG
Sbjct  2    LRTSARSLQLARHHVAASRTVTRTFATTRITMS----NQKFRQERDTFGDLQVPADRYWG  57

Query  292  AQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAE  471
            AQTQRSL NF+IGG  ER+P P+I+AFG+LKK AA VNM YGL+P IG A+ QAA EV E
Sbjct  58   AQTQRSLMNFDIGGPSERLPPPLIKAFGVLKKAAAHVNMTYGLDPKIGNAISQAATEVIE  117

Query  472  GKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSND  648
            GKL DHFPLV++QTGSGTQSNMNANEVI+NRA EILG + G +K VHPNDHVN SQSSND
Sbjct  118  GKLTDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKKPVHPNDHVNMSQSSND  177

Query  649  TFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            TFPTVMHIAA  EI+  L+P LK LH +L  K+  F DIIKIGRT
Sbjct  178  TFPTVMHIAAVSEIHNDLIPALKTLHDALDEKAKAFADIIKIGRT  222



>ref|XP_005650930.1| fumarate hydratase [Coccomyxa subellipsoidea C-169]
 gb|EIE26386.1| fumarate hydratase [Coccomyxa subellipsoidea C-169]
Length=489

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 158/195 (81%), Gaps = 4/195 (2%)
 Frame = +1

Query  205  VCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILK  384
            V  R+F+T  R+E DTFGP+ VP+D+ WGAQTQRSLQNF+IGG  ERMPEP++ AFG+LK
Sbjct  20   VTVRFFAT--RQESDTFGPLDVPADRYWGAQTQRSLQNFKIGGRAERMPEPVVCAFGVLK  77

Query  385  KCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIAN  561
            + AAKVNME G L+   GKA+MQAA EVAEGKL +HFPLV+WQTGSGTQSNMNANEVIAN
Sbjct  78   RAAAKVNMESGYLDEKRGKAIMQAAGEVAEGKLLEHFPLVVWQTGSGTQSNMNANEVIAN  137

Query  562  RAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLH  738
            RA EILG + G+K+ VHPNDHVN+ QSSNDTFPTVMHIAA  EI  RLLP L  L+ +L 
Sbjct  138  RAVEILGGELGDKSVVHPNDHVNKGQSSNDTFPTVMHIAAIQEITGRLLPALTSLYEALE  197

Query  739  SKSVEFKDIIKIGRT  783
             K  EF  IIKIGRT
Sbjct  198  KKVQEFNHIIKIGRT  212



>ref|XP_008530562.1| PREDICTED: fumarate hydratase, mitochondrial [Equus przewalskii]
Length=233

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  35   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  94

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLN+HFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  95   DYGLDPKIANAIMKAADEVAEGKLNEHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  154

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  155  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  214

Query  766  IKIGRT  783
            IKIGRT
Sbjct  215  IKIGRT  220



>ref|XP_008635756.1| PREDICTED: fumarate hydratase, mitochondrial [Corvus brachyrhynchos]
Length=492

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 165/215 (77%), Gaps = 4/215 (2%)
 Frame = +1

Query  151  RVTCGSTRSISSESLRYTVCWRYFSTS---FREERDTFGPIQVPSDKLWGAQTQRSLQNF  321
            R+    TR +  + L  T+   ++++S   FR E DTFG ++VPSDK +GAQT RS  NF
Sbjct  2    RLHAVGTRGLQPQGLPVTMGQLWYTSSQEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNF  61

Query  322  EIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLV  501
            +IGG  ERMP  +IRAFGILK+ AA+VN +YGL+P I KA++QAA EVAEGKLNDHFPLV
Sbjct  62   KIGGVSERMPVQVIRAFGILKRAAAEVNQDYGLDPKIAKAIVQAANEVAEGKLNDHFPLV  121

Query  502  IWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAA  678
            +WQTGSGTQ+NMN NEVI+NRA EI+G   G +K VHPNDHVN+SQSSNDTFPT MHIAA
Sbjct  122  VWQTGSGTQTNMNVNEVISNRAIEIMGGTLGSKKPVHPNDHVNKSQSSNDTFPTAMHIAA  181

Query  679  AMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            A E+N+ LLP LK+L  +L  KS EF  IIKIGRT
Sbjct  182  AQEVNEVLLPGLKKLQNALEGKSKEFSQIIKIGRT  216



>ref|NP_001119412.1| fumarate hydratase 2 [Arabidopsis thaliana]
 gb|AED96016.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=423

 Score =   277 bits (708),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  346  MPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGT  525
            MPEPI+RAFG+LKKCAAKVNMEYGL+P IG+A+M+AAQEVAEGKLNDHFPLV+WQTGSGT
Sbjct  1    MPEPIVRAFGVLKKCAAKVNMEYGLDPMIGEAIMEAAQEVAEGKLNDHFPLVVWQTGSGT  60

Query  526  QSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLL  705
            QSNMNANEVIANRAAEILGHKRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA EI  RL+
Sbjct  61   QSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAATEITSRLI  120

Query  706  PNLKQLHTSLHSKSVEFKDIIKIGRT  783
            P+LK LH+SL SKS EFKDI+KIGRT
Sbjct  121  PSLKNLHSSLESKSFEFKDIVKIGRT  146



>ref|XP_011621870.1| PREDICTED: fumarate hydratase 1, mitochondrial [Amborella trichopoda]
Length=423

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  346  MPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGT  525
            MPEPIIRAFG+LKKC+AKVNMEYGL+PSIGKA+MQAAQEVA+G+LNDHFPLVIWQTGSGT
Sbjct  1    MPEPIIRAFGVLKKCSAKVNMEYGLDPSIGKAIMQAAQEVADGQLNDHFPLVIWQTGSGT  60

Query  526  QSNMNANEVIANRAAEILGHKRGEKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLL  705
            QSNMNANEVIANRAAEILG KRGEK VHPNDHVNRSQSSNDTFPTVMHIAAA+E N R +
Sbjct  61   QSNMNANEVIANRAAEILGKKRGEKFVHPNDHVNRSQSSNDTFPTVMHIAAAVETNSRFI  120

Query  706  PNLKQLHTSLHSKSVEFKDIIKIGRT  783
            P+LKQLH SL +K++EFKDIIKIGRT
Sbjct  121  PSLKQLHASLDAKTIEFKDIIKIGRT  146



>gb|ACY91850.1| fumarase [Rhizopus oryzae]
Length=479

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 157/197 (80%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  6    RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  65

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+ MN NEVI
Sbjct  66   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTKMNVNEVI  125

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G KA VHPNDHVN SQSSNDTFPT MH+AA +EI+ RL+P L  L  +
Sbjct  126  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIHGRLIPALTTLRDA  185

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF+ IIKIGRT
Sbjct  186  LQAKSAEFEHIIKIGRT  202



>ref|XP_008847403.1| PREDICTED: fumarate hydratase, mitochondrial [Nannospalax galili]
Length=508

 Score =   279 bits (713),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRVEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGPTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+N+ LLP L++LH +L +KS EF  +
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVNEVLLPGLQKLHDALSTKSKEFAQV  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>sp|P55250.1|FUMH_RHIOR RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Rhizopus oryzae]
 emb|CAA55314.1| fumarase [Rhizopus oryzae]
Length=494

 Score =   278 bits (712),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 157/197 (80%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMPEP+IRAFG
Sbjct  21   RLFSSASAALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGPTERMPEPLIRAFG  80

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YGL+P +G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+ MN NEVI
Sbjct  81   VLKKAAATVNMTYGLDPKVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTKMNVNEVI  140

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G KA VHPNDHVN SQSSNDTFPT MH+AA +EI+ RL+P L  L  +
Sbjct  141  SNRAIELLGGELGSKAPVHPNDHVNMSQSSNDTFPTAMHVAAVVEIHGRLIPALTTLRDA  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF+ IIKIGRT
Sbjct  201  LQAKSAEFEHIIKIGRT  217



>ref|XP_006998748.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Peromyscus 
maniculatus bairdii]
Length=366

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALSAKSKEFMQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|XP_003974177.1| PREDICTED: fumarate hydratase, mitochondrial [Takifugu rubripes]
Length=499

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = +1

Query  136  LIAARRVTCG--STRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRS  309
            L A R++ C   +   ++  S R     R  S+ +R ERDTFG ++VP+DK +GAQT RS
Sbjct  5    LKAVRQLNCNRLTLEKLAVNSRRLICTSRMASSEYRLERDTFGELKVPADKYYGAQTVRS  64

Query  310  LQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDH  489
              NF+IGG  ERMP  +I+AFGILK+ AA+VN +YGL+P I  A++QAA EV+ GKL+DH
Sbjct  65   TMNFKIGGPSERMPIQVIKAFGILKRAAAEVNKDYGLDPKIAGAIIQAADEVSAGKLDDH  124

Query  490  FPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVM  666
            FPLV+WQTGSGTQSNMN NEVI+NRA EILG   G K  VHPNDHVN+SQSSNDTFPT M
Sbjct  125  FPLVVWQTGSGTQSNMNVNEVISNRAIEILGGTLGSKDPVHPNDHVNKSQSSNDTFPTAM  184

Query  667  HIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            HIAAA E+++ LLP L+ LH +L +KS EFKDIIKIGRT
Sbjct  185  HIAAATEVHQVLLPGLQTLHDALAAKSEEFKDIIKIGRT  223



>gb|KFH63115.1| fumarate hydratase, mitochondrial [Mortierella verticillata NRRL 
6337]
Length=497

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 161/196 (82%), Gaps = 1/196 (1%)
 Frame = +1

Query  199  YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  378
            ++     ++  FR+E DTFG ++VP+D+ WGAQTQRSLQNF+IGG  ERMPEP+I+AFG+
Sbjct  22   FSAAPSVWAQKFRQEADTFGNLEVPADRYWGAQTQRSLQNFDIGGATERMPEPLIKAFGV  81

Query  379  LKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIA  558
            LK+ AA VNM YGL+ ++G A+++A+ EV EGKL DHFPLV+WQTGSGTQ+NMN NEVI+
Sbjct  82   LKRAAATVNMTYGLDQTVGDAIVKASNEVIEGKLLDHFPLVVWQTGSGTQTNMNVNEVIS  141

Query  559  NRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSL  735
            NRA E+LG + G +K VHPNDHVN SQSSNDTFPT MH+AAA+EIN+RL+P +  L  ++
Sbjct  142  NRAIELLGGELGSKKPVHPNDHVNMSQSSNDTFPTAMHVAAAIEINQRLIPAVTLLRDAI  201

Query  736  HSKSVEFKDIIKIGRT  783
             +KS EFKDIIKIGRT
Sbjct  202  QAKSEEFKDIIKIGRT  217



>ref|XP_004555021.1| PREDICTED: fumarate hydratase, mitochondrial-like [Maylandia 
zebra]
 ref|XP_005734132.1| PREDICTED: fumarate hydratase, mitochondrial-like [Pundamilia 
nyererei]
 ref|XP_005920862.1| PREDICTED: fumarate hydratase, mitochondrial-like [Haplochromis 
burtoni]
Length=499

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  ISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEP  357
            +S+ S  +    R  S+ +R ERDTFG ++VP+DK +GAQT RS  NF+IGG  ERMP  
Sbjct  21   LSATSKLHICTSRMASSDYRIERDTFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQ  80

Query  358  IIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNM  537
            +I+AFG+LKK AA+VN EYGL+P I +A++QAA EV+ GKL+DHFPLV+WQTGSGTQ+NM
Sbjct  81   VIKAFGVLKKAAAQVNKEYGLDPKIAEAIVQAADEVSAGKLDDHFPLVVWQTGSGTQTNM  140

Query  538  NANEVIANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNL  714
            N NEVI+NRA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIA A E+++ LLP L
Sbjct  141  NVNEVISNRAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAVATEVHQVLLPGL  200

Query  715  KQLHTSLHSKSVEFKDIIKIGRT  783
            + LH +L SK+ EFKDIIKIGRT
Sbjct  201  QTLHDALASKAEEFKDIIKIGRT  223



>ref|XP_004450319.1| PREDICTED: fumarate hydratase, mitochondrial isoform 1 [Dasypus 
novemcinctus]
Length=508

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGAAERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVHEVLLPGLQKLHDALDAKSKEFAHI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>ref|XP_009087608.1| PREDICTED: fumarate hydratase, mitochondrial [Serinus canaria]
Length=485

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 163/217 (75%), Gaps = 13/217 (6%)
 Frame = +1

Query  136  LIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQ  315
            L A RR+ C +   +SS+             +FR E DTFG ++VPSDK +GAQT RS  
Sbjct  5    LRACRRLGCSAGLLLSSQE------------AFRIEYDTFGELKVPSDKYYGAQTVRSTM  52

Query  316  NFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFP  495
            NF+IGG  ERMP  +IRAFGILK+ AA+VN +YGL+P I KA++QAA EVAEGKLNDHFP
Sbjct  53   NFKIGGVSERMPVQVIRAFGILKRAAAEVNQDYGLDPKIAKAIVQAANEVAEGKLNDHFP  112

Query  496  LVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHI  672
            LV+WQTGSGTQ+NMN NEVI+NRA EI+G   G +K VHPNDHVN+SQSSNDTFPT MHI
Sbjct  113  LVVWQTGSGTQTNMNVNEVISNRAIEIMGGTLGSKKPVHPNDHVNKSQSSNDTFPTAMHI  172

Query  673  AAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            AAA E+N+ LLP LK+L  +L  KS EF  IIKIGRT
Sbjct  173  AAAQEVNEVLLPGLKKLQNALEGKSKEFSQIIKIGRT  209



>gb|ESA01861.1| hypothetical protein GLOINDRAFT_337726 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX65785.1| fumarase FUM1 [Rhizophagus irregularis DAOM 197198w]
Length=467

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +1

Query  232  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  411
            +R ERDTFG I+VP+D+ WGAQTQRSL+NF+IGG  ERMPEP+I+AFGI+K+ AA VN  
Sbjct  7    YRIERDTFGDIEVPADRYWGAQTQRSLKNFDIGGPTERMPEPLIKAFGIIKRAAATVNAT  66

Query  412  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  591
            YGL+  IG+A+++AA EV++G L DHFPLV+WQTGSGTQ+NMNANEVIANRA EILG + 
Sbjct  67   YGLDQKIGEAIVKAANEVSKGDLLDHFPLVVWQTGSGTQTNMNANEVIANRAIEILGGQL  126

Query  592  GEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDII  768
            G K+ VHPNDHVN SQSSNDTFPT MH++AA+EIN+RLLP L QL  ++  KS EF +II
Sbjct  127  GSKSPVHPNDHVNMSQSSNDTFPTAMHVSAAIEINERLLPGLTQLRDAIAEKSKEFANII  186

Query  769  KIGRT  783
            KIGRT
Sbjct  187  KIGRT  191



>ref|XP_003037573.1| hypothetical protein SCHCODRAFT_81011 [Schizophyllum commune 
H4-8]
 gb|EFJ02671.1| hypothetical protein SCHCODRAFT_81011 [Schizophyllum commune 
H4-8]
Length=498

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 169/228 (74%), Gaps = 17/228 (7%)
 Frame = +1

Query  127  MAMLIAARRVTCGST--RSISSESLRYTVCWRYFSTSF------REERDTFGPIQVPSDK  282
            M+ L  +RR+ C +   R++ S+        R FST+F      R ERDTFG +QVPSD+
Sbjct  1    MSTLHLSRRILCRAPIRRAVPSQ--------RLFSTTFMAAQQHRIERDTFGELQVPSDR  52

Query  283  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  462
             WGAQTQRSLQNF+IGG  ER+P P+I+AFG+LKK AA VNM YG++P +GKA+ QAA +
Sbjct  53   YWGAQTQRSLQNFDIGGPTERLPPPLIKAFGVLKKAAATVNMTYGMDPKLGKAIQQAADD  112

Query  463  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQS  639
            V  GKL DHFPLV++QTGSGTQSNMNANEVI+NRA EILG + G +K VHPNDHVN SQS
Sbjct  113  VISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGELGSKKPVHPNDHVNMSQS  172

Query  640  SNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            SNDTFPTVMHIAA  EI   LLP L +L  +L  K+  F+ IIKIGRT
Sbjct  173  SNDTFPTVMHIAAVTEITNNLLPALTELRDALDQKANAFEKIIKIGRT  220



>ref|XP_003439886.2| PREDICTED: fumarate hydratase, mitochondrial-like [Oreochromis 
niloticus]
Length=499

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = +1

Query  184  SESLRYTVCW-RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI  360
            S + ++ +C  R  S+ +R ERDTFG ++VP+DK +GAQT RS  NF+IGG  ERMP  +
Sbjct  22   SATSKFHICTSRMASSDYRIERDTFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQV  81

Query  361  IRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMN  540
            I+AFG+LKK AA+VN EYGL+P I +A++QAA EV+ GKL+DHFPLV+WQTGSGTQ+NMN
Sbjct  82   IKAFGVLKKAAAQVNKEYGLDPKIAEAIVQAADEVSAGKLDDHFPLVVWQTGSGTQTNMN  141

Query  541  ANEVIANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLK  717
             NEVI+NRA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIA A E+++ LLP L+
Sbjct  142  VNEVISNRAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAVATEVHQVLLPGLQ  201

Query  718  QLHTSLHSKSVEFKDIIKIGRT  783
             LH +L +K+ EFKDIIKIGRT
Sbjct  202  TLHDALAAKAEEFKDIIKIGRT  223



>emb|CDH51516.1| fumarate hydratase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=466

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = +1

Query  235  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  414
            R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMP P+I+AFGILKK AA VNM Y
Sbjct  7    RVERDTFGELQVPADRYWGAQTQRSLQNFDIGGPGERMPAPLIQAFGILKKAAATVNMTY  66

Query  415  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  594
            GL+P IG+A+ +AA EV  GKL DHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG + G
Sbjct  67   GLDPKIGEAIQKAADEVINGKLMDHFPLVVWQTGSGTQTNMNVNEVISNRAIELLGGELG  126

Query  595  EK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIK  771
             K  VHPNDHVN SQSSNDTFPT MHIAAAMEI+ RLLP L  L  +L +KS EF  IIK
Sbjct  127  SKNPVHPNDHVNMSQSSNDTFPTAMHIAAAMEISNRLLPALTSLRFALQAKSEEFSHIIK  186

Query  772  IGRT  783
            IGRT
Sbjct  187  IGRT  190



>ref|XP_011272281.1| fumarate hydratase [Wickerhamomyces ciferrii]
 emb|CCH45889.1| fumarate hydratase [Wickerhamomyces ciferrii]
Length=486

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 167/218 (77%), Gaps = 11/218 (5%)
 Frame = +1

Query  136  LIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQ  315
            +++AR +   S RSI + +++ +         FR E D FG +QVP+DK WGAQTQRSLQ
Sbjct  1    MLSARLLNT-SKRSIHTSTIKMS--------QFRTESDAFGELQVPNDKYWGAQTQRSLQ  51

Query  316  NFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYG-LEPSIGKAVMQAAQEVAEGKLNDHF  492
            NF+IGG+RE++PEP+I+AFG+LKK  A VN ++G L+P + +A+ QAA EVA GKL DHF
Sbjct  52   NFKIGGEREKLPEPLIKAFGVLKKSTAIVNEKFGTLKPELAQAIQQAADEVASGKLKDHF  111

Query  493  PLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMH  669
            PLV++QTGSGTQSNMNANEVI+NRA EILG K G K  VHPNDHVN+SQSSNDTFPTVMH
Sbjct  112  PLVVFQTGSGTQSNMNANEVISNRAIEILGGKLGSKTPVHPNDHVNQSQSSNDTFPTVMH  171

Query  670  IAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            IAA  EI   LLP L+ L  +L SKS EF DIIKIGRT
Sbjct  172  IAAVQEITNHLLPELQLLQKALQSKSDEFNDIIKIGRT  209



>ref|XP_004578565.1| PREDICTED: fumarate hydratase, mitochondrial [Ochotona princeps]
Length=508

 Score =   277 bits (708),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 167/218 (77%), Gaps = 5/218 (2%)
 Frame = +1

Query  145  ARRVTCGSTRSISSESL---RYTVCWRYFS-TSFREERDTFGPIQVPSDKLWGAQTQRSL  312
             R  TC S   +S  ++   R     R  S  SFR E DTFG ++VP+DK +GAQT RS 
Sbjct  15   GRAPTCASAPGVSGLAVLPTRLPHAARMASQNSFRTEYDTFGELKVPNDKYYGAQTVRST  74

Query  313  QNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHF  492
             NF+IGG  ERMP P+I+AFGILK+ AA+VN +YGL+P I  A+M+AA EVAEGKLNDHF
Sbjct  75   MNFKIGGVTERMPIPVIKAFGILKRAAAEVNQDYGLDPKIADAIMKAANEVAEGKLNDHF  134

Query  493  PLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMH  669
            PLVIWQTGSGTQ+NMN NEVI+NRA E+LG + G +K VHPNDHVN+SQSSNDTFPT MH
Sbjct  135  PLVIWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDTFPTAMH  194

Query  670  IAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            IAAA+E+++ LLP L++LH +L +KS EF  IIKIGRT
Sbjct  195  IAAAVEVHEVLLPGLQKLHDALEAKSKEFAQIIKIGRT  232



>ref|XP_008295685.1| PREDICTED: fumarate hydratase, mitochondrial [Stegastes partitus]
Length=499

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 158/198 (80%), Gaps = 2/198 (1%)
 Frame = +1

Query  196  RYTVCWRYFSTS-FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAF  372
            +  +C    + S FR ERDTFG ++VP+D+ +GAQT RS  NF+IGG  ERMP P+I+AF
Sbjct  26   KLLICTSAMAASEFRIERDTFGELKVPADRYYGAQTVRSTMNFKIGGPTERMPLPVIKAF  85

Query  373  GILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEV  552
            GILK+ AA+VN +YGL P I  A++QAA EVA GKL+DHFPLV+WQTGSGTQ+NMN NEV
Sbjct  86   GILKRAAAEVNKDYGLNPKIADAIVQAADEVAAGKLDDHFPLVVWQTGSGTQTNMNVNEV  145

Query  553  IANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHT  729
            I+NRA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L+ LH 
Sbjct  146  ISNRAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHQVLLPGLQTLHD  205

Query  730  SLHSKSVEFKDIIKIGRT  783
            +L +K+ EFKDIIKIGRT
Sbjct  206  ALAAKAEEFKDIIKIGRT  223



>ref|XP_004895657.1| PREDICTED: fumarate hydratase, mitochondrial isoform X5 [Heterocephalus 
glaber]
 ref|XP_004853527.1| PREDICTED: fumarate hydratase, mitochondrial isoform X4 [Heterocephalus 
glaber]
Length=428

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS+ NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSMMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGCE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALSAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>dbj|GAN02812.1| fumarate hydratase [Mucor ambiguus]
Length=494

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 157/197 (80%), Gaps = 7/197 (4%)
 Frame = +1

Query  214  RYFSTS------FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFG  375
            R FS++      FR ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG+ ERMPEP+IRAFG
Sbjct  21   RLFSSASIALQKFRAERDTFGDLQVPADRYWGAQTQRSLQNFDIGGEHERMPEPLIRAFG  80

Query  376  ILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVI  555
            +LKK AA VNM YG++ ++G+A+ +AA EV +G L DHFPLV+WQTGSGTQ+NMN NEVI
Sbjct  81   VLKKAAATVNMTYGMDTTVGEAIQKAADEVIDGSLIDHFPLVVWQTGSGTQTNMNVNEVI  140

Query  556  ANRAAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTS  732
            +NRA E+LG + G K  VHPNDHVN SQSSNDTFPT MH+AA +EI  RL+P L  L  +
Sbjct  141  SNRAIELLGGELGSKTPVHPNDHVNMSQSSNDTFPTAMHVAAVVEITHRLIPALNTLRDA  200

Query  733  LHSKSVEFKDIIKIGRT  783
            L +KS EF+ IIKIGRT
Sbjct  201  LDAKSKEFEHIIKIGRT  217



>ref|XP_001900957.1| fumarase [Brugia malayi]
Length=504

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 169/223 (76%), Gaps = 6/223 (3%)
 Frame = +1

Query  133  MLIAARRVTC--GSTRSISSESLR---YTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQ  297
            +L+   R+ C  G TR  S+ ++     T+  R  ST+ R+ERDTFG +QVP+D+ +GAQ
Sbjct  6    ILVGGDRLNCIYGVTRISSALAVARAVNTMVKRNMSTAIRKERDTFGELQVPADRYYGAQ  65

Query  298  TQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGK  477
            T RS+ NF+IGG  ERMP P+I AFGILKK AA VN EYGL+  I  A+ +AA EV  GK
Sbjct  66   TARSMINFKIGGPEERMPLPVIHAFGILKKAAALVNKEYGLDQKIVDAIAKAADEVIAGK  125

Query  478  LNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTF  654
            L+DHFPLV+WQTGSGTQSNMN NEVI+NRA E+LG + G +K VHPNDHVN SQSSNDT+
Sbjct  126  LDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNMSQSSNDTY  185

Query  655  PTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            PT MHIA A EIN RLLP+L+QL  SLH KS EF++IIKIGRT
Sbjct  186  PTAMHIAVAREINSRLLPSLQQLLDSLHRKSKEFENIIKIGRT  228



>ref|XP_006958376.1| fumarate hydratase [Wallemia sebi CBS 633.66]
 gb|EIM21689.1| fumarate hydratase [Wallemia sebi CBS 633.66]
Length=470

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 1/187 (1%)
 Frame = +1

Query  226  TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVN  405
            + FREE+DTFGP++VP D+ WGAQTQRSLQNFEIGG++ RMP P+ RAFG+LKK AA VN
Sbjct  7    SEFREEKDTFGPLRVPLDRYWGAQTQRSLQNFEIGGEQARMPVPLTRAFGVLKKAAAAVN  66

Query  406  MEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  585
            M YGL+  IGKA+M+AA EVA GKL+ HFPLV++QTGSGTQ+NMN+NEVI+NRA EILG 
Sbjct  67   MTYGLDERIGKAIMEAADEVATGKLDSHFPLVVFQTGSGTQTNMNSNEVISNRAIEILGG  126

Query  586  KRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKD  762
            K G K  VHPNDHVN SQSSNDTFPT MH+AA +E+N  LLPNL  L  +L  K+  + +
Sbjct  127  KLGSKDPVHPNDHVNMSQSSNDTFPTAMHVAAVLELNNSLLPNLTTLRNALADKAESWSN  186

Query  763  IIKIGRT  783
            IIKIGRT
Sbjct  187  IIKIGRT  193



>ref|XP_006102845.1| PREDICTED: fumarate hydratase, mitochondrial [Myotis lucifugus]
Length=510

 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = +1

Query  181  SSESLRYTVCWRYFS-TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEP  357
            +S   R  V  R  S  SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P
Sbjct  32   ASLPFRPPVAARMASQNSFRVEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIP  91

Query  358  IIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNM  537
            +I+AFGILK+ AA+VN +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NM
Sbjct  92   VIKAFGILKRAAAEVNQDYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNM  151

Query  538  NANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNL  714
            N NEVI+NRA E+LG + G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+++ LLP L
Sbjct  152  NVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVHEVLLPGL  211

Query  715  KQLHTSLHSKSVEFKDIIKIGRT  783
            ++LH +L +KS +F  IIKIGRT
Sbjct  212  QKLHDALEAKSKDFAQIIKIGRT  234



>gb|AAH06048.1| Fumarate hydratase 1 [Mus musculus]
Length=507

 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRVEFDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E++K LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHKVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|XP_006800490.1| PREDICTED: fumarate hydratase, mitochondrial-like [Neolamprologus 
brichardi]
Length=499

 Score =   276 bits (706),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 161/202 (80%), Gaps = 2/202 (1%)
 Frame = +1

Query  184  SESLRYTVCW-RYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPI  360
            S + +  +C  R  S+ +R ERDTFG ++VP+DK +GAQT RS  NF+IGG  ERMP  +
Sbjct  22   SATSKLRICTSRMASSDYRIERDTFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQV  81

Query  361  IRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMN  540
            I+AFG+LKK AA+VN EYGL+P I +A++QAA EV+ GKL+DHFPLV+WQTGSGTQ+NMN
Sbjct  82   IKAFGVLKKAAAQVNKEYGLDPKIAEAIVQAADEVSAGKLDDHFPLVVWQTGSGTQTNMN  141

Query  541  ANEVIANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLK  717
             NEVI+NRA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIA A E+++ LLP L+
Sbjct  142  VNEVISNRAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAVATEVHQVLLPGLQ  201

Query  718  QLHTSLHSKSVEFKDIIKIGRT  783
             LH +L SK+ EFKDIIKIGRT
Sbjct  202  TLHDALASKAEEFKDIIKIGRT  223



>ref|NP_034339.2| fumarate hydratase, mitochondrial precursor [Mus musculus]
 sp|P97807.3|FUMH_MOUSE RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
AltName: Full=EF-3; Flags: Precursor [Mus musculus]
 dbj|BAE27597.1| unnamed protein product [Mus musculus]
 gb|EDL13210.1| fumarate hydratase 1 [Mus musculus]
Length=507

 Score =   276 bits (707),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRVEFDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E++K LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHKVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>gb|AAA52483.1| fumarase precursor (EC 4.2.1.2) [Homo sapiens]
Length=468

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  6    SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  66   DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  125

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  126  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>ref|XP_004711822.1| PREDICTED: fumarate hydratase, mitochondrial-like [Echinops telfairi]
Length=503

 Score =   276 bits (706),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILKK AA VN 
Sbjct  42   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPVPVIKAFGILKKAAADVNQ  101

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P +  A+M+AA EVAEGKLNDHFPLVIWQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  102  EYGLDPKVASAIMKAADEVAEGKLNDHFPLVIWQTGSGTQTNMNVNEVISNRAIEMLGGE  161

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L++LH +L++KS EF  I
Sbjct  162  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHEVLLPGLQKLHDALNAKSKEFAQI  221

Query  766  IKIGRT  783
            IKIGRT
Sbjct  222  IKIGRT  227



>ref|XP_010164262.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Caprimulgus 
carolinensis]
Length=305

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 154/194 (79%), Gaps = 1/194 (1%)
 Frame = +1

Query  205  VCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILK  384
            V  +    +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK
Sbjct  100  VSQKSTQEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILK  159

Query  385  KCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANR  564
            + AA+VN +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NR
Sbjct  160  RAAAEVNQDYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNR  219

Query  565  AAEILGHKRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHS  741
            A EI+G K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +
Sbjct  220  AIEIMGGKLGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEA  279

Query  742  KSVEFKDIIKIGRT  783
            KS EF  IIKIGRT
Sbjct  280  KSKEFSQIIKIGRT  293



>ref|XP_005884158.1| PREDICTED: fumarate hydratase, mitochondrial [Myotis brandtii]
Length=473

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  12   SFRVEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  71

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  72   DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  131

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAAME+++ LLP L++LH +L +KS +F  I
Sbjct  132  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAMEVHEVLLPGLQKLHDALEAKSKDFAQI  191

Query  766  IKIGRT  783
            IKIGRT
Sbjct  192  IKIGRT  197



>sp|P14408.1|FUMH_RAT RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Rattus norvegicus]
 gb|AAA41177.1| fumarase precursor (EC 4.2.1.2) [Rattus norvegicus]
Length=507

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHQVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|XP_005969001.1| PREDICTED: fumarate hydratase, mitochondrial [Pantholops hodgsonii]
Length=510

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFDQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_009278489.1| PREDICTED: fumarate hydratase, mitochondrial [Aptenodytes forsteri]
Length=489

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 160/212 (75%), Gaps = 2/212 (1%)
 Frame = +1

Query  151  RVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIG  330
            R+ C S  S     LRYT        +FR E DTFG ++VPSDK +GAQT RS  NF+IG
Sbjct  3    RLLCRSALSERDWCLRYTTAGST-QEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIG  61

Query  331  GDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQ  510
            G  ERMP  +IRAFGILK+ AA+VN +YGL+P I  A+++AA EV EGKLNDHFPLV+WQ
Sbjct  62   GVSERMPVQVIRAFGILKRAAAEVNQDYGLDPKIANAIIKAANEVTEGKLNDHFPLVVWQ  121

Query  511  TGSGTQSNMNANEVIANRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAME  687
            TGSGTQ+NMN NEVI+NRA EI+G K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E
Sbjct  122  TGSGTQTNMNVNEVISNRAIEIMGGKLGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQE  181

Query  688  INKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            +N+ LLP LK+L  +L +KS EF  IIKIGRT
Sbjct  182  VNEVLLPGLKKLQNALEAKSKEFSQIIKIGRT  213



>ref|XP_011396762.1| Fumarate hydratase 2, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23884.1| Fumarate hydratase 2, chloroplastic [Auxenochlorella protothecoides]
Length=465

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            S R ERDTFGP++VPSD+ WGAQTQRS+QNF+IGG  ERMPEP++RAFG+LK+ AA+VNM
Sbjct  2    STRTERDTFGPLEVPSDRYWGAQTQRSIQNFKIGGPAERMPEPVVRAFGVLKRAAARVNM  61

Query  409  EYG-LEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGH  585
            + G L+   G+A++ AA EVAEG+L DHFPLV+WQTGSGTQSNMNANEVIANRA EILG 
Sbjct  62   QMGVLDRRQGEAIVSAAGEVAEGRLTDHFPLVVWQTGSGTQSNMNANEVIANRAIEILGG  121

Query  586  KRGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKD  762
            + G+K+ VHPNDHVN+ QSSNDTFPTVMHIA   EI +RLLP L  L ++L +K  EF  
Sbjct  122  ELGDKSLVHPNDHVNKGQSSNDTFPTVMHIAGVTEIERRLLPALAHLQSALEAKQAEFAH  181

Query  763  IIKIGRT  783
            I+KIGRT
Sbjct  182  IVKIGRT  188



>ref|NP_001069271.1| fumarate hydratase, mitochondrial [Bos taurus]
 gb|AAI18451.1| Fumarate hydratase [Bos taurus]
 tpg|DAA21383.1| TPA: fumarate hydratase, mitochondrial [Bos taurus]
Length=510

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFDQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_010774773.1| PREDICTED: fumarate hydratase, mitochondrial [Notothenia coriiceps]
Length=499

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 172/241 (71%), Gaps = 21/241 (9%)
 Frame = +1

Query  67   WRQRRLLSAFGCGSSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCW-RYFSTSFREE  243
            +R  R +  F C           L+A +RV   S         +  +C  R  ++ +R E
Sbjct  2    FRSLRRVQQFNCN----------LLALKRVRVNS---------KLLICTSRMAASEYRIE  42

Query  244  RDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLE  423
            RD+FG ++VP+DK +GAQT RS  NF+IGG  ERMP  +I+AFGILK+ AA+VN E+GL+
Sbjct  43   RDSFGELKVPADKYYGAQTVRSTMNFKIGGPSERMPIQVIKAFGILKRAAAEVNKEFGLD  102

Query  424  PSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-  600
            P I  A++QAA EV+ GKL+DHFPLV+WQTGSGTQSNMN NEVI+NRA EILG K G K 
Sbjct  103  PKIADAIIQAADEVSAGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEILGGKLGSKD  162

Query  601  AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGR  780
             VHPNDHVN+SQSSNDTFPT MHIAAA E++  LLP L+ LH +L +K+VEFKDIIKIGR
Sbjct  163  PVHPNDHVNKSQSSNDTFPTAMHIAAATEVHHVLLPGLQALHDALAAKAVEFKDIIKIGR  222

Query  781  T  783
            T
Sbjct  223  T  223



>prf||1709138A fumarase
Length=507

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHQVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|NP_058701.2| fumarate hydratase, mitochondrial precursor [Rattus norvegicus]
 gb|AAH87598.1| Fumarate hydratase 1 [Rattus norvegicus]
 gb|EDL94769.1| fumarate hydratase 1 [Rattus norvegicus]
Length=507

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            EYGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  EYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHQVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|XP_005897261.1| PREDICTED: fumarate hydratase, mitochondrial [Bos mutus]
 gb|ELR55340.1| Fumarate hydratase, mitochondrial [Bos mutus]
Length=510

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFDQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_004330338.1| PREDICTED: fumarate hydratase, mitochondrial-like [Tursiops truncatus]
Length=419

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFG+LK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGVLKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>gb|EYB92700.1| hypothetical protein Y032_0191g1324 [Ancylostoma ceylanicum]
Length=280

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = +1

Query  235  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  414
            R+ERDTFG ++VP+D+ +GAQT RS  NF+IGG  ERMP P++ AFGILKK AA VN E+
Sbjct  36   RKERDTFGELEVPADRYYGAQTARSQMNFKIGGPEERMPIPVVHAFGILKKAAAMVNTEF  95

Query  415  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  594
            GL+  +  A+ +AA EV  GKL+DHFPLV WQTGSGTQSNMN NEVI+NRA EILG + G
Sbjct  96   GLDKKLADAICKAADEVIAGKLDDHFPLVTWQTGSGTQSNMNVNEVISNRAIEILGGELG  155

Query  595  -EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIK  771
             +K VHPNDHVN SQSSNDTFPT MHIA A E+N RLLP LKQLH SL  KS EFKDIIK
Sbjct  156  SKKPVHPNDHVNMSQSSNDTFPTAMHIAVAREVNARLLPALKQLHDSLQKKSNEFKDIIK  215

Query  772  IGRT  783
            IGRT
Sbjct  216  IGRT  219



>pdb|3E04|A Chain A, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|B Chain B, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|C Chain C, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|D Chain D, Crystal Structure Of Human Fumarate Hydratase
Length=490

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  29   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  88

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  89   DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  148

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  149  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  208

Query  766  IKIGRT  783
            IKIGRT
Sbjct  209  IKIGRT  214



>ref|XP_006050829.1| PREDICTED: fumarate hydratase, mitochondrial [Bubalus bubalis]
 ref|XP_010834988.1| PREDICTED: fumarate hydratase, mitochondrial [Bison bison bison]
Length=510

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFDQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|NP_001155363.1| fumarate hydratase, mitochondrial [Ovis aries]
 gb|ACR55776.1| fumarate hydratase [Ovis aries]
Length=510

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFDQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_002717380.1| PREDICTED: fumarate hydratase, mitochondrial [Oryctolagus cuniculus]
 ref|XP_002722110.1| PREDICTED: fumarate hydratase, mitochondrial [Oryctolagus cuniculus]
Length=508

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRTEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLVIWQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVIWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>gb|AAY59704.1| fumarate hydratase [Cricetulus griseus]
Length=467

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  6    SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGPTERMPIPVIKAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  66   DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALSAKSKEFAQV  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>ref|XP_007240663.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Astyanax 
mexicanus]
Length=263

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 156/195 (80%), Gaps = 3/195 (2%)
 Frame = +1

Query  208  CWRYF--STSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGIL  381
            C R    S S+R ERDTFG ++VPSDK +GAQT RS  NF IGG  ERMP  +I+AFGIL
Sbjct  41   CARSMAGSESYRIERDTFGELKVPSDKYYGAQTVRSTMNFRIGGATERMPIQVIKAFGIL  100

Query  382  KKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIAN  561
            K+ AA+VN +YGL+P I +A+++AA EV  GKL+DHFPLV+WQTGSGTQ+NMN NEVI+N
Sbjct  101  KRAAAEVNQDYGLDPKIAEAIVKAADEVTAGKLDDHFPLVVWQTGSGTQTNMNVNEVISN  160

Query  562  RAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLH  738
            RA EILG K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L++LH +L 
Sbjct  161  RAIEILGGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAAAKEVHEVLLPGLQELHNALA  220

Query  739  SKSVEFKDIIKIGRT  783
            +KS EFK IIKIGRT
Sbjct  221  AKSEEFKHIIKIGRT  235



>ref|XP_004895654.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Heterocephalus 
glaber]
 ref|XP_004853525.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Heterocephalus 
glaber]
Length=473

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS+ NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  12   SFRIEYDTFGELKVPNDKYYGAQTVRSMMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  71

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  72   DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGCE  131

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  132  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALSAKSKEFAQI  191

Query  766  IKIGRT  783
            IKIGRT
Sbjct  192  IKIGRT  197



>ref|XP_010392198.1| PREDICTED: fumarate hydratase, mitochondrial [Corvus cornix cornix]
Length=467

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>ref|XP_006993784.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Peromyscus 
maniculatus bairdii]
Length=466

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  5    SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  65   DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  124

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  125  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALSAKSKEFMQV  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_005041811.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X2 
[Ficedula albicollis]
Length=467

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>gb|KFO62089.1| hypothetical protein N302_14449, partial [Corvus brachyrhynchos]
Length=467

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>gb|KIO08161.1| hypothetical protein M404DRAFT_14265 [Pisolithus tinctorius Marx 
270]
Length=492

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 162/211 (77%), Gaps = 6/211 (3%)
 Frame = +1

Query  169  TRSISSESLRYTVCWRYFSTS-----FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGG  333
            T S+    L +    R FS S     FR+ERDTFG IQVP+D+ WGAQTQRSLQNF+IGG
Sbjct  4    TTSLRLPRLLHVARQRRFSVSHSVMAFRQERDTFGDIQVPADRYWGAQTQRSLQNFDIGG  63

Query  334  DRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQT  513
              ER+P P+I+AFG+LKK A+ VN+ YGL+P IG+A+ +AA EV  GKL DHFPLV++QT
Sbjct  64   PAERLPAPLIKAFGVLKKAASIVNVSYGLDPKIGEAIQKAADEVISGKLIDHFPLVVFQT  123

Query  514  GSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEI  690
            GSGTQSNMNANEVI+NRA E+LG + G +K VHPNDHVN SQSSND+FPT MH+AA  EI
Sbjct  124  GSGTQSNMNANEVISNRAIELLGGELGSKKPVHPNDHVNMSQSSNDSFPTAMHVAAVTEI  183

Query  691  NKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            +  LLP L +L  +L SK  EFKDIIKIGRT
Sbjct  184  HSSLLPALVELRDALQSKVDEFKDIIKIGRT  214



>gb|KFW87389.1| hypothetical protein N305_02194, partial [Manacus vitellinus]
Length=467

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  66   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>gb|KFP81385.1| hypothetical protein N311_05316, partial [Apaloderma vittatum]
Length=439

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  IIRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQIIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G +
Sbjct  66   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGQ  125

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  126  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>ref|XP_005078228.1| PREDICTED: fumarate hydratase, mitochondrial [Mesocricetus auratus]
Length=507

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF ++
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALSAKSKEFAEV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|XP_005041810.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X1 
[Ficedula albicollis]
Length=477

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  16   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  75

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  76   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  135

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  136  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  195

Query  766  IKIGRT  783
            IKIGRT
Sbjct  196  IKIGRT  201



>gb|KFW11876.1| hypothetical protein N326_13222, partial [Eurypyga helias]
Length=466

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF +I
Sbjct  125  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSEI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>emb|CDS05044.1| Putative Fumarate hydratase, mitochondrial [Absidia idahoensis 
var. thermophila]
Length=466

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = +1

Query  235  REERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEY  414
            R ERDTFG +QVP+D+ WGAQTQRSLQNF+IGG  ERMP P+I+AFGILKK AA VNM Y
Sbjct  7    RVERDTFGELQVPTDRYWGAQTQRSLQNFDIGGAGERMPAPLIQAFGILKKAAATVNMTY  66

Query  415  GLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG  594
            GL+P IG+A+ +AA EV  GKL DHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG + G
Sbjct  67   GLDPKIGEAIQKAADEVISGKLLDHFPLVVWQTGSGTQTNMNVNEVISNRAIELLGGELG  126

Query  595  EK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIK  771
             K  VHPNDHVN SQSSNDTFPT MHIAA MEI+ RLLP L  L  +L +KS EF  IIK
Sbjct  127  SKNPVHPNDHVNMSQSSNDTFPTAMHIAAVMEISNRLLPALTSLRFALQAKSEEFSHIIK  186

Query  772  IGRT  783
            IGRT
Sbjct  187  IGRT  190



>ref|XP_010202049.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Colius 
striatus]
Length=466

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPFQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
             YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   NYGLDPKIADAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L ++L  KS EF DI
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQSALEGKSREFSDI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>gb|KGL79172.1| hypothetical protein N309_10896, partial [Tinamus guttatus]
Length=466

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    SFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPIQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGLEP+I  A+++AA EVA GKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G +
Sbjct  65   DYGLEPNIANAIIKAADEVAAGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGQ  124

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF +I
Sbjct  125  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLENALEAKSKEFSEI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_004439637.1| PREDICTED: fumarate hydratase, mitochondrial [Ceratotherium simum 
simum]
Length=508

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EILG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEILGGE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHEVLLPGLQKLHDALDAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>gb|KFP26128.1| hypothetical protein N325_10917, partial [Colius striatus]
Length=467

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPFQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
             YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  66   NYGLDPKIADAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  125

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L ++L  KS EF DI
Sbjct  126  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQSALEGKSREFSDI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>ref|XP_005419421.1| PREDICTED: fumarate hydratase, mitochondrial-like [Geospiza fortis]
Length=529

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  68   AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  127

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  128  DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  187

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  188  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEEKSKEFSQI  247

Query  766  IKIGRT  783
            IKIGRT
Sbjct  248  IKIGRT  253



>ref|XP_009979909.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Tauraco 
erythrolophus]
Length=429

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEG+LNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGQLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_008929917.1| PREDICTED: fumarate hydratase, mitochondrial [Manacus vitellinus]
Length=493

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  32   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  91

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  92   DYGLDPKIAKAIVQAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  151

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  152  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  211

Query  766  IKIGRT  783
            IKIGRT
Sbjct  212  IKIGRT  217



>ref|XP_010075048.1| PREDICTED: fumarate hydratase, mitochondrial [Pterocles gutturalis]
Length=476

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = +1

Query  205  VCWRYFST--SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGI  378
            + W   ST  +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGI
Sbjct  5    IQWEVKSTQEAFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGI  64

Query  379  LKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIA  558
            LK+ AA+VN +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+
Sbjct  65   LKRAAAEVNQDYGLDPKISDAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVIS  124

Query  559  NRAAEILGHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSL  735
            NRA EI+G K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L
Sbjct  125  NRAIEIMGGKLGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNAL  184

Query  736  HSKSVEFKDIIKIGRT  783
             +KS EF  IIKIGRT
Sbjct  185  EAKSKEFSQIIKIGRT  200



>gb|KFV66685.1| hypothetical protein N307_11320, partial [Picoides pubescens]
Length=466

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNK  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIADAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_004895653.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Heterocephalus 
glaber]
 ref|XP_004853524.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Heterocephalus 
glaber]
 gb|EHB09990.1| Fumarate hydratase, mitochondrial [Heterocephalus glaber]
Length=508

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS+ NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSMMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGCE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALSAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>ref|XP_003499892.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Cricetulus 
griseus]
 ref|XP_007637780.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Cricetulus 
griseus]
 gb|EGW05762.1| Fumarate hydratase, mitochondrial [Cricetulus griseus]
 gb|ERE73303.1| fumarate hydratase [Cricetulus griseus]
Length=507

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGPTERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|NP_957257.1| fumarate hydratase, mitochondrial precursor [Danio rerio]
 sp|Q7SX99.1|FUMH_DANRE RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Danio rerio]
 gb|AAH55566.1| Zgc:66253 [Danio rerio]
 gb|AAH66484.1| Zgc:66253 [Danio rerio]
Length=509

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 172/241 (71%), Gaps = 11/241 (5%)
 Frame = +1

Query  67   WRQRRLLSAFGCG-SSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREE  243
            +R  R L  F    S +R  Q +  I AR V C       +  LR+       S +FR E
Sbjct  2    YRSARSLHRFSASLSDLRAAQRS--IKARNV-C------PAPGLRHQTVRMASSEAFRIE  52

Query  244  RDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLE  423
            RDTFG ++VPSDK +GAQT RS  NF IGG  ERMP  +IRAFGILKK AA+VN +YGL+
Sbjct  53   RDTFGELKVPSDKYYGAQTVRSTMNFRIGGVTERMPIQVIRAFGILKKAAAEVNKDYGLD  112

Query  424  PSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-  600
            P I  A+M+AA EV  GKL+DHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG K G K 
Sbjct  113  PKIADAIMKAADEVESGKLDDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGKLGSKD  172

Query  601  AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGR  780
             VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L+ LH +L +K+ +FKDIIKIGR
Sbjct  173  PVHPNDHVNKSQSSNDTFPTAMHIAAAKEVHEVLLPGLQTLHDALAAKAEQFKDIIKIGR  232

Query  781  T  783
            T
Sbjct  233  T  233



>gb|KFV00612.1| hypothetical protein N340_04373, partial [Tauraco erythrolophus]
Length=432

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEG+LNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGQLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>gb|KFP18053.1| hypothetical protein Z169_14841, partial [Egretta garzetta]
Length=466

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_005368585.1| PREDICTED: fumarate hydratase, mitochondrial [Microtus ochrogaster]
Length=507

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  46   SFRIEYDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  105

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  106  DYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  165

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  +
Sbjct  166  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALSAKSKEFAQV  225

Query  766  IKIGRT  783
            IKIGRT
Sbjct  226  IKIGRT  231



>ref|XP_005326633.1| PREDICTED: fumarate hydratase, mitochondrial [Ictidomys tridecemlineatus]
Length=508

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L++KS EF  I
Sbjct  167  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALNAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>gb|KFZ60559.1| hypothetical protein N338_09291, partial [Podiceps cristatus]
Length=466

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|NP_001267172.1| fumarate hydratase, mitochondrial [Pan troglodytes]
 dbj|BAK62931.1| fumarate hydratase, mitochondrial precursor [Pan troglodytes]
Length=510

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_002718365.1| PREDICTED: fumarate hydratase, mitochondrial-like [Oryctolagus 
cuniculus]
Length=508

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRTEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+ A EVAEGKLNDHFPLVIWQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIANAIMKVADEVAEGKLNDHFPLVIWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>ref|XP_008489569.1| PREDICTED: fumarate hydratase, mitochondrial [Calypte anna]
Length=474

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  13   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  72

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  73   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  132

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  133  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  192

Query  766  IKIGRT  783
            IKIGRT
Sbjct  193  IKIGRT  198



>gb|KGL93621.1| hypothetical protein N301_03833, partial [Charadrius vociferus]
Length=466

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>gb|KFO98944.1| hypothetical protein N300_02760, partial [Calypte anna]
Length=468

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  7    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  66

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  67   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  126

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  127  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  186

Query  766  IKIGRT  783
            IKIGRT
Sbjct  187  IKIGRT  192



>ref|NP_000134.2| fumarate hydratase, mitochondrial [Homo sapiens]
 sp|P07954.3|FUMH_HUMAN RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Homo sapiens]
 gb|AAB66354.1| fumarase precursor [Homo sapiens]
 gb|AAD00071.1| fumarase [Homo sapiens]
 gb|AAH03108.1| Fumarate hydratase [Homo sapiens]
 gb|AAH17444.1| Fumarate hydratase [Homo sapiens]
 gb|AAP88841.1| fumarate hydratase [Homo sapiens]
 gb|AAX32244.1| fumarate hydratase [synthetic construct]
 gb|AAX32245.1| fumarate hydratase [synthetic construct]
 gb|EAW70092.1| fumarate hydratase, isoform CRA_c [Homo sapiens]
 gb|ABW03809.1| fumarate hydratase [synthetic construct]
 dbj|BAG35325.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20674.1| fumarate hydratase [synthetic construct]
 gb|AIC48761.1| FH, partial [synthetic construct]
Length=510

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_010581869.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Haliaeetus 
leucocephalus]
Length=467

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  66   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  125

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  126  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>gb|KFQ04696.1| hypothetical protein N329_04765, partial [Haliaeetus albicilla]
 gb|KFQ97614.1| hypothetical protein Y956_03361, partial [Nipponia nippon]
Length=466

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_011845414.1| PREDICTED: fumarate hydratase, mitochondrial [Mandrillus leucophaeus]
Length=510

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>emb|CCF51284.1| probable FUM1-fumarate hydratase [Ustilago hordei]
Length=516

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 165/228 (72%), Gaps = 6/228 (3%)
 Frame = +1

Query  103  GSSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDK  282
            G+S R     + IA       +TR+ +S +   +   +     FR E+DTFGP+QVP+D+
Sbjct  12   GASTRVAPPRLAIAFASAIPTATRAFASSAFIMSQQAK-----FRSEKDTFGPLQVPADR  66

Query  283  LWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQE  462
             WGAQTQRSLQNF+IGG +ERMPEP+I AFG+LKK AA VN  YGL+P +  A+ QAA E
Sbjct  67   YWGAQTQRSLQNFDIGGPQERMPEPLIEAFGVLKKAAATVNKSYGLDPKVADAICQAADE  126

Query  463  VAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRGEK-AVHPNDHVNRSQS  639
            V  GKL+ HFPLV++QTGSGTQ+NMN NEVI+NRA EILG + G K  VHPNDHVN SQS
Sbjct  127  VIAGKLHAHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKEPVHPNDHVNMSQS  186

Query  640  SNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            SNDTFPT MH+A+  +I K LLP L+QL  +L +K  EF DIIKIGRT
Sbjct  187  SNDTFPTAMHVASVTQITKSLLPALEQLCAALDAKRAEFDDIIKIGRT  234



>ref|XP_004283542.1| PREDICTED: fumarate hydratase, mitochondrial [Orcinus orca]
Length=466

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFG+LK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGVLKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEVLLPGLQKLHDALDAKSKEFAHI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>gb|KFV39301.1| hypothetical protein N341_12919, partial [Tyto alba]
Length=467

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  6    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  65

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  66   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  125

Query  589  RGEKA-VHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  126  LGSKTPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  185

Query  766  IKIGRT  783
            IKIGRT
Sbjct  186  IKIGRT  191



>ref|XP_007988126.1| PREDICTED: fumarate hydratase, mitochondrial [Chlorocebus sabaeus]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHNALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_007462683.1| PREDICTED: fumarate hydratase, mitochondrial [Lipotes vexillifer]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_003824573.1| PREDICTED: fumarate hydratase, mitochondrial [Pan paniscus]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>gb|KFW71651.1| hypothetical protein AS28_14072, partial [Pygoscelis adeliae]
Length=466

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_011891657.1| PREDICTED: fumarate hydratase, mitochondrial [Cercocebus atys]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_010382999.1| PREDICTED: fumarate hydratase, mitochondrial [Rhinopithecus roxellana]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_003267364.1| PREDICTED: fumarate hydratase, mitochondrial [Nomascus leucogenys]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|NP_588397.3| fumarate hydratase (predicted) [Schizosaccharomyces pombe 972h-]
 sp|O94552.3|FUMH_SCHPO RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Schizosaccharomyces pombe 972h-]
 emb|CAA21432.3| fumarate hydratase (predicted) [Schizosaccharomyces pombe]
Length=520

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 156/185 (84%), Gaps = 1/185 (1%)
 Frame = +1

Query  232  FREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNME  411
            FR+E DTFGPIQVP++K WGAQTQRSLQNF IGG++ER+P P++RAFG+LK+ AA VN E
Sbjct  58   FRQESDTFGPIQVPAEKYWGAQTQRSLQNFRIGGEKERLPLPLVRAFGVLKRAAASVNRE  117

Query  412  YGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKR  591
            +GL+P +  A+ QAAQEV +G+L+D+FPLV++QTGSGTQSNMN+NEVIANRA EILG   
Sbjct  118  FGLDPKLADAIEQAAQEVIDGRLDDNFPLVVFQTGSGTQSNMNSNEVIANRAIEILGGTL  177

Query  592  G-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDII  768
            G +K VHPNDHVN SQSSNDTFPTVMHIA+ ++I+  LLP +K LH +L  K  EFK+II
Sbjct  178  GSKKPVHPNDHVNMSQSSNDTFPTVMHIASVLQIHTHLLPAMKHLHRALKGKEEEFKNII  237

Query  769  KIGRT  783
            KIGRT
Sbjct  238  KIGRT  242



>ref|XP_010295483.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Phaethon 
lepturus]
 gb|KFQ65379.1| hypothetical protein N335_01053, partial [Phaethon lepturus]
Length=466

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_007182482.1| PREDICTED: fumarate hydratase, mitochondrial [Balaenoptera acutorostrata 
scammoni]
Length=510

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>sp|P10173.1|FUMH_PIG RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase 
[Sus scrofa]
Length=466

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+++AFGILK+ AA+VN 
Sbjct  5    SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVLKAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  65   DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  124

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  125  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEALLPGLQKLHDALDAKSREFAQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>emb|CDQ03094.1| Protein BM-FUM-1, partial [Brugia malayi]
Length=486

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 156/195 (80%), Gaps = 1/195 (1%)
 Frame = +1

Query  202  TVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGIL  381
            T+  R  ST+ R+ERDTFG +QVP+D+ +GAQT RS+ NF+IGG  ERMP P+I AFGIL
Sbjct  16   TMVKRNMSTAIRKERDTFGELQVPADRYYGAQTARSMINFKIGGPEERMPLPVIHAFGIL  75

Query  382  KKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIAN  561
            KK AA VN EYGL+  I  A+ +AA EV  GKL+DHFPLV+WQTGSGTQSNMN NEVI+N
Sbjct  76   KKAAALVNKEYGLDQKIVDAIAKAADEVIAGKLDDHFPLVVWQTGSGTQSNMNVNEVISN  135

Query  562  RAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLH  738
            RA E+LG + G +K VHPNDHVN SQSSNDT+PT MHIA A EIN RLLP+L+QL  SLH
Sbjct  136  RAIEMLGGELGSKKPVHPNDHVNMSQSSNDTYPTAMHIAVAREINSRLLPSLQQLLDSLH  195

Query  739  SKSVEFKDIIKIGRT  783
             KS EF++IIKIGRT
Sbjct  196  RKSKEFENIIKIGRT  210



>ref|NP_001230517.1| fumarate hydratase [Sus scrofa]
Length=512

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  51   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  110

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  111  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  170

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  171  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEVHEALLPGLQKLHDALDAKSREFAQI  230

Query  766  IKIGRT  783
            IKIGRT
Sbjct  231  IKIGRT  236



>ref|XP_003893750.1| PREDICTED: fumarate hydratase, mitochondrial [Papio anubis]
Length=510

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_010309788.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Balearica 
regulorum gibbericeps]
 gb|KFO06525.1| hypothetical protein N312_01122, partial [Balearica regulorum 
gibbericeps]
Length=466

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_005517420.1| PREDICTED: fumarate hydratase, mitochondrial-like [Pseudopodoces 
humilis]
Length=506

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  45   AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  104

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I KA++QAA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G  
Sbjct  105  DYGLDPKIAKAIVQAASEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGT  164

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L  KS EF  I
Sbjct  165  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEGKSKEFSQI  224

Query  766  IKIGRT  783
            IKIGRT
Sbjct  225  IKIGRT  230



>ref|XP_002760919.1| PREDICTED: fumarate hydratase, mitochondrial [Callithrix jacchus]
Length=510

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRVEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAATEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_009508750.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Phalacrocorax 
carbo]
 gb|KFW97120.1| hypothetical protein N336_11437, partial [Phalacrocorax carbo]
Length=466

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>ref|XP_010117491.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Chlamydotis 
macqueenii]
 gb|KFP41368.1| hypothetical protein N324_08945, partial [Chlamydotis macqueenii]
Length=466

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++A+ EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIADAIVKASNEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF +I
Sbjct  125  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSEI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>sp|Q60HF9.1|FUMH_MACFA RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Macaca fascicularis]
 dbj|BAD51956.1| fumarate hydratase [Macaca fascicularis]
Length=510

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_001094968.1| PREDICTED: fumarate hydratase, mitochondrial isoform 2 [Macaca 
mulatta]
Length=510

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_007119566.1| PREDICTED: fumarate hydratase, mitochondrial [Physeter catodon]
Length=510

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_004028710.1| PREDICTED: fumarate hydratase, mitochondrial [Gorilla gorilla 
gorilla]
Length=510

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_005374877.1| PREDICTED: fumarate hydratase, mitochondrial [Chinchilla lanigera]
Length=508

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDPKIATAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  167  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAALEVHEVLLPGLQKLHDALSAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



>gb|KFR02179.1| hypothetical protein N306_08359, partial [Opisthocomus hoazin]
Length=466

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  5    AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  64

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EV+EGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  65   DYGLDPKIANAIIKAANEVSEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  124

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF +I
Sbjct  125  LGSKNPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSEI  184

Query  766  IKIGRT  783
            IKIGRT
Sbjct  185  IKIGRT  190



>gb|EOA97454.1| Fumarate hydratase, mitochondrial, partial [Anas platyrhynchos]
Length=468

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  7    SFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  66

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVA+GKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  67   DYGLDPKIANAIVKAADEVAQGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  126

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  127  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  186

Query  766  IKIGRT  783
            IKIGRT
Sbjct  187  IKIGRT  192



>ref|NP_001272104.1| fumarate hydratase, mitochondrial [Macaca fascicularis]
 dbj|BAE89793.1| unnamed protein product [Macaca fascicularis]
Length=510

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_537215.1| PREDICTED: fumarate hydratase, mitochondrial isoform 1 [Canis 
lupus familiaris]
Length=508

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 180/248 (73%), Gaps = 20/248 (8%)
 Frame = +1

Query  46   RSIVLLDWRQRRLLSAFGCGSSIRETQMAMLIAARRVTCGSTRSISSESLRYTVCWRYFS  225
            R++ LL  R RRL+ A G  S+    + A+L+                 LR     R  S
Sbjct  3    RAVRLL-ARSRRLVRAPGSASAPGLGEAAVLL-----------------LRPPDAARMAS  44

Query  226  -TSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKV  402
              SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+V
Sbjct  45   QNSFRIEFDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEV  104

Query  403  NMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILG  582
            N +YGL+  I +A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG
Sbjct  105  NQDYGLDSKIAEAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLG  164

Query  583  HKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFK  759
             + G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L++KS EF 
Sbjct  165  GELGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALNAKSKEFA  224

Query  760  DIIKIGRT  783
             IIKIGRT
Sbjct  225  QIIKIGRT  232



>ref|XP_010894175.1| PREDICTED: fumarate hydratase, mitochondrial [Esox lucius]
Length=504

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = +1

Query  220  FSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAK  399
             S+ +R E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP  +I+AFGILK+ AA+
Sbjct  40   MSSEYRIEADTFGELRVPADKYYGAQTVRSTMNFKIGGPSERMPIQVIKAFGILKRAAAE  99

Query  400  VNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEIL  579
            VN +YGL+P +  A++QAA EVA GKL+DHFPLV+WQTGSGTQSNMN NEVI+NRA EIL
Sbjct  100  VNKDYGLDPRLADAIIQAADEVAAGKLDDHFPLVVWQTGSGTQSNMNVNEVISNRAIEIL  159

Query  580  GHKRGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEF  756
            G K G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+++ LLP L+ LH +L +K+VEF
Sbjct  160  GGKLGSKDPVHPNDHVNKSQSSNDTFPTAMHIAAAKEVHEVLLPGLQHLHDALQAKAVEF  219

Query  757  KDIIKIGRT  783
            KDIIKIGRT
Sbjct  220  KDIIKIGRT  228



>gb|EHH15914.1| hypothetical protein EGK_02083 [Macaca mulatta]
Length=510

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_009897885.1| PREDICTED: fumarate hydratase, mitochondrial [Picoides pubescens]
Length=486

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  25   AFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNK  84

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  85   DYGLDPKIADAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  144

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF  I
Sbjct  145  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSQI  204

Query  766  IKIGRT  783
            IKIGRT
Sbjct  205  IKIGRT  210



>ref|XP_010215690.1| PREDICTED: fumarate hydratase, mitochondrial [Tinamus guttatus]
Length=494

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  33   SFRTEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPIQVIRAFGILKRAAAEVNQ  92

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGLEP+I  A+++AA EVA GKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G +
Sbjct  93   DYGLEPNIANAIIKAADEVAAGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGQ  152

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF +I
Sbjct  153  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLENALEAKSKEFSEI  212

Query  766  IKIGRT  783
            IKIGRT
Sbjct  213  IKIGRT  218



>ref|XP_003935387.1| PREDICTED: fumarate hydratase, mitochondrial [Saimiri boliviensis 
boliviensis]
Length=510

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P +  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKLANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALEAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_010157072.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Eurypyga 
helias]
Length=490

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            +FR E DTFG ++VPSDK +GAQT RS  NF+IGG  ERMP  +IRAFGILK+ AA+VN 
Sbjct  29   AFRIEYDTFGELKVPSDKYYGAQTVRSTMNFKIGGVSERMPVQVIRAFGILKRAAAEVNQ  88

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+++AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA EI+G K
Sbjct  89   DYGLDPKIANAIVKAANEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEIMGGK  148

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA E+N+ LLP LK+L  +L +KS EF +I
Sbjct  149  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAQEVNEVLLPGLKKLQNALEAKSKEFSEI  208

Query  766  IKIGRT  783
            IKIGRT
Sbjct  209  IKIGRT  214



>ref|XP_005690753.1| PREDICTED: fumarate hydratase, mitochondrial [Capra hircus]
Length=546

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +1

Query  178  ISSESLRYTVCWRYFSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEP  357
            +   +++   C      SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P
Sbjct  126  VKPGNMKLAECPEASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGMTERMPIP  185

Query  358  IIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNM  537
            +I+AFGILK+ AA+VN +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NM
Sbjct  186  VIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNM  245

Query  538  NANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNL  714
            N NEVI+NRA EILG + G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L
Sbjct  246  NVNEVISNRAIEILGGELGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGL  305

Query  715  KQLHTSLHSKSVEFKDIIKIGRT  783
            ++LH +L +KS EF  IIKIGRT
Sbjct  306  QKLHDALEAKSKEFDQIIKIGRT  328



>gb|EHH50891.1| hypothetical protein EGM_01787 [Macaca fascicularis]
Length=510

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_011289145.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase, mitochondrial 
[Felis catus]
Length=506

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 170/224 (76%), Gaps = 7/224 (3%)
 Frame = +1

Query  133  MLIAARRVTCGSTRSISS-ESLRYTVCWRYFS-----TSFREERDTFGPIQVPSDKLWGA  294
            +L  +RR+      SIS    +  ++   YFS      SFR E DTFG ++VP+DK +GA
Sbjct  7    LLARSRRLVRPPASSISEVPGVSGSIIASYFSLXASQNSFRIEFDTFGELKVPNDKYYGA  66

Query  295  QTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNMEYGLEPSIGKAVMQAAQEVAEG  474
            QT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN +YGL+  I  A+M+AA EVAEG
Sbjct  67   QTVRSTMNFKIGGVTERMPIPVIKAFGILKRAAAEVNQDYGLDSKIANAIMKAADEVAEG  126

Query  475  KLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHKRG-EKAVHPNDHVNRSQSSNDT  651
            KLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG + G +K VHPNDHVN+SQSSNDT
Sbjct  127  KLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDT  186

Query  652  FPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDIIKIGRT  783
            FPT MHIAAA+E+++ LLP L++LH +L +KS EF  IIKIGRT
Sbjct  187  FPTAMHIAAAVEVHEVLLPGLQKLHDALEAKSKEFAQIIKIGRT  230



>ref|XP_011811077.1| PREDICTED: fumarate hydratase, mitochondrial [Colobus angolensis 
palliatus]
Length=510

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  49   SFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQ  108

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+P I  A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  109  DYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  168

Query  589  RGEK-AVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G K  VHPNDHVN+SQSSNDTFPT MHIAAA+E+++ LLP L++LH +L +KS EF  I
Sbjct  169  LGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSREFAQI  228

Query  766  IKIGRT  783
            IKIGRT
Sbjct  229  IKIGRT  234



>ref|XP_004799295.1| PREDICTED: fumarate hydratase, mitochondrial [Mustela putorius 
furo]
Length=508

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +1

Query  229  SFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIIRAFGILKKCAAKVNM  408
            SFR E DTFG ++VP+DK +GAQT RS  NF+IGG  ERMP P+I+AFGILK+ AA+VN 
Sbjct  47   SFRIEFDTFGELKVPNDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQ  106

Query  409  EYGLEPSIGKAVMQAAQEVAEGKLNDHFPLVIWQTGSGTQSNMNANEVIANRAAEILGHK  588
            +YGL+  I +A+M+AA EVAEGKLNDHFPLV+WQTGSGTQ+NMN NEVI+NRA E+LG +
Sbjct  107  DYGLDSKIAEAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGE  166

Query  589  RG-EKAVHPNDHVNRSQSSNDTFPTVMHIAAAMEINKRLLPNLKQLHTSLHSKSVEFKDI  765
             G +K VHPNDHVN+SQSSNDTFPT MHIAAA+E++  LLP L++LH +LH+KS EF  I
Sbjct  167  LGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHNVLLPGLQKLHDALHAKSKEFAQI  226

Query  766  IKIGRT  783
            IKIGRT
Sbjct  227  IKIGRT  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856