BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8706

Length=1742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB80004.1|  hypothetical protein B456_013G076900                    471   1e-158   Gossypium raimondii
ref|XP_012077962.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    469   6e-158   Jatropha curcas
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             469   1e-157   Prunus persica
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          468   2e-157   Sesamum indicum [beniseed]
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          468   2e-157   Sesamum indicum [beniseed]
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         468   2e-157   Jatropha curcas
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               467   8e-157   Prunus mume [ume]
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             464   7e-156   Prunus persica
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          462   5e-155   
ref|XP_002516727.1|  uv excision repair protein rad23, putative         461   8e-155   Ricinus communis
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          461   2e-154   Solanum tuberosum [potatoes]
ref|XP_012077961.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    460   3e-154   Jatropha curcas
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             458   1e-153   Prunus persica
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    457   5e-153   Nicotiana tomentosiformis
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    456   1e-152   Populus euphratica
gb|KJB80005.1|  hypothetical protein B456_013G076900                    456   2e-152   Gossypium raimondii
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               454   4e-152   Vitis vinifera
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    453   2e-151   Nicotiana sylvestris
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          452   3e-151   
ref|XP_006846642.1|  PREDICTED: ubiquitin receptor RAD23d               451   1e-150   Amborella trichopoda
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    451   1e-150   Populus euphratica
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    449   5e-150   Populus euphratica
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               449   9e-150   
ref|XP_002305813.1|  ubiquitin family protein                           446   6e-149   Populus trichocarpa [western balsam poplar]
ref|XP_006383464.1|  ubiquitin family protein                           446   1e-148   
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    442   2e-147   Populus euphratica
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    442   3e-147   Tarenaya hassleriana [spider flower]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                447   8e-147   
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          441   1e-146   Pyrus x bretschneideri [bai li]
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          429   2e-142   
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          429   4e-142   Pyrus x bretschneideri [bai li]
emb|CDY58121.1|  BnaCnng32650D                                          421   7e-139   Brassica napus [oilseed rape]
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             417   2e-137   Capsella rubella
emb|CDP19777.1|  unnamed protein product                                389   2e-126   Coffea canephora [robusta coffee]
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    384   2e-124   Vitis vinifera
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    384   2e-124   Vitis vinifera
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          385   4e-124   
gb|AFK37577.1|  unknown                                                 382   5e-124   Lotus japonicus
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    383   6e-124   Nicotiana tomentosiformis
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    381   1e-123   
ref|NP_001242098.1|  uncharacterized protein LOC100813881               382   1e-123   
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    381   2e-123   
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    382   2e-123   Citrus sinensis [apfelsine]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    382   2e-123   
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    381   2e-123   
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   382   2e-123   Citrus sinensis [apfelsine]
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    381   2e-123   
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    381   3e-123   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   381   3e-123   Citrus sinensis [apfelsine]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                382   4e-123   Morus notabilis
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    383   5e-123   
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    383   6e-123   Glycine max [soybeans]
ref|NP_001240201.1|  uncharacterized protein LOC100809066               380   1e-122   Glycine max [soybeans]
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             380   1e-122   Citrus clementina [clementine]
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          380   1e-122   
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             380   1e-122   Citrus clementina [clementine]
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     380   1e-122   Glycine soja [wild soybean]
gb|ABK24371.1|  unknown                                                 379   2e-122   Picea sitchensis
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               379   3e-122   Solanum lycopersicum
gb|EPS71284.1|  hypothetical protein M569_03474                         378   4e-122   Genlisea aurea
gb|KJB79994.1|  hypothetical protein B456_013G076500                    377   4e-122   Gossypium raimondii
gb|KJB80000.1|  hypothetical protein B456_013G076800                    377   6e-122   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    377   7e-122   Gossypium raimondii
gb|ACU18529.1|  unknown                                                 377   1e-121   Glycine max [soybeans]
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    377   1e-121   Nicotiana sylvestris
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             374   1e-121   
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   377   2e-121   Citrus sinensis [apfelsine]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   376   2e-121   Citrus sinensis [apfelsine]
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    375   3e-121   Nicotiana sylvestris
ref|XP_002529115.1|  uv excision repair protein rad23, putative         376   5e-121   Ricinus communis
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             375   8e-121   
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    375   9e-121   Glycine max [soybeans]
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    374   2e-120   Setaria italica
gb|ACH72675.1|  RAD23                                                   373   4e-120   Pinus sylvestris var. mongolica
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               373   6e-120   Glycine max [soybeans]
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    372   7e-120   Populus euphratica
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     373   8e-120   Glycine soja [wild soybean]
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          372   1e-119   Eucalyptus grandis [rose gum]
ref|XP_012077957.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    370   2e-119   Jatropha curcas
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             369   2e-119   
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             370   4e-119   
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          369   1e-118   Tarenaya hassleriana [spider flower]
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          369   1e-118   Populus euphratica
gb|KJB79996.1|  hypothetical protein B456_013G076600                    367   1e-118   Gossypium raimondii
gb|KJB79995.1|  hypothetical protein B456_013G076600                    368   2e-118   Gossypium raimondii
gb|ABD96960.1|  hypothetical protein                                    370   2e-118   Tarenaya spinosa
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    367   4e-118   
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    367   6e-118   Cicer arietinum [garbanzo]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   367   1e-117   Citrus sinensis [apfelsine]
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               366   2e-117   Pyrus x bretschneideri [bai li]
ref|NP_001063134.1|  Os09g0407200                                       366   2e-117   
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          365   2e-117   Tarenaya hassleriana [spider flower]
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          365   5e-117   Citrus sinensis [apfelsine]
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             365   9e-117   
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   365   1e-116   Citrus sinensis [apfelsine]
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  362   2e-116   Citrus sinensis [apfelsine]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             363   2e-116   Citrus clementina [clementine]
gb|AAB65841.1|  osRAD23                                                 363   3e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             362   7e-116   Phaseolus vulgaris [French bean]
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             361   7e-116   Phaseolus vulgaris [French bean]
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             362   7e-116   Populus trichocarpa [western balsam poplar]
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    362   1e-115   Populus euphratica
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    362   1e-115   Populus euphratica
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             362   1e-115   Phaseolus vulgaris [French bean]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          362   2e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    360   2e-115   Nelumbo nucifera [Indian lotus]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    360   2e-115   Nelumbo nucifera [Indian lotus]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    359   4e-115   Populus euphratica
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             359   5e-115   
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                361   6e-115   Erythranthe guttata [common monkey flower]
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          360   7e-115   Camelina sativa [gold-of-pleasure]
gb|ACU20959.1|  unknown                                                 358   9e-115   Glycine max [soybeans]
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                358   9e-115   Erythranthe guttata [common monkey flower]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    357   1e-114   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               357   1e-114   Glycine max [soybeans]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             360   2e-114   Capsella rubella
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             359   2e-114   Eutrema salsugineum [saltwater cress]
gb|KEH44233.1|  RAD23 UV excision repair family protein                 358   2e-114   Medicago truncatula
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               358   4e-114   Camelina sativa [gold-of-pleasure]
emb|CDP02781.1|  unnamed protein product                                356   1e-113   Coffea canephora [robusta coffee]
ref|NP_186903.1|  UV excision repair protein RAD23C                     357   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    356   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC76393.1|  RAD23-like protein                                     353   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    356   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    355   3e-113   Cucumis melo [Oriental melon]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  356   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          353   1e-112   Phoenix dactylifera
gb|ABB02636.1|  RAD23-like                                              352   3e-112   Solanum tuberosum [potatoes]
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    350   4e-112   Populus euphratica
ref|NP_850982.1|  ubiquitin receptor RAD23b                             351   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    351   4e-112   
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    351   4e-112   
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          352   6e-112   Nelumbo nucifera [Indian lotus]
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    352   6e-112   Phoenix dactylifera
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    352   7e-112   Phoenix dactylifera
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    351   7e-112   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    351   9e-112   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    351   1e-111   Populus euphratica
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    352   1e-111   Arabis alpina [alpine rockcress]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    352   2e-111   Arabis alpina [alpine rockcress]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    350   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    350   2e-111   Solanum lycopersicum
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               350   2e-111   Nicotiana sylvestris
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    350   2e-111   Solanum lycopersicum
ref|NP_001274760.1|  uncharacterized protein LOC102577665               350   3e-111   Solanum tuberosum [potatoes]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    350   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    348   5e-111   Solanum lycopersicum
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    352   7e-111   
dbj|BAC76389.1|  RAD23-like protein                                     348   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    347   2e-110   Nicotiana tomentosiformis
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    347   3e-110   Elaeis guineensis
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    346   6e-110   Nicotiana sylvestris
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    346   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    346   1e-109   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    346   1e-109   Fragaria vesca subsp. vesca
emb|CDX67404.1|  BnaA07g14440D                                          345   3e-109   
emb|CDX74251.1|  BnaA03g27960D                                          345   4e-109   
emb|CDX91998.1|  BnaC03g33000D                                          344   6e-109   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               344   7e-109   Brassica rapa
emb|CDY01661.1|  BnaC04g30910D                                          343   9e-109   
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          343   1e-108   Elaeis guineensis
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    343   2e-108   Elaeis guineensis
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               342   2e-108   Brassica rapa
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          343   2e-108   Cucumis melo [Oriental melon]
emb|CDX74522.1|  BnaA04g08670D                                          342   3e-108   
ref|NP_198663.1|  ubiquitin receptor RAD23d                             342   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             341   6e-108   
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        341   6e-108   Nicotiana tabacum [American tobacco]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    340   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             340   1e-107   Eutrema salsugineum [saltwater cress]
ref|XP_011655771.1|  PREDICTED: ubiquitin receptor RAD23d               341   2e-107   Cucumis sativus [cucumbers]
gb|AAK59766.1|  unknown protein                                         340   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    339   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    339   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          338   1e-106   
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               338   2e-106   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    337   3e-106   Arabis alpina [alpine rockcress]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               336   4e-106   Brassica rapa
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          336   5e-106   Elaeis guineensis
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                336   5e-106   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                336   5e-106   Erythranthe guttata [common monkey flower]
gb|AFK43607.1|  unknown                                                 330   8e-106   Lotus japonicus
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    335   9e-106   Tarenaya hassleriana [spider flower]
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      334   1e-105   Brassica rapa
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    335   1e-105   Tarenaya hassleriana [spider flower]
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    337   1e-105   Phoenix dactylifera
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    337   1e-105   Phoenix dactylifera
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    334   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    334   3e-105   Camelina sativa [gold-of-pleasure]
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               328   3e-105   Gossypium arboreum [tree cotton]
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    333   3e-104   Elaeis guineensis
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          331   5e-104   
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    333   8e-104   
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    333   8e-104   
emb|CAA72741.1|  RAD23, isoform I                                       329   2e-103   Daucus carota [carrots]
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          328   7e-103   Fragaria vesca subsp. vesca
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    328   2e-102   Elaeis guineensis
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    323   3e-101   Cucumis melo [Oriental melon]
gb|ACN40029.1|  unknown                                                 322   3e-100   Picea sitchensis
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          317   6e-99    
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    315   4e-98    Cicer arietinum [garbanzo]
gb|EAZ07072.1|  hypothetical protein OsI_29318                          313   1e-96    Oryza sativa Indica Group [Indian rice]
ref|NP_001061854.1|  Os08g0430200                                       311   7e-96    
ref|NP_974181.1|  ubiquitin receptor RAD23b                             306   6e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 305   2e-94    Medicago truncatula
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    306   3e-94    Setaria italica
gb|KJB69952.1|  hypothetical protein B456_011G053200                    304   5e-94    Gossypium raimondii
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          305   5e-94    Nelumbo nucifera [Indian lotus]
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               303   2e-93    Gossypium arboreum [tree cotton]
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            300   3e-93    
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          300   2e-92    Citrus sinensis [apfelsine]
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               300   3e-92    Nicotiana tomentosiformis
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                301   3e-92    
gb|KJB34920.1|  hypothetical protein B456_006G091100                    299   8e-92    Gossypium raimondii
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    299   8e-92    Nelumbo nucifera [Indian lotus]
gb|ACG32894.1|  DNA repair protein RAD23                                299   2e-91    Zea mays [maize]
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       298   3e-91    Brachypodium distachyon [annual false brome]
ref|XP_002303970.1|  DNA repair protein RAD23                           296   4e-91    
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             297   5e-91    Populus trichocarpa [western balsam poplar]
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   296   5e-91    Citrus sinensis [apfelsine]
gb|KJB34921.1|  hypothetical protein B456_006G091100                    294   7e-91    Gossypium raimondii
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          296   9e-91    Populus euphratica
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    296   1e-90    Eucalyptus grandis [rose gum]
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    296   1e-90    Eucalyptus grandis [rose gum]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               296   1e-90    Gossypium arboreum [tree cotton]
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    295   2e-90    Eucalyptus grandis [rose gum]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    295   2e-90    Eucalyptus grandis [rose gum]
ref|NP_001142065.1|  uncharacterized protein LOC100274222               296   2e-90    Zea mays [maize]
ref|NP_001149140.1|  LOC100282762                                       296   3e-90    Zea mays [maize]
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    294   4e-90    Nicotiana sylvestris
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    294   5e-90    
gb|EAZ00429.1|  hypothetical protein OsI_22453                          295   5e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    294   6e-90    Nicotiana sylvestris
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          294   6e-90    Solanum tuberosum [potatoes]
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633              293   7e-90    
ref|NP_001057334.1|  Os06g0264300                                       295   7e-90    
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               294   7e-90    Fragaria vesca subsp. vesca
ref|NP_001266655.1|  DNA repair protein RAD23                           294   1e-89    
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               292   2e-89    
ref|XP_006845449.1|  PREDICTED: ubiquitin receptor RAD23b               292   4e-89    Amborella trichopoda
gb|ACF79443.1|  unknown                                                 290   1e-88    Zea mays [maize]
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    290   1e-88    Nicotiana tomentosiformis
ref|NP_001149553.1|  LOC100283179                                       291   2e-88    Zea mays [maize]
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    290   2e-88    Nicotiana tomentosiformis
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             290   3e-88    Prunus persica
emb|CDO98260.1|  unnamed protein product                                289   4e-88    Coffea canephora [robusta coffee]
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 291   5e-88    
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          289   6e-88    Prunus mume [ume]
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              289   7e-88    
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          289   7e-88    Pyrus x bretschneideri [bai li]
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          288   8e-88    
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      288   1e-87    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT30328.1|  Putative DNA repair protein RAD23                       290   1e-87    
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          288   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    285   2e-87    Nicotiana sylvestris
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    288   3e-87    Brachypodium distachyon [annual false brome]
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    288   3e-87    Brachypodium distachyon [annual false brome]
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             287   3e-87    
ref|XP_012067446.1|  PREDICTED: ubiquitin receptor RAD23b-like          287   3e-87    Jatropha curcas
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         286   3e-87    Jatropha curcas
ref|XP_002299163.1|  DNA repair protein RAD23                           286   4e-87    
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               288   4e-87    Vitis vinifera
emb|CBI25247.3|  unnamed protein product                                287   5e-87    Vitis vinifera
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          286   6e-87    Populus euphratica
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          286   7e-87    Phoenix dactylifera
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          285   8e-87    Sesamum indicum [beniseed]
gb|EMS50196.1|  putative DNA repair protein RAD23                       292   1e-86    Triticum urartu
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    285   2e-86    Nicotiana sylvestris
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    285   2e-86    Nicotiana sylvestris
dbj|BAJ98767.1|  predicted protein                                      286   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          286   3e-86    Brachypodium distachyon [annual false brome]
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    284   4e-86    
ref|NP_565216.2|  ubiquitin receptor RAD23b                             283   5e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001763027.1|  predicted protein                                  283   6e-86    
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    281   6e-86    
gb|ABG89119.1|  Rad23-3Ai                                               283   7e-86    synthetic construct
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    284   9e-86    
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    283   1e-85    
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             283   1e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    284   1e-85    
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               283   1e-85    
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          283   2e-85    
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    282   2e-85    
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...    285   3e-85    
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             281   3e-85    
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          281   4e-85    
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    281   5e-85    
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    281   5e-85    
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             281   6e-85    
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    280   6e-85    
ref|XP_004147454.1|  PREDICTED: ubiquitin receptor RAD23b               281   6e-85    
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    281   6e-85    
ref|XP_011651807.1|  PREDICTED: ubiquitin receptor RAD23b               281   7e-85    
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    281   8e-85    
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    281   1e-84    
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               280   1e-84    
dbj|BAC76390.1|  RAD23-like protein                                     280   1e-84    
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               280   2e-84    
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    280   2e-84    
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    280   2e-84    
ref|NP_173070.1|  DNA repair protein RAD23A                             278   5e-84    
dbj|BAC76391.1|  RAD23-like protein                                     278   7e-84    
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          278   7e-84    
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      278   1e-83    
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             277   2e-83    
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             277   2e-83    
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      276   3e-83    
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    276   5e-83    
ref|XP_002512770.1|  uv excision repair protein rad23, putative         275   6e-83    
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    276   6e-83    
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    276   6e-83    
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               273   3e-82    
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             273   5e-82    
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     273   8e-82    
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              272   1e-81    
ref|XP_001780766.1|  predicted protein                                  272   2e-81    
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              272   2e-81    
emb|CDX79333.1|  BnaC06g19700D                                          271   5e-81    
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             271   1e-80    
emb|CDX67983.1|  BnaA07g20230D                                          271   1e-80    
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    270   1e-80    
dbj|BAC76395.1|  RAD23-like protein                                     268   2e-80    
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          270   3e-80    
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg             265   1e-79    
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                266   1e-79    
emb|CDX81753.1|  BnaC08g38480D                                          266   2e-79    
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          267   2e-79    
ref|XP_003637291.1|  RAD23 protein                                      265   8e-79    
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     262   6e-77    
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    259   2e-76    
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    258   2e-76    
emb|CAA72742.1|  RAD23 protein, isoform II                              258   3e-76    
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    258   5e-76    
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    257   6e-76    
gb|KJB80001.1|  hypothetical protein B456_013G076800                    254   1e-75    
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          249   2e-75    
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    254   3e-75    
emb|CDY33351.1|  BnaC05g12320D                                          254   4e-75    
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    254   7e-75    
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              249   8e-75    
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      254   8e-75    
gb|EEC72612.1|  hypothetical protein OsI_06092                          254   9e-75    
ref|NP_001046083.1|  Os02g0179300                                       254   9e-75    
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    254   1e-74    
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              248   3e-74    
emb|CDY35071.1|  BnaA06g10810D                                          252   6e-74    
gb|AAF68123.1|AC010793_18  F20B17.8                                     251   1e-73    
ref|XP_012077958.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    248   3e-73    
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    248   3e-73    
ref|XP_012077959.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    248   4e-73    
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    249   2e-72    
gb|KJB69953.1|  hypothetical protein B456_011G053200                    244   2e-71    
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    244   4e-71    
dbj|BAK04690.1|  predicted protein                                      244   7e-71    
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             241   4e-70    
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    240   2e-69    
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          239   7e-69    
ref|NP_001148810.1|  LOC100282427                                       237   4e-68    
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 236   5e-68    
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          234   3e-67    
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    233   4e-67    
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          231   2e-66    
ref|XP_012077966.1|  PREDICTED: ubiquitin receptor RAD23d-like          227   3e-66    
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    229   4e-65    
ref|XP_003637292.1|  RAD23 protein                                      223   7e-65    
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    219   8e-62    
dbj|BAJ97496.1|  predicted protein                                      221   1e-61    
gb|EPS72838.1|  hypothetical protein M569_01918                         215   1e-60    
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          207   3e-60    
emb|CAN62701.1|  hypothetical protein VITISV_007064                     214   6e-60    
gb|AEA86337.1|  putative DNA repair protein                             208   7e-60    
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          214   3e-59    
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                211   5e-59    
gb|KJB69954.1|  hypothetical protein B456_011G053200                    205   7e-57    
gb|KJB67005.1|  hypothetical protein B456_010G170000                    201   5e-55    
gb|EMT27109.1|  Putative DNA repair protein RAD23                       199   1e-53    
gb|EMS61794.1|  putative DNA repair protein RAD23                       199   1e-53    
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     200   1e-53    
ref|XP_003455006.1|  PREDICTED: UV excision repair protein RAD23 ...    193   7e-52    
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...    189   5e-51    
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     191   2e-50    
gb|ACJ83410.1|  unknown                                                 180   9e-50    
gb|AEA86336.1|  putative DNA repair protein                             180   1e-49    
ref|XP_004549657.1|  PREDICTED: UV excision repair protein RAD23 ...    184   1e-48    
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                   178   3e-47    
ref|XP_003081625.1|  Nucleotide excision repair factor NEF2, RAD2...    175   1e-46    
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               167   7e-46    
emb|CEF99377.1|  UBA-like                                               177   9e-46    
gb|KDO69966.1|  hypothetical protein CISIN_1g0163871mg                  173   2e-45    
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg             173   2e-45    
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                     173   4e-45    
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...    170   8e-44    
ref|XP_001420144.1|  predicted protein                                  170   1e-43    
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...    169   4e-43    
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    159   9e-43    
ref|XP_004549658.1|  PREDICTED: UV excision repair protein RAD23 ...    167   1e-42    
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...    167   2e-42    
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          157   4e-42    
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...    165   4e-42    
gb|KGL75456.1|  UV excision repair protein RAD23 B                      165   8e-42    
ref|XP_001366912.1|  PREDICTED: UV excision repair protein RAD23 ...    165   8e-42    
ref|XP_006631678.1|  PREDICTED: UV excision repair protein RAD23 ...    164   9e-42    
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    156   1e-41    
emb|CDQ83149.1|  unnamed protein product                                165   1e-41    
emb|CDQ90828.1|  unnamed protein product                                164   2e-41    
ref|XP_009819016.1|  PREDICTED: UV excision repair protein RAD23 ...    162   2e-41    
gb|KFV48041.1|  UV excision repair protein RAD23 B                      163   5e-41    
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...    163   6e-41    
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...    162   8e-41    
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...    162   8e-41    
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...    161   1e-40    
gb|KFU98476.1|  UV excision repair protein RAD23 B                      161   2e-40    
ref|XP_005062233.1|  PREDICTED: UV excision repair protein RAD23 ...    159   3e-40    
ref|NP_956858.1|  UV excision repair protein RAD23 homolog B            161   3e-40    
ref|XP_002432231.1|  uv excision repair protein rad23, putative         160   3e-40    
ref|XP_005428092.1|  PREDICTED: UV excision repair protein RAD23 ...    159   3e-40    
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...    159   3e-40    
ref|XP_005459515.1|  PREDICTED: UV excision repair protein RAD23 ...    159   3e-40    
ref|XP_009886968.1|  PREDICTED: UV excision repair protein RAD23 ...    159   4e-40    
ref|XP_005708114.1|  nucleotide excision repair protein                 161   5e-40    
ref|XP_001752264.1|  predicted protein                                  152   5e-40    
ref|XP_009096530.1|  PREDICTED: UV excision repair protein RAD23 ...    159   6e-40    
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...    160   6e-40    
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...    160   7e-40    
ref|XP_006789079.1|  PREDICTED: UV excision repair protein RAD23 ...    159   7e-40    
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...    159   7e-40    
gb|KGL96224.1|  UV excision repair protein RAD23 B                      160   7e-40    
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...    160   7e-40    
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...    160   7e-40    
ref|XP_005931262.1|  PREDICTED: UV excision repair protein RAD23 ...    159   8e-40    
ref|XP_007172025.1|  PREDICTED: UV excision repair protein RAD23 ...    159   8e-40    
ref|XP_009704807.1|  PREDICTED: UV excision repair protein RAD23 ...    158   9e-40    
ref|XP_007103675.1|  PREDICTED: UV excision repair protein RAD23 ...    159   1e-39    
ref|XP_009873289.1|  PREDICTED: UV excision repair protein RAD23 ...    158   1e-39    
ref|XP_010403981.1|  PREDICTED: UV excision repair protein RAD23 ...    159   1e-39    
gb|KFP54135.1|  UV excision repair protein RAD23 B                      159   1e-39    
ref|XP_010403980.1|  PREDICTED: UV excision repair protein RAD23 ...    159   1e-39    
ref|XP_009643344.1|  PREDICTED: UV excision repair protein RAD23 ...    157   1e-39    
ref|XP_005646102.1|  UV excision repair protein Rad23                   159   2e-39    
ref|XP_010724307.1|  PREDICTED: UV excision repair protein RAD23 ...    155   2e-39    
ref|XP_009475490.1|  PREDICTED: UV excision repair protein RAD23 ...    157   2e-39    
ref|XP_010566855.1|  PREDICTED: UV excision repair protein RAD23 ...    157   2e-39    
ref|XP_009501627.1|  PREDICTED: UV excision repair protein RAD23 ...    157   2e-39    
ref|XP_008938608.1|  PREDICTED: UV excision repair protein RAD23 ...    157   2e-39    
gb|KFV42406.1|  UV excision repair protein RAD23 B                      158   2e-39    
ref|XP_009915463.1|  PREDICTED: UV excision repair protein RAD23 ...    157   2e-39    
gb|KFP68145.1|  UV excision repair protein RAD23 B                      158   2e-39    
gb|KFQ83380.1|  UV excision repair protein RAD23 B                      157   2e-39    
ref|NP_001284535.1|  UV excision repair protein RAD23 homolog A i...    158   2e-39    
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...    158   2e-39    
ref|XP_006255338.1|  PREDICTED: UV excision repair protein RAD23 ...    158   2e-39    
gb|KFQ93153.1|  UV excision repair protein RAD23 B                      158   2e-39    
ref|XP_010208101.1|  PREDICTED: UV excision repair protein RAD23 ...    157   2e-39    
ref|XP_011122498.1|  hypothetical protein AOL_s00079g321                159   2e-39    
ref|XP_009905224.1|  PREDICTED: UV excision repair protein RAD23 ...    157   3e-39    
gb|KFP78669.1|  UV excision repair protein RAD23 B                      158   3e-39    
gb|KFP28504.1|  UV excision repair protein RAD23 B                      157   3e-39    
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          156   3e-39    
ref|XP_005682329.1|  PREDICTED: UV excision repair protein RAD23 ...    157   3e-39    
ref|XP_005208732.1|  PREDICTED: UV excision repair protein RAD23 ...    157   3e-39    
gb|KFW73791.1|  UV excision repair protein RAD23 B                      157   3e-39    
ref|XP_010125653.1|  PREDICTED: UV excision repair protein RAD23 ...    156   3e-39    
ref|XP_010143171.1|  PREDICTED: UV excision repair protein RAD23 ...    156   3e-39    
ref|XP_005502851.1|  PREDICTED: UV excision repair protein RAD23 ...    156   3e-39    
ref|XP_009284591.1|  PREDICTED: UV excision repair protein RAD23 ...    156   3e-39    
gb|KFP09954.1|  UV excision repair protein RAD23 B                      157   3e-39    
ref|XP_006041613.1|  PREDICTED: UV excision repair protein RAD23 ...    157   3e-39    
ref|XP_009579770.1|  PREDICTED: UV excision repair protein RAD23 ...    156   4e-39    
ref|XP_006996281.1|  PREDICTED: UV excision repair protein RAD23 ...    157   4e-39    
gb|KFP93964.1|  UV excision repair protein RAD23 B                      157   4e-39    
ref|XP_009563003.1|  PREDICTED: UV excision repair protein RAD23 ...    156   4e-39    
ref|XP_005962893.1|  PREDICTED: UV excision repair protein RAD23 ...    157   4e-39    
ref|XP_008639793.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    156   4e-39    
gb|KFQ29720.1|  UV excision repair protein RAD23 B                      157   4e-39    
ref|XP_004677510.1|  PREDICTED: UV excision repair protein RAD23 ...    158   4e-39    
ref|XP_007640731.1|  PREDICTED: UV excision repair protein RAD23 ...    157   4e-39    
gb|KFP45297.1|  UV excision repair protein RAD23 B                      157   4e-39    
ref|XP_004677511.1|  PREDICTED: UV excision repair protein RAD23 ...    157   4e-39    
ref|XP_008921937.1|  PREDICTED: UV excision repair protein RAD23 ...    156   5e-39    
gb|KFV72415.1|  UV excision repair protein RAD23 B                      157   5e-39    
gb|KFM01514.1|  UV excision repair protein RAD23 B                      157   6e-39    
ref|XP_004635604.1|  PREDICTED: UV excision repair protein RAD23 ...    157   6e-39    
gb|EMC77210.1|  UV excision repair protein RAD23 like protein B         157   6e-39    
ref|XP_010764281.1|  PREDICTED: UV excision repair protein RAD23 ...    157   6e-39    
ref|XP_009251134.1|  PREDICTED: UV excision repair protein RAD23 ...    154   7e-39    
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...    157   7e-39    
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...    157   7e-39    
gb|KFO78985.1|  UV excision repair protein RAD23 B                      157   7e-39    
ref|XP_011598628.1|  PREDICTED: UV excision repair protein RAD23 ...    155   8e-39    
gb|KFW08178.1|  UV excision repair protein RAD23 B                      156   8e-39    
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...    159   8e-39    
ref|XP_007462497.1|  PREDICTED: UV excision repair protein RAD23 ...    155   9e-39    
ref|XP_007178312.1|  PREDICTED: UV excision repair protein RAD23 ...    155   9e-39    
emb|CAF91196.1|  unnamed protein product                                155   9e-39    
ref|XP_010992120.1|  PREDICTED: UV excision repair protein RAD23 ...    156   1e-38    
gb|KFW80798.1|  UV excision repair protein RAD23 B                      156   1e-38    
ref|XP_006918804.1|  PREDICTED: UV excision repair protein RAD23 ...    156   1e-38    
ref|XP_005968716.1|  PREDICTED: UV excision repair protein RAD23 ...    155   1e-38    
ref|XP_009487270.1|  PREDICTED: UV excision repair protein RAD23 ...    155   1e-38    
ref|XP_006906142.1|  PREDICTED: UV excision repair protein RAD23 ...    155   1e-38    



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   471 bits (1213),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 288/389 (74%), Positives = 321/389 (83%), Gaps = 5/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1     MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN V EN+F+V+M+ K K +SGEGS +STA TK    ASS   + APA   + + + + A
Sbjct  61    ENSVTENSFIVIMLTKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSAMAA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
              A       + TP   +   DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121   PATESAPVASSTPLSDS---DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE AE PP     P V Q  N AAQPQQ AQ A +P+S PNA
Sbjct  178   RAAYNNPERAVEYLYSGIPEQAEAPPV-ARAPVVGQATNPAAQPQQPAQTAAIPTSGPNA  236

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLPN+ +S AG A TL+FLRNS QFQAL+AMVQANPQILQPMLQELGKQNP+
Sbjct  237   NPLDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALQAMVQANPQILQPMLQELGKQNPN  295

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA
Sbjct  296   LMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRA  355

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
              VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  356   TVLQVFFACNKNEELAANYLLDHMHDFQD  384



>ref|XP_012077962.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Jatropha 
curcas]
Length=382

 Score =   469 bits (1208),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 281/389 (72%), Positives = 313/389 (80%), Gaps = 7/389 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1     MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +          APAP PA
Sbjct  61    ENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQPSTTTEAPAPTPA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P    +      P +   DVYGQAASNLVAGNNLE  IQQILDMGGG+W RETVVRAL
Sbjct  121   PPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQQILDMGGGSWTRETVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE AEV P       +      A  P QA QPA   S  PNA
Sbjct  181   RAAYNNPERAVEYLYSGIPEQAEVQPV----AQIPASAQAANTPAQAEQPAVPTSGGPNA  236

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLP++ S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  237   NPLDLFPQGLPSMGSNASAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  294

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA
Sbjct  295   LMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRA  353

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  354   IVLEVFFACNKNEELAANYLLDHMHEFEE  382



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   469 bits (1206),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 274/389 (70%), Positives = 307/389 (79%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1     MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN+VAEN+F+V+M+ K K+S    S++  A T    PAS+ +++  P   PA   A   +
Sbjct  61    ENQVAENSFIVIMLTKNKASPSGASSTKGAATSQAQPASTPTSTAPPVASPAPVRAVAES  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                V   A A     +    DVYGQAASNLVAG NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  121   QPVVETPAVAAPTDSSRS--DVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERAVEYLYSGIPE AEVPPA   P         AA P   A     P+  PNA
Sbjct  179   RAAFNNPERAVEYLYSGIPEQAEVPPAAQVPAGEQAANPPAANPPAQAPQPVAPTGGPNA  238

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  239   NPLDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPH  296

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRA
Sbjct  297   LMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             LVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  357   LVLEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   468 bits (1205),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 274/394 (70%), Positives = 302/394 (77%), Gaps = 19/394 (5%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKD TTLE
Sbjct  1     MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDETTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FV V+M     +S  G+A+++A   + +   S ++        A +PAP  A
Sbjct  61    ENKVAENSFV-VIMLTKNKASSSGAATASAVASSTSQPVSNTSLPTQPVTAAPSPAPTVA  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                    +        A S DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  120   PLQSAPESAPVPAPTPASSTDVYGQAASNLVAGNNLEATVQQILDMGGGSWDRDTVVRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEV-----PPAEGnpppvlqppnqaaqpqqaaqpapvps  943
             RAAYNNPERAVEYLYSGIPE AEV     PPA G P        QAA P       P+  
Sbjct  180   RAAYNNPERAVEYLYSGIPEQAEVNPVVQPPAGGQPVNPPAQATQAAAPAGGPNANPL--  237

Query  944   sapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELG  1123
                     DLFPQGLPN+ S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELG
Sbjct  238   --------DLFPQGLPNMGSNASAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELG  287

Query  1124  KQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  1303
             KQNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAM
Sbjct  288   KQNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAM  346

Query  1304  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             GFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  347   GFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  380



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   468 bits (1204),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 273/394 (69%), Positives = 301/394 (76%), Gaps = 19/394 (5%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             M+IFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1     MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIHQGKVLKDATTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAE +FV V+M     +S  G+A+++A   +   + S + S       A  PAPV A
Sbjct  61    ENKVAEKSFV-VVMLTKNKASSSGAATASAAPSSKTQSVSDTPSPTQPVSAAPTPAPVAA  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                    +        A S DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RAL
Sbjct  120   PPQSAPESAPVPAPTPASSTDVYGQAASNLVAGSNLETTVQQILDMGGGSWDRETVIRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEV-----PPAEGnpppvlqppnqaaqpqqaaqpapvps  943
             RAAYNNPERAVEYLY+GIPE AEV     PPA G P        Q A P       P+  
Sbjct  180   RAAYNNPERAVEYLYTGIPEQAEVAHAAQPPAGGQPVTNPSQGTQPAVPSGGPNANPL--  237

Query  944   sapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELG  1123
                     DLFPQGLPN+ S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELG
Sbjct  238   --------DLFPQGLPNMGSNASAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELG  287

Query  1124  KQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  1303
             KQNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAM
Sbjct  288   KQNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAM  346

Query  1304  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             GFDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  347   GFDRALVLEVFFACNKNEELAANYLLDHMHEFDD  380



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   468 bits (1204),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 280/389 (72%), Positives = 312/389 (80%), Gaps = 7/389 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1     MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +          APAP PA
Sbjct  61    ENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQPSTTTEAPAPTPA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P    +      P +   DVYGQAASNLVAGNNLE  IQQILDMGGG+W RETVVRAL
Sbjct  121   PPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQQILDMGGGSWTRETVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE AEV P       +      A  P QA QPA   S  PNA
Sbjct  181   RAAYNNPERAVEYLYSGIPEQAEVQPV----AQIPASAQAANTPAQAEQPAVPTSGGPNA  236

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLP++ S+ + G  TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPH
Sbjct  237   NPLDLFPQGLPSMGSNASAG--TLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPH  294

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA
Sbjct  295   LMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRA  353

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  354   IVLEVFFACNKNEELAANYLLDHMHEFEE  382



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   467 bits (1201),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 276/389 (71%), Positives = 309/389 (79%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1     MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN+VAEN+F+VVM+ K K+S    S++  A T    PAS+ +++T P   PA   A   +
Sbjct  61    ENQVAENSFIVVMLTKNKASPSGASSTKGAATSQAQPASTPTSTTPPVATPAPVRAVAES  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                V   A A     +    DVYGQAASNLVAG NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  121   QPVVETPAVAAPTDSSRS--DVYGQAASNLVAGTNLEATVQQILDMGGGSWDRDTVVRAL  178

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERAVEYLYS IPE AEVPPA   P        QAA P   A    VP+  PNA
Sbjct  179   RAAFNNPERAVEYLYSXIPEQAEVPPAAQVPVGEQAANPQAANPPAQAPQPVVPTGGPNA  238

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  239   NPLDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPH  296

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRA
Sbjct  297   LMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             LVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  357   LVLEVYFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   464 bits (1194),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 281/389 (72%), Positives = 313/389 (80%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+M+ K+KSSSGEGS +STATT      S+ SA+         AP P  A
Sbjct  61    ENKVAENSFVVIMLTKSKSSSGEGSGASTATTTKAPQPSAPSAAPTATLTAPQAPIPTSA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                        + A T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121   PPASVTTPAPVSSATTEVESDPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNP RA++YLYSGIPE  EVPPA    P   +  N  AQP Q+AQPA  P S PNA
Sbjct  181   RAAFNNPARAIDYLYSGIPEQPEVPPA-ARIPVSGEVANLPAQPPQSAQPAATPPSGPNA  239

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPL+LFPQGLPN+ +      N L+FLR+SQQFQALRAMVQANPQILQPMLQELGKQNP+
Sbjct  240   NPLNLFPQGLPNVGAGAGAAGN-LDFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPN  298

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA
Sbjct  299   LMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  357   IVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   462 bits (1189),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 273/389 (70%), Positives = 301/389 (77%), Gaps = 2/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1     MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             +N VAEN+F+V+M+ K K+S    S+   A T    PAS+   S AP P   +    +  
Sbjct  61    QNNVAENSFIVIMLTKPKASPAGASSKQGAATSQAQPASTAPTSAAPPPAAPAPAPALLQ  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P P    A   APT    DVYGQAASNLVAG  LE  +QQILDMGGG+WDRETVVRAL
Sbjct  121   LLPQPXXQTAAVVAPTDSRSDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERAVEYLYSGIPE AE PPA   P         AA P   A     P+  PNA
Sbjct  181   RAAFNNPERAVEYLYSGIPEQAEAPPAAQVPAGEQAANPMAANPPAQAPQPVAPTGGPNA  240

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLPN+  +NAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  241   NPLDLFPQGLPNM-GANAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPH  298

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRA
Sbjct  299   LMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRA  358

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             LVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  359   LVLEVYFACNKNEELAANYLLDHMHEFEE  387



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   461 bits (1187),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 264/389 (68%), Positives = 302/389 (78%), Gaps = 8/389 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1     MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+F+V+ M   +  S  G +++++   + A  +ST   +A  P   +    V A
Sbjct  61    ENKVAENSFIVI-MLSKRKVSPSGGSTASSAPPSQAQPASTLPPSATQPSTTAQAPAVTA  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P   A   P   P +   D+YGQAASNLVAG+NLE  +QQILDMGGG+WDRETV RAL
Sbjct  120   ELPQSAAESTPVVNPVSSETDIYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVARAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERAVEYLYSGIPE  EV P     P        A     A +PA   S   NA
Sbjct  180   RAAFNNPERAVEYLYSGIPEQPEVQP----LPRAPSSGQAAIPSATAQEPAAPTSGGANA  235

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLP I S+ + G  TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  236   NPLDLFPQGLPTIGSTTSAG--TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  293

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQADFLRLINEPVEG +GN+LGQLA+++PQ+V VTPEEREAIERLEAMGFDRA
Sbjct  294   LMRLIQEHQADFLRLINEPVEG-DGNLLGQLASAVPQSVSVTPEEREAIERLEAMGFDRA  352

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMH+FE+
Sbjct  353   IVLEVFFACNKNEELAANYLLDHMHDFEE  381



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 271/393 (69%), Positives = 303/393 (77%), Gaps = 7/393 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1     MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDATTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+M++K K SS   S+   A + T  PA ST  +      P +  A   +
Sbjct  61    ENKVAENSFVVIMLSKNKVSSTGTSSIPAAPSNTAQPAGSTDQARQTITAPQATAALPQS  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             ++    A+     A  +   DVY QAASNLVAG+NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  121   ASESAPASAPVPAAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPA----EGnpppvlqppnqaaqpqqaaqpapvpss  946
             RAA+NNPERAV+YLYSGIPE AE+PP                       Q A    VPSS
Sbjct  181   RAAFNNPERAVDYLYSGIPEQAEIPPVARTPAAPAVTAPASGQAINPAAQDASQLAVPSS  240

Query  947   apnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGK  1126
              PNANPLDLFPQGL N   SNAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGK
Sbjct  241   GPNANPLDLFPQGLTNA-GSNAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGK  298

Query  1127  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  1306
             QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  299   QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMG  357

Query  1307  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             FDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  358   FDRALVLEVYFACNKNEELAANYLLDHMHEFDE  390



>ref|XP_012077961.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Jatropha 
curcas]
Length=394

 Score =   460 bits (1184),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 281/401 (70%), Positives = 313/401 (78%), Gaps = 19/401 (5%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDT------------VADVKKSIETVQGSNVYPASQLMLIH  382
             MK+FVKTLKGT+FEIEVKP+D             VADVKK+IETVQG++VYPA++ MLI+
Sbjct  1     MKVFVKTLKGTNFEIEVKPDDRTENNNNVNGEIQVADVKKAIETVQGADVYPAAKQMLIY  60

Query  383   QGKVLKDGTTLEENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapa  562
             QGKVLKD TTLEENKVA+N+F+V+M++K+K SSG  SA+ST       PASS  +     
Sbjct  61    QGKVLKDDTTLEENKVADNSFIVIMLSKSKVSSGGTSAASTGPPSQAQPASSLPSHATQP  120

Query  563   pvpasapapvpasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGG  742
                  APAP PA  P    +      P +   DVYGQAASNLVAGNNLE  IQQILDMGG
Sbjct  121   STTTEAPAPTPAPPPSAAESIPAVANPVSSESDVYGQAASNLVAGNNLEATIQQILDMGG  180

Query  743   GTWDRETVVRALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaa  922
             G+W RETVVRALRAAYNNPERAVEYLYSGIPE AEV P       +      A  P QA 
Sbjct  181   GSWTRETVVRALRAAYNNPERAVEYLYSGIPEQAEVQPV----AQIPASAQAANTPAQAE  236

Query  923   qpapvpssapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQ  1102
             QPA   S  PNANPLDLFPQGLP++ S+ + G  TL+FLRNSQQFQALRAMVQANPQILQ
Sbjct  237   QPAVPTSGGPNANPLDLFPQGLPSMGSNASAG--TLDFLRNSQQFQALRAMVQANPQILQ  294

Query  1103  PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREA  1282
             PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREA
Sbjct  295   PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREA  353

Query  1283  IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             IERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  354   IERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  394



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   458 bits (1179),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 276/389 (71%), Positives = 311/389 (80%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+M+ K+KSS GEGS +STAT       S+ SA+         AP P  A
Sbjct  61    ENKVAENSFVVIMLTKSKSSLGEGSGASTATITKAPQPSAPSAAPTVTLTAPQAPIPTSA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             S          + A      + YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121   SPASVTTPAPVSSATMEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNP RA++YLYSGIPE  EVPP   + P   +  N  AQ  Q+AQPA  P S PNA
Sbjct  181   RAAFNNPARAIDYLYSGIPEQPEVPPV-AHIPVSGEAANLPAQSPQSAQPASTPPSGPNA  239

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPL+LFPQGLPN+ +  AG  N L+FLR+SQQFQALRAMVQANPQILQPMLQELGKQNP+
Sbjct  240   NPLNLFPQGLPNVGAGGAGAGN-LDFLRDSQQFQALRAMVQANPQILQPMLQELGKQNPN  298

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA
Sbjct  299   LMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  357   IVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   457 bits (1175),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 275/391 (70%), Positives = 307/391 (79%), Gaps = 10/391 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1     MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+M++K K S+   SA+    + T  PA+ST   T     P +  A V  
Sbjct  61    ENKVAENSFVVIMLSKNKVSTSATSATQPTPSNTAQPATSTGQPTQTVTAPQATAASVAP  120

Query  599   sapvpvaapaptpaptag--sgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  772
             +   P +AP P  AP +     DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+R
Sbjct  121   AQSAPQSAPTPAAAPVSANPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  773   ALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssap  952
             ALRAA+NNPERA+EYLYSGIPE AE+      PP       QA  P   A    VPS  P
Sbjct  181   ALRAAFNNPERAIEYLYSGIPEQAEI-----PPPAPAPASGQAVNPPVQASQPAVPSGGP  235

Query  953   nanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  1132
             NANPLDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQN
Sbjct  236   NANPLDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQN  293

Query  1133  PHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             P LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFD
Sbjct  294   PQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFD  352

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  353   RALVLQVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   456 bits (1173),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 262/390 (67%), Positives = 302/390 (77%), Gaps = 9/390 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1     MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             E+KVAEN+F+VVM++K+K SSG  S ++ A      P SS  ++       A A  P   
Sbjct  61    ESKVAENSFIVVMLSKSKVSSGGPSTATAAPPTLAQPTSSLPSNVTQPSSTAQAAVPAAV  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                   ++PA   +  +   D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRAL
Sbjct  121   PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             RAA+NNPERAVEYLYSGIPE AEVPP A+G    V   P   AQ   A       ++   
Sbjct  181   RAAFNNPERAVEYLYSGIPEQAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANPL-  239

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
                 DLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP
Sbjct  240   ----DLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  293

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
             HLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDR
Sbjct  294   HLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDR  352

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             ALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  353   ALVLEVFFACNKNEELAANYLLDHMHEFDE  382



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   456 bits (1172),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 284/390 (73%), Positives = 317/390 (81%), Gaps = 6/390 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1     MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN V EN+F+V+M+ K K +SGEGS +STA TK    ASS   + APA   + + + + A
Sbjct  61    ENSVTENSFIVIMLTKNKGASGEGSTASTAPTKKAPEASSLPTAPAPASTASVSMSAMAA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
              A       + TP   +   DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121   PATESAPVASSTPLSDS---DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRAL  177

Query  779   RAAYNNPERAVEYLYS-GIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             RAAYNNPERAVEYLYS      AE PP     P V Q  N AAQPQQ AQ A +P+S PN
Sbjct  178   RAAYNNPERAVEYLYSVSTFLQAEAPPV-ARAPVVGQATNPAAQPQQPAQTAAIPTSGPN  236

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
             ANPLDLFPQGLPN+ +S AG A TL+FLRNS QFQAL+AMVQANPQILQPMLQELGKQNP
Sbjct  237   ANPLDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALQAMVQANPQILQPMLQELGKQNP  295

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
             +LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDR
Sbjct  296   NLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDR  355

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             A VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  356   ATVLQVFFACNKNEELAANYLLDHMHDFQD  385



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   454 bits (1169),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 266/389 (68%), Positives = 298/389 (77%), Gaps = 8/389 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN+VAE++F  V++  +K+    G AS+T+   T      +S+         +  APV A
Sbjct  61    ENQVAESSF--VVIMLSKNKVSAGGASTTSAAPTSQAQPVSSSPPTSNQPSTAPQAPVVA  118

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                V            +   D+YGQAASNLVAGNNLE  IQQILDMGGG+WDR+TVVRAL
Sbjct  119   LPEVIPEPAPAVAPSISSDSDIYGQAASNLVAGNNLEVTIQQILDMGGGSWDRDTVVRAL  178

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE AE PPA    PP                   V SS PNA
Sbjct  179   RAAYNNPERAVEYLYSGIPEQAEGPPA--ARPPASGLAVNLPTQAPQGPQTTVASSGPNA  236

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQGLP++ S+ + G  TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  237   NPLDLFPQGLPSMGSNASAG--TLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPH  294

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQADFLRLINEPVE GEGN+LGQL  ++PQAV +TPEERE+IERLEAMGFDRA
Sbjct  295   LMRLIQEHQADFLRLINEPVE-GEGNVLGQL-GTVPQAVTITPEERESIERLEAMGFDRA  352

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             LVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  353   LVLEVFFACNKNEELAANYLLDHMHEFEE  381



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   453 bits (1165),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 276/391 (71%), Positives = 307/391 (79%), Gaps = 6/391 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1     MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+M+AK K S+   SA+  A + T  PA+ST   T     P +  A +  
Sbjct  61    ENKVAENSFVVIMLAKNKVSTSATSAAQPAPSNTAQPATSTGQPTQTVTAPQATAASLAP  120

Query  599   sapvpvaapaptpaptag--sgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  772
             +   P +AP P  AP +     DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+R
Sbjct  121   AQSAPQSAPTPAAAPVSSNPVTDVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIR  180

Query  773   ALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssap  952
             ALRAA+NNPERA+EYLYSGIPE AE+P      P +     QA  P   A    VPS  P
Sbjct  181   ALRAAFNNPERAIEYLYSGIPEQAEIP-PAAPAPALAPASGQAVNPPVQASQPAVPSGGP  239

Query  953   nanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  1132
             NANPLDLFPQGLPN+  SNAG  N L+FL NS QFQALRAMVQANPQILQPMLQELGKQN
Sbjct  240   NANPLDLFPQGLPNV-GSNAGAGN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQN  297

Query  1133  PHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             P LMRLIQEHQADFLRLINEPVEG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFD
Sbjct  298   PQLMRLIQEHQADFLRLINEPVEG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFD  356

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALVL+VFFACNKNEELAANYLLDHMHEF++
Sbjct  357   RALVLQVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   452 bits (1163),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 272/389 (70%), Positives = 304/389 (78%), Gaps = 5/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+ M     SS    + ++  T T AP  S SA+         AP P  A
Sbjct  61    ENKVAENSFVVI-MLTKSKSSLGEGSGASTATITKAPQPSASAAPTVTLTAPQAPIPTSA  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                        + A T    + YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  120   LPASVTTPAPVSLATTEVESNPYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNP RA++YLYSGIPE  EVPP   + P   +  N  AQP Q+AQPA  P   PNA
Sbjct  180   RAAFNNPARAIDYLYSGIPEQPEVPPV-AHIPVSGEAANLPAQPPQSAQPASTPPGGPNA  238

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPL+LFPQGLPN+ +  AG  N L+FLR SQQFQALRAMVQANPQILQPMLQELGKQNP+
Sbjct  239   NPLNLFPQGLPNVGAGGAGAGN-LDFLRGSQQFQALRAMVQANPQILQPMLQELGKQNPN  297

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQ+HQADFLRLINEPVEGGEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA
Sbjct  298   LMRLIQQHQADFLRLINEPVEGGEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRA  355

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  356   IVLEVFFACNKNEELAANYLLDHMHEFEE  384



>ref|XP_006846642.1| PREDICTED: ubiquitin receptor RAD23d [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   451 bits (1160),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 268/398 (67%), Positives = 305/398 (77%), Gaps = 18/398 (5%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKG+HFEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIHQGKVLKD TTL 
Sbjct  1     MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIHQGKVLKDDTTLL  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             +NKVAENNF+V+M+ KTK+ +G G++++++ T  + P SS+  +   +  PA   A    
Sbjct  61    DNKVAENNFLVIMLTKTKAPAGGGTSTTSSATAQVQPPSSSPPNPPTSAPPAQTAATPSP  120

Query  599   sapvpvaapaptpaptagsgD--VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  772
                               SGD  VYGQAASNLVAG+NLE AIQQILDMGGG+WDR+TVVR
Sbjct  121   PVAAAPTTVNQPATALLSSGDADVYGQAASNLVAGSNLEQAIQQILDMGGGSWDRDTVVR  180

Query  773   ALRAAYNNPERAVEYLYSGIPESAEVP------PAEGnpppvlqppnqaaqpqqaaqpap  934
             ALRAAYNNPERAVEYLYSGIPE AE P      PA G       P    +     A    
Sbjct  181   ALRAAYNNPERAVEYLYSGIPEQAEAPAPVARSPASG-------PAVNPSVQAPQAAQPA  233

Query  935   vpssapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQ  1114
             VPSS PNANPLDLFPQGLPN+    A GA TL+FLRNSQQFQALR M QANPQILQPMLQ
Sbjct  234   VPSSGPNANPLDLFPQGLPNM--GGAAGAGTLDFLRNSQQFQALRDMFQANPQILQPMLQ  291

Query  1115  ELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQLAASMPQAVQVTPEEREAIER  1291
             ELGKQNP LMRLIQEHQADFLRLINE P EG EGN+LGQLA++MPQAV VTPEEREAIER
Sbjct  292   ELGKQNPQLMRLIQEHQADFLRLINEQPAEGAEGNLLGQLASAMPQAVTVTPEEREAIER  351

Query  1292  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             LEA+GFDRALVLEVFFACNKNEELAANYLLDHM+EFE+
Sbjct  352   LEALGFDRALVLEVFFACNKNEELAANYLLDHMNEFEE  389



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   451 bits (1159),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 259/390 (66%), Positives = 298/390 (76%), Gaps = 10/390 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1     MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             E+KVAEN+F+VV M      S  G +++TA   +  P SS  ++       A A  P   
Sbjct  61    ESKVAENSFIVV-MLSKSKVSSGGPSTATAAPPSAQPTSSLPSNVTQPSSTAQAAVPAAV  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                   ++PA   +  +   D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRAL
Sbjct  120   PQSAAESSPAVVVSDLSSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             RAA+NNPERAVEYLYSGIPE AEVPP A+G    V   P   AQ   A       ++   
Sbjct  180   RAAFNNPERAVEYLYSGIPEQAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANPL-  238

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
                 DLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP
Sbjct  239   ----DLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  292

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
             HLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDR
Sbjct  293   HLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDR  351

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             ALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  352   ALVLEVFFACNKNEELAANYLLDHMHEFDE  381



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   449 bits (1156),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 267/389 (69%), Positives = 305/389 (78%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1     MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV+E++F VVM++K+K SS   S +  A      PASS  ++     + + AP P  A
Sbjct  61    ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                    +            ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRAL
Sbjct  121   LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERAVEYLYSGIP+ AEVPP            N A  P  A QP   P+S PNA
Sbjct  181   RAAFNNPERAVEYLYSGIPQQAEVPPV-AQVVQGPASGNAANPPALAPQPVVAPNSGPNA  239

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+
Sbjct  240   NPLDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPY  297

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA
Sbjct  298   LMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  357   IVLEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   449 bits (1154),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 266/393 (68%), Positives = 298/393 (76%), Gaps = 8/393 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1     MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDTTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+ M      S  G++S +A     A    ++           A A +P 
Sbjct  61    ENKVAENSFVVI-MLSKNKVSSTGTSSISAALSNTAQPDGSTDQARQTITTPQATAALPQ  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             SA      PAP PA  +   DVY QAASNLVAG+NLE  +QQILDMGGG+WDR+TVVRAL
Sbjct  120   SASESAPTPAPVPAAASSVTDVYDQAASNLVAGSNLETTVQQILDMGGGSWDRDTVVRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAV+YLYSGIPE  E+PP    P         +AQ    A       + P++
Sbjct  180   RAAYNNPERAVDYLYSGIPEQTEIPPVARAPAAPAVTAPASAQAINPAAQDASQLAVPSS  239

Query  959   ----nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGK  1126
                 NPLDLFPQGL N   SNAG  N L+FLRNS QFQALRAMVQANPQILQPMLQELGK
Sbjct  240   GPNANPLDLFPQGLTNA-GSNAGAGN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGK  297

Query  1127  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  1306
             QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  298   QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMG  356

Query  1307  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             FDRALVLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  357   FDRALVLEVYFACNKNEELAANYLLDHLHEFDE  389



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   446 bits (1148),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 265/389 (68%), Positives = 306/389 (79%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1     MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV+E++F VVM++K+K SSG  S +  A      PASS  ++     + + AP P  A
Sbjct  61    ENKVSESSFFVVMLSKSKVSSGGPSTAPAAPASQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                    +            ++YGQAASNLVAG+NLE  IQ+ILDMGGG W+RETVVRAL
Sbjct  121   LPQSAAESSPAVVTSALLDTNMYGQAASNLVAGSNLEATIQEILDMGGGDWNRETVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERA++YLYSGIPE AEVPP            N    P  A QP   P+S PNA
Sbjct  181   RAAFNNPERAIDYLYSGIPEQAEVPPV-AQVVQGPASGNAVNPPALAPQPVVAPNSGPNA  239

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQG  +   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+
Sbjct  240   NPLDLFPQGHHST-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPY  297

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA
Sbjct  298   LMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  357   IVLEVYFACNKNEELAANYLLDHMHEFDE  385



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   446 bits (1146),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 256/392 (65%), Positives = 295/392 (75%), Gaps = 11/392 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVA-DVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  415
             MK+FVKTLKGT+FEIEVKPEDTV  +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL
Sbjct  1     MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTL  60

Query  416   EENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapv  592
             +E+KVAEN+F VV++     SS G  +A++     +    S+ +A+           +  
Sbjct  61    DESKVAENSFIVVMLSKSKVSSGGPSTATAAPPNVSSGGPSTATAAPPTLVSAQPTSSLP  120

Query  593   pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  772
                      + A  PA      D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVR
Sbjct  121   SNVTQPSSTSQAAVPAAAFSDADMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVR  180

Query  773   ALRAAYNNPERAVEYLYSGIPESAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssa  949
             ALRAA+NNPERAVEYLYSGIPE AEVPP A+G    V   P   AQ   A       ++ 
Sbjct  181   ALRAAFNNPERAVEYLYSGIPEQAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANP  240

Query  950   pnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQ  1129
                   DLFPQGLP+   SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQ
Sbjct  241   L-----DLFPQGLPST-GSNAGAGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQ  293

Query  1130  NPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGF  1309
             NPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGF
Sbjct  294   NPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGF  352

Query  1310  DRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             DRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  353   DRALVLEVFFACNKNEELAANYLLDHMHEFDE  384



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 263/390 (67%), Positives = 305/390 (78%), Gaps = 5/390 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1     MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419   ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
             ENKV+E++F VV++     SSSG  +A +   ++    +S  S  T P+    +      
Sbjct  61    ENKVSESSFFVVMLSKSKVSSSGPSTAPAAPPSQAPPASSLPSNVTQPSITSQAPVPAAA  120

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
                    ++PA   +  +   ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRA
Sbjct  121   LPQSAAESSPAVVTSALSLDTNMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRA  180

Query  776   LRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             LRAA+NNPERAVEYLYSGIP+ AEVPP            N A  P  A QP   P+S PN
Sbjct  181   LRAAFNNPERAVEYLYSGIPQQAEVPPV-AQVVQGPASGNAANPPALAPQPVVAPNSGPN  239

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
             ANPLDLFPQG      SNAG  N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP
Sbjct  240   ANPLDLFPQGHHRT-GSNAGTGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  297

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
             +LMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDR
Sbjct  298   YLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDR  356

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             A+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  357   AIVLEVYFACNKNEELAANYLLDHMHEFDE  386



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   442 bits (1137),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 263/390 (67%), Positives = 294/390 (75%), Gaps = 5/390 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1     MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENK++EN F+ V+M      S  G+++++A   + +  S   A+   +    + P P   
Sbjct  61    ENKISENGFI-VIMLSKSKVSSSGTSTASAPPASASQPSQAPAAPRVSAPTVAVPEPTSG  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
              A     A A   AP     DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRAL
Sbjct  120   PATATATATATAAAPVLAQTDVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             RAAYNNPERAVEYLYSGIP  AEVP  A+  P        QA   Q A      P+  PN
Sbjct  180   RAAYNNPERAVEYLYSGIPAQAEVPQVAQAPPSGGQTTNPQAQAQQPAPAAPAAPAGGPN  239

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
             ANPL+LFPQGLP   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP
Sbjct  240   ANPLNLFPQGLPT--AGADAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  297

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
              LMRLIQ+HQADFL LINEP EG E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDR
Sbjct  298   QLMRLIQDHQADFLNLINEPAEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDR  356

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             ALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  357   ALVLEVFFACNKNEELAANYLLDHIHEFED  386



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   447 bits (1150),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 269/437 (62%), Positives = 305/437 (70%), Gaps = 48/437 (11%)
 Frame = +2

Query  230   RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  409
             ++ MKI VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD T
Sbjct  115   KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIHQGKVLKDVT  174

Query  410   TLEENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapap  589
             TLEENKV EN+F+V+M+ K K+S    S++S A T    P +++  +++     +  PA 
Sbjct  175   TLEENKVVENSFIVIMITKNKASPSGASSTSGAATSQAQPVTASPPASSTPSTTSETPAS  234

Query  590   vpasapvpvaapaptpaptagsgDVYGQAASNLV--------------------------  691
             V                  +   DVYGQAASNLV                          
Sbjct  235   VAPPPQSVPEPAPAAAPTASAELDVYGQAASNLVAGSNLEATVQQILDRNLFPNLLLQQL  294

Query  692   -------------------AGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVE  814
                                AG+NLE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVE
Sbjct  295   LLLRDAELDVYGQAASNLVAGSNLEATVQQILDMGGGSWDRDTVVRALRAAFNNPERAVE  354

Query  815   YLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPN  994
             YLYSGIPE A+VPP    P         A  P   A     P+  PNANPLDLFPQGLP+
Sbjct  355   YLYSGIPEQADVPPPAQVPAGGQAANPPAINPPVQASQPAAPTGGPNANPLDLFPQGLPS  414

Query  995   IPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADF  1174
             + S+   GA TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADF
Sbjct  415   MGSN--VGAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADF  472

Query  1175  LRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKN  1354
             LRLINEPVE GEGN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKN
Sbjct  473   LRLINEPVE-GEGNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKN  531

Query  1355  EELAANYLLDHMHEFED  1405
             EELAANYLLDHMHEF+D
Sbjct  532   EELAANYLLDHMHEFDD  548



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   441 bits (1133),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 263/389 (68%), Positives = 300/389 (77%), Gaps = 4/389 (1%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKVAEN+FVV+M+ K+ S  GEGS +STA T      S+ + +       + APA    
Sbjct  61    ENKVAENSFVVIMLTKSTSPPGEGSGASTAATTKAPQPSAHTGAPTATLTASPAPAAAST  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                          A T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRAL
Sbjct  121   LPASVATPAPVASATTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNP RA++YLYSGIPE  E PPA    P   Q  N  AQP Q+AQPA  P S PNA
Sbjct  181   RAAFNNPARAIDYLYSGIPEQPEAPPAV-RIPVGGQVANPPAQPPQSAQPASAPPSRPNA  239

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPL+LFPQ LPN+    AG A  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+
Sbjct  240   NPLNLFPQELPNV-GVGAGAAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPN  298

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             L+RLI EHQADFLRLINEP EGGEGN+LG   A++PQA+ ++PEEREAIERLEAMGF RA
Sbjct  299   LVRLIGEHQADFLRLINEPAEGGEGNVLGD--AAVPQAIAISPEEREAIERLEAMGFARA  356

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  357   IVLQVFFACNKNEELTANYLLDHMHEFED  385



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 253/390 (65%), Positives = 288/390 (74%), Gaps = 13/390 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  419   ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
              NKVAEN+F V+++        GEGS +STA T      S+ + +         AP    
Sbjct  61    GNKVAENSFVVIMLTKSKSPPGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPXAAS  120

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
             A               T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRA
Sbjct  121   ALPAPVTTPAPVASPTTDSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRA  180

Query  776   LRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             LRAA+NNP RA++YLYSGIPE  E PP        +  P         AQPA  P S PN
Sbjct  181   LRAAFNNPARAIDYLYSGIPEQPEAPPT-------VPIPVSEQVTNPPAQPASAPPSRPN  233

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
             A+PL+LFPQGLPN+    AGGA  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP
Sbjct  234   ADPLNLFPQGLPNV---GAGGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNP  290

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
             +L+RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF R
Sbjct  291   NLVRLIGTHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFAR  348

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             A+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  349   AIVLQVFFACNKNEELAANYLLDHMHEFED  378



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   429 bits (1103),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 260/390 (67%), Positives = 296/390 (76%), Gaps = 7/390 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1     MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  419   ENKVAENNFV-VVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
              NKVAEN+FV +++      + GEGS +STA T      S+ + +         APA   
Sbjct  61    GNKVAENSFVVIMLTKSKSPTGGEGSGASTAATTEAPQPSAHTGAPTATLTATPAPAAAS  120

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
             A               T    D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVV A
Sbjct  121   ALPASVTTPAPVASPTTNSQADSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVCA  180

Query  776   LRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             LRAA+NNP RA++YLYSGIPE  E PPA    P   Q  N  AQP Q+AQPA  P S PN
Sbjct  181   LRAAFNNPARAIDYLYSGIPEQPEAPPAV-PIPVSEQVANPPAQPPQSAQPASAPPSRPN  239

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
             A+PL+LFPQGLPN+    AGGA  L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP
Sbjct  240   ADPLNLFPQGLPNM---GAGGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNP  296

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
             +L+RLI  HQADFLRLINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF R
Sbjct  297   NLVRLIGAHQADFLRLINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFAR  354

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             A+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  355   AIVLQVFFACNKNEELAANYLLDHMHEFED  384



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   421 bits (1081),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 251/389 (65%), Positives = 289/389 (74%), Gaps = 6/389 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1     MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN V EN+F+ V+M      S  G+++++A     +   +  A T   P  A+  A VP 
Sbjct  60    ENNVVENSFI-VIMLSKAKVSSSGASTASAPAPAPSATQAQPAQTVATPQVATPTASVPE  118

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
              +       AP+ A  +   DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RAL
Sbjct  119   PSSGAATGAAPSAAAASTQTDVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRAL  178

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAA+NNPERAVEYLYSGIP  AE+PPA    P             Q        +  PNA
Sbjct  179   RAAFNNPERAVEYLYSGIPAQAEIPPAP-QAPATGGQAANPLAQTQQEAAPVPATGGPNA  237

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPL+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP 
Sbjct  238   NPLNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQ  295

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA
Sbjct  296   LVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRA  354

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  355   MVLEVFFACNKNEELAANYLLDHMHEFEE  383



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   417 bits (1071),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 256/390 (66%), Positives = 289/390 (74%), Gaps = 7/390 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+FVKTL GT+FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1     MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419   ENKVAENN-FVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
             EN V E +  V+++     SSSG  +AS+ A T T +   +  A T   P  ++    VP
Sbjct  60    ENNVVEKSFIVIMLSKTKVSSSGASTASAPAPTPTPSATQAQPAQTVATPQVSAPTVSVP  119

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
                     A AP  A  +   DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRA
Sbjct  120   EPTSGTATAAAPAAAAASVQTDVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRA  179

Query  776   LRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             LRAA+NNPERAVEYLYSGIP  AEVPP      P         Q Q         +  PN
Sbjct  180   LRAAFNNPERAVEYLYSGIPAQAEVPPV--AQAPSTGEQAANPQAQPQQAAPAAATGGPN  237

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
             ANPL+LFPQG+P   +    GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP
Sbjct  238   ANPLNLFPQGMPA--ADAGAGAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  295

Query  1136  HLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDR  1315
              L+RLIQEHQADFLRLINEPVEG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDR
Sbjct  296   QLVRLIQEHQADFLRLINEPVEGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDR  354

Query  1316  ALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             A+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  355   AMVLEVFFACNKNEELAANYLLDHMHEFED  384



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 212/249 (85%), Positives = 220/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS LVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  144   DVYGQAASTLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  203

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE PP     PP  Q  +  AQ   + QPA VPSS PNANPLDLFPQGLPN+  SN  G
Sbjct  204   SAEAPPV-SRTPPSGQTTSPPAQLPPSTQPAAVPSSGPNANPLDLFPQGLPNL-GSNPAG  261

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP+
Sbjct  262   ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPI  321

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQ +QVT EEREAI RLE MGFDRA VLEVFFACNKNEELAANYL
Sbjct  322   EGGEGNILGQLAGAMPQTIQVTAEEREAIRRLEEMGFDRATVLEVFFACNKNEELAANYL  381

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  382   LDHMHEFEE  390


 Score =   137 bits (346),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIML  74



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   384 bits (987),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 210/249 (84%), Positives = 216/249 (87%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNN E AIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  155   DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  214

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P Q+ QP P PSS PNANPLDLFPQG+PN+  SN  G
Sbjct  215   QAEVPPV----ARAPASGQAANPPAQSQQPVPAPSSGPNANPLDLFPQGIPNV-GSNPAG  269

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  270   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  329

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  330   EGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAANYL  389

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  390   LDHMHEFED  398


 Score =   136 bits (343),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   384 bits (986),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 210/249 (84%), Positives = 216/249 (87%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNN E AIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  154   DAYGQAASNLVAGNNFEEAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  213

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P Q+ QP P PSS PNANPLDLFPQG+PN+  SN  G
Sbjct  214   QAEVPPV----ARAPASGQAANPPAQSQQPVPAPSSGPNANPLDLFPQGIPNV-GSNPAG  268

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  269   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  328

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLAA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  329   EGGEGNILGQLAAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAANYL  388

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  389   LDHMHEFED  397


 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   385 bits (988),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 210/249 (84%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLEGA+QQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  187   DVYGQAASNLVAGNNLEGAVQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  246

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE PP   + P        A   Q A   A   +        DLFPQG P++  SNAGG
Sbjct  247   SAEAPPTSASVPSRQAANVPAQPQQAAQPAAVPSAGPNANPL-DLFPQGFPSV-GSNAGG  304

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  305   ANTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  364

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGG GNIL QLA +MPQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  365   EGGAGNILEQLAGAMPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  424

Query  1379  LDHMHEFED  1405
             LDH+HEFE+
Sbjct  425   LDHIHEFEE  433


 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++FVVVM+
Sbjct  61   ENKVAESSFVVVML  74



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   382 bits (982),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 232/389 (60%), Positives = 274/389 (70%), Gaps = 13/389 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKI VKTLKGTHF+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1     MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN VAE++F VV+M      S  G++++ A       A   ++S  P       P     
Sbjct  61    ENNVAEDSF-VVIMLSKNKVSSSGASTAAAAPPNPVTAPQPASSVPPTSSTPEPPTSAVG  119

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
                           PTA    VYGQAASNL+AG+N++  +QQIL+MGGG+WDR+TV+RAL
Sbjct  120   QGASNSEQSPVITPPTAAVSSVYGQAASNLIAGSNVDPTVQQILEMGGGSWDRDTVIRAL  179

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE A+VP              QA  P        VP+  PN 
Sbjct  180   RAAYNNPERAVEYLYSGIPEQADVP-----AVARSPSVGQAENPSVRPPQPAVPTGGPNT  234

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPL+LFPQG+PN+ + +  G   L+FLRN+QQFQALRAMVQANPQILQPMLQELGKQNPH
Sbjct  235   NPLNLFPQGIPNMGAEDNAG--DLDFLRNNQQFQALRAMVQANPQILQPMLQELGKQNPH  292

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             LM+LIQEHQ+DFL LINEP EG E      LAA M QA+ VTPEE EAI+RLE MGFDR 
Sbjct  293   LMQLIQEHQSDFLNLINEP-EGEE----NPLAAGMTQAITVTPEEDEAIQRLEDMGFDRD  347

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
             LVLEVF ACN+NE+LAANYLLDH +EF+D
Sbjct  348   LVLEVFIACNRNEDLAANYLLDHQNEFDD  376



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   383 bits (983),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 229/249 (92%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  149   DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSGIPE  208

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEVPP  G  PP  Q  NQ AQPQ AAQPAPVP+  PNA+PL+LFPQGLP++  SN GG
Sbjct  209   TAEVPPV-GGSPPSAQAGNQPAQPQPAAQPAPVPAGGPNADPLNLFPQGLPSM-GSNTGG  266

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  267   ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  326

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYL
Sbjct  327   EGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYL  386

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  387   LDHMHEFEE  395


 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 229/249 (92%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  131   DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSGIPE  190

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEVPP  G  PP  Q  NQ AQPQ AAQPAPVP+  PNA+PL+LFPQGLP++  SN GG
Sbjct  191   TAEVPPV-GGSPPSAQAGNQPAQPQPAAQPAPVPAGGPNADPLNLFPQGLPSM-GSNTGG  248

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  249   ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  308

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYL
Sbjct  309   EGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYL  368

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  369   LDHMHEFEE  377


 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  154   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  213

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  214   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  271

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  272   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  331

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  332   EGGEGNILGQLAGTMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  391

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  392   LDHMHEFDE  400


 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  136   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  195

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  196   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  253

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  254   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  313

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  314   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  373

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  374   LDHMHEFDE  382


 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  152   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  211

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  212   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  268

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  269   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  328

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  329   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  388

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  389   LDHMHEFED  397


 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  155   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  214

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  215   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  272

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  273   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  332

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  333   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  392

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  393   LDHMHEFDE  401


 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  137   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  196

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  197   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  254

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  255   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  314

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  315   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  374

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  375   LDHMHEFDE  383


 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  158   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  217

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  218   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  274

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  275   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  334

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  335   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  394

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  395   LDHMHEFED  403


 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 224/249 (90%), Gaps = 1/249 (0%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG++LEGAIQQILDMGGGTWDR+ VVRALRAAYNNPERAVEYLYSGIPE
Sbjct  138   DVYGQAASNLVAGSHLEGAIQQILDMGGGTWDRDIVVRALRAAYNNPERAVEYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP     P V Q  N  AQPQQ AQ +PVP+S PNANPLDLFPQGLPN+ +    G
Sbjct  198   QAEVPPV-ARAPVVGQATNPPAQPQQPAQASPVPTSGPNANPLDLFPQGLPNMGAGGGAG  256

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP 
Sbjct  257   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPA  316

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYL
Sbjct  317   EGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYL  376

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  377   LDHMHEFED  385


 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  151   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  210

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  211   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  267

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  268   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  327

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  328   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  387

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  388   LDHMHEFED  396


 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  217   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  273

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  274   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  333

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  334   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  393

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  394   LDHMHEFED  402


 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   382 bits (980),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 216/249 (87%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQI+DMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  173   DVYGQAASNLVAGSNLEATVQQIIDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPE  232

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+VPPA   P       + A  P   A     P+  PN NPLDLFPQGLPN+  SNAG 
Sbjct  233   QADVPPAAQVPAGGRATNSPAINPPVQAPQPAPPTGGPNENPLDLFPQGLPNV-GSNAG-  290

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  291   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  350

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYL
Sbjct  351   EGGEGNLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYL  410

Query  1379  LDHMHEFED  1405
             LDHMHEF+D
Sbjct  411   LDHMHEFDD  419


 Score =   131 bits (330),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN+F+V+M+
Sbjct  61   ENKVVENSFIVIMI  74



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   383 bits (983),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  223   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  282

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  283   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  340

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  341   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  400

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  401   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  460

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  461   LDHMHEFDE  469


 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   383 bits (983),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  222   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  281

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  282   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  339

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  340   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  399

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  400   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  459

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  460   LDHMHEFDE  468


 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 209/249 (84%), Positives = 222/249 (89%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  146   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  205

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP     P   QP N  A   QAAQPA VPSS PNANPLDLFPQGLPN+  S A G
Sbjct  206   QAEAPPVT-REPASAQPANPPAAAPQAAQPASVPSSGPNANPLDLFPQGLPNV-GSGAAG  263

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  264   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  323

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA++MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  324   EGGEGNILGQLASAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  383

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  384   LDHMHEFDE  392


 Score =   131 bits (330),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  156   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  215

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  216   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  272

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  273   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  332

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  333   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  392

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  393   LDHMHEFED  401


 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 215/250 (86%), Positives = 230/250 (92%), Gaps = 3/250 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS+LVAGNNL+GAIQQILDMGGGTWDRETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  151   DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYSGIPE  210

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEVPP  G  PP +Q  NQ AQPQ AAQPAPVP+  PNA+PL+LFPQGLP++  SN  G
Sbjct  211   AAEVPPV-GGSPPSVQAGNQPAQPQPAAQPAPVPAGGPNADPLNLFPQGLPSV-GSNTAG  268

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  269   ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  328

Query  1199  EGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  329   EGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  388

Query  1376  LLDHMHEFED  1405
             LLDHMHEFE+
Sbjct  389   LLDHMHEFEE  398


 Score =   139 bits (351),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  155   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  214

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  215   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  271

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  272   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  331

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  332   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  391

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  392   LDHMHEFED  400


 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 207/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  170   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  229

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  230   QAEAPPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  287

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  288   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  347

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  348   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  407

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  408   LDHMHEFDE  416


 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   379 bits (972),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 223/397 (56%), Positives = 271/397 (68%), Gaps = 15/397 (4%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG  FEI+ +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1     MKLSVKTLKGNRFEIDAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  419   ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
             +N++ EN F VV++     SS+   S++S+A+T      S+  A  +     AS     P
Sbjct  61    DNQITENGFLVVMLTKTKTSSAAGASSTSSASTIQHTQTSTPLAPASNPVEAASPVVSQP  120

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
              +     +  AP       + D YG+AAS LVAG+NLE  IQQ+LDMGGG+WDR+TVVRA
Sbjct  121   PAVAPATSVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  776   LRAAYNNPERAVEYLYSGIPESAEV-------PPAEGnpppvlqppnqaaqpqqaaqpap  934
             LRAAYNNPERAVEYLYSGIPE+AE+       PP+             AA+   A    P
Sbjct  181   LRAAYNNPERAVEYLYSGIPETAEIAVPVARSPPSNSGAAGQGTNDVVAAESDLAQATVP  240

Query  935   vpssapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQ  1114
                        +LFPQGLPN+ ++  GGA  L+FLRN+ QFQALR MVQANPQILQPMLQ
Sbjct  241   SGGPNAAPL--NLFPQGLPNLGATAGGGA--LDFLRNNPQFQALRTMVQANPQILQPMLQ  296

Query  1115  ELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERL  1294
             EL KQNP LMRLIQ+HQA+FL LINE  EG   ++LGQ AA MPQ++ VTPEEREAIERL
Sbjct  297   ELSKQNPQLMRLIQDHQAEFLHLINEETEG---DLLGQFAAEMPQSINVTPEEREAIERL  353

Query  1295  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             EAMGFDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  354   EAMGFDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 214/250 (86%), Positives = 230/250 (92%), Gaps = 3/250 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS+LVAGNNL+GAIQQILDMGGGTWDRETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  162   DVYGQAASSLVAGNNLDGAIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYSGIPE  221

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEVPP  G  PP +Q  NQ AQPQ AAQPAPVP+  PNA+PL+LFPQGLP++  SN  G
Sbjct  222   AAEVPPV-GGSPPSVQAGNQPAQPQPAAQPAPVPAGGPNADPLNLFPQGLPSV-GSNTAG  279

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  280   ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  339

Query  1199  EGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EGGEG N+LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  340   EGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  399

Query  1376  LLDHMHEFED  1405
             LLDH+HEFE+
Sbjct  400   LLDHIHEFEE  409


 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE+NF+V+M+
Sbjct  61   ENKVAESNFIVIML  74



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   378 bits (970),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/249 (78%), Positives = 209/249 (84%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLVAGNNLEG IQQILDMGGGTWDR++VVRALRAA+NNPERAVEYLYSGIPE
Sbjct  143   DVYSQAASNLVAGNNLEGTIQQILDMGGGTWDRDSVVRALRAAFNNPERAVEYLYSGIPE  202

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE+PPA G+          A    Q   P P      N    +LFPQGLPN+ S+  GG
Sbjct  203   SAELPPAPGSGAGQQAAAAAAPPQAQPPVPIPSAGPNANPL--NLFPQGLPNLGSNVGGG  260

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTLEFLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPV
Sbjct  261   ANTLEFLRNTPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPV  320

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEG++LGQLA  MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYL
Sbjct  321   EGGEGDLLGQLAGGMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYL  380

Query  1379  LDHMHEFED  1405
             LDH HEFED
Sbjct  381   LDHGHEFED  389


 Score =   119 bits (299),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 2/74 (3%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV+DVK  IET QG   YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIHQGKVLKDATTLE  58

Query  419  ENKVAENNFVVVMM  460
            EN VAE +FVV+M+
Sbjct  59   ENNVAEKSFVVIML  72



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   377 bits (969),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 209/249 (84%), Positives = 222/249 (89%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  138   DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP     P V Q  N A QPQQ AQ A +P+S PNANPLDLFPQGLPN+ +S AG 
Sbjct  198   QAEAPPV-ARAPVVGQTTNPAEQPQQPAQTAAIPTSGPNANPLDLFPQGLPNMGASGAG-  255

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP 
Sbjct  256   AGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPA  315

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYL
Sbjct  316   EGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYL  375

Query  1379  LDHMHEFED  1405
             LDHMH+F+D
Sbjct  376   LDHMHDFQD  384


 Score =   119 bits (298),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFVVVMM  460
            E+ V EN+F+V+M+
Sbjct  61   ESSVTENSFIVIML  74



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   377 bits (968),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 212/249 (85%), Positives = 223/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  136   DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  195

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP     P V Q  N AAQPQQ AQ A VP+S PNANPLDLFPQGLPN+ +S AG 
Sbjct  196   QAEAPPV-ARAPVVGQTTNPAAQPQQPAQTAAVPTSGPNANPLDLFPQGLPNMGASGAG-  253

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP 
Sbjct  254   AGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPA  313

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYL
Sbjct  314   EGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYL  373

Query  1379  LDHMHEFED  1405
             LDHMH+F+D
Sbjct  374   LDHMHDFQD  382


 Score =   122 bits (305),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   377 bits (968),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 212/249 (85%), Positives = 223/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLEG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  138   DVYGQAASNLVAGSNLEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP     P V Q  N AAQPQQ AQ A VP+S PNANPLDLFPQGLPN+ +S AG 
Sbjct  198   QAEAPPV-ARAPVVGQTTNPAAQPQQPAQTAAVPTSGPNANPLDLFPQGLPNMGASGAG-  255

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP 
Sbjct  256   AGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPA  315

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYL
Sbjct  316   EGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYL  375

Query  1379  LDHMHEFED  1405
             LDHMH+F+D
Sbjct  376   LDHMHDFQD  384


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  61   ENSVTENSFIVIML  74



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 206/249 (83%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVR LRAAYNNPERAVEYLYSGIPE
Sbjct  136   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRTLRAAYNNPERAVEYLYSGIPE  195

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE  P  G P         A  PQ A   +   S        DLFPQGLPN+  S A G
Sbjct  196   QAEALPVTGVPASAQPSNPPADTPQAAQPASVPSSGPNANPL-DLFPQGLPNV-GSGAAG  253

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  254   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPV  313

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYL
Sbjct  314   EGGEGNILGQLAGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYL  373

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  374   LDHMHEFDE  382


 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE++F+V+M+
Sbjct  61   ENKVAESSFIVIML  74



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 214/250 (86%), Positives = 229/250 (92%), Gaps = 3/250 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  148   DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSGIPE  207

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEVPP  G  PP  Q  NQ AQPQ AAQPAPVP+  PNA+PL+LFPQGLP++  SN GG
Sbjct  208   TAEVPPV-GGSPPSAQAGNQPAQPQPAAQPAPVPAGGPNADPLNLFPQGLPSL-GSNTGG  265

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  266   ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  325

Query  1199  E-GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             E GGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  326   EGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  385

Query  1376  LLDHMHEFED  1405
             LLDH+HEFE+
Sbjct  386   LLDHIHEFEE  395


 Score =   141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 204/246 (83%), Positives = 214/246 (87%), Gaps = 3/246 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYGQAAS+LVAG+NLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSGIPE 
Sbjct  91    VYGQAASSLVAGSNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSGIPEQ  150

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AE PP      P+      A   Q   Q A VPS  PNANPLDLFPQGLPN+  S AGGA
Sbjct  151   AEAPPV--AHMPLGGQAPAAQPQQHPTQTAAVPSGGPNANPLDLFPQGLPNV-GSGAGGA  207

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE
Sbjct  208   GTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVE  267

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
              GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL
Sbjct  268   SGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  327

Query  1382  DHMHEF  1399
             DHMHEF
Sbjct  328   DHMHEF  333


 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 206/250 (82%), Positives = 216/250 (86%), Gaps = 4/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIPSSNAG  1015
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQ GLPN+  SNAG
Sbjct  217   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQQGLPNM-GSNAG  274

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
              A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  275   -AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  333

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  334   VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  393

Query  1376  LLDHMHEFED  1405
             LLDHMHEFED
Sbjct  394   LLDHMHEFED  403


 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 216/249 (87%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  152   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  211

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  212   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  268

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  269   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  328

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  329   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  388

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  389   LDHMHEFED  397


 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   375 bits (963),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 214/250 (86%), Positives = 229/250 (92%), Gaps = 3/250 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAAS+LVAGNNL+GAIQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  130   DVYGQAASSLVAGNNLDGAIQQILDMGGGMWDRDTVVRALRAAFNNPERAVEYLYSGIPE  189

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEVPP  G  PP  Q  NQ AQPQ AAQPAPVP+  PNA+PL+LFPQGLP++  SN GG
Sbjct  190   TAEVPPV-GGSPPSAQAGNQPAQPQPAAQPAPVPAGGPNADPLNLFPQGLPSL-GSNTGG  247

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             ANTL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  248   ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  307

Query  1199  E-GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             E GGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  308   EGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  367

Query  1376  LLDHMHEFED  1405
             LLDH+HEFE+
Sbjct  368   LLDHIHEFEE  377


 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAENNF+V+M+
Sbjct  61   ENKVAENNFIVIML  74



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   376 bits (965),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 223/252 (88%), Gaps = 4/252 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  159   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  218

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP         Q  NQ AQPQQ AQPA VPS  PNANPLDLFPQGLPN+ S  AG 
Sbjct  219   QAEVPPV-APVSLSGQAANQPAQPQQPAQPAAVPSGGPNANPLDLFPQGLPNMGSGGAGA  277

Query  1019  AN---TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLIN  1189
                  TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLIN
Sbjct  278   GAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQTDFLRLIN  337

Query  1190  EPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  1369
             EPVEGGEGNI+GQLAA+MPQAV VTPEEREAIERLEAMGFDR LVLEVFFACNKNEELAA
Sbjct  338   EPVEGGEGNIMGQLAAAMPQAVTVTPEEREAIERLEAMGFDRGLVLEVFFACNKNEELAA  397

Query  1370  NYLLDHMHEFED  1405
             NYLLDHMHEFED
Sbjct  398   NYLLDHMHEFED  409


 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+QGKVLKD TT++
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIYQGKVLKDNTTID  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   375 bits (963),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 206/250 (82%), Positives = 216/250 (86%), Gaps = 4/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  155   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  214

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIPSSNAG  1015
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQ GLPN+  SNAG
Sbjct  215   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQQGLPNM-GSNAG  272

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
              A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  273   -AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEP  331

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             VEGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  332   VEGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  391

Query  1376  LLDHMHEFED  1405
             LLDHMHEFED
Sbjct  392   LLDHMHEFED  401


 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   375 bits (962),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 219/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+GIPE
Sbjct  155   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTGIPE  214

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE P      P   QP N  A   Q AQPA V S+ PNANPLDLFPQGLPN+  S A G
Sbjct  215   QAEAPLV-ARAPVSAQPTNPPADAPQTAQPAAVTSAGPNANPLDLFPQGLPNV-GSGAAG  272

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP 
Sbjct  273   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPA  332

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQ+A+ MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  333   EGGEGNILGQMASGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  392

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  393   LDHMHEFEE  401


 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDATTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN F+V+M+
Sbjct  61   ENKVAENTFIVIML  74



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 230/393 (59%), Positives = 271/393 (69%), Gaps = 13/393 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1     MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  419   ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
             EN+V ENNF V+++     SSS   + +S           +T A   P    A AP    
Sbjct  61    ENQVLENNFLVIMLRQNKASSSAPPAKASANQAPPTQTVPATPAPQTPVAPAAPAPTVPV  120

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
             ++      A        +   D YGQAASNLVAG NLEG IQ IL+MGGGTWDR+TV+RA
Sbjct  121   SAPAPTATASPAPAVAVSTEADSYGQAASNLVAGGNLEGTIQSILEMGGGTWDRDTVLRA  180

Query  776   LRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapn  955
             L+AAYNNPERAVEYLYSGIP+  +VP       P                 A VPSS PN
Sbjct  181   LQAAYNNPERAVEYLYSGIPDQMDVP------APPPSSQAANPVQPSQPAQAAVPSSGPN  234

Query  956   anplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNP  1135
              NPLDLFPQ LPN  S+NAG  N L+ LRN+ QFQ L ++VQANPQILQP+LQELGKQNP
Sbjct  235   VNPLDLFPQALPNA-SANAGAGN-LDVLRNNAQFQTLLSLVQANPQILQPLLQELGKQNP  292

Query  1136  HLMRLIQEHQADFLRLINEPVEG---GEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  1306
              +M+LIQE+QA+F+RLINEP+EG    E N+L Q+A +  + + VTPEE EAI RLE MG
Sbjct  293   QVMQLIQENQAEFMRLINEPLEGDEENEMNMLDQIADAA-ETIAVTPEENEAILRLEGMG  351

Query  1307  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             FDRALVLEVFFACNKNE+LAANYLLDHMHEF++
Sbjct  352   FDRALVLEVFFACNKNEQLAANYLLDHMHEFDN  384



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 229/397 (58%), Positives = 274/397 (69%), Gaps = 15/397 (4%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG  FEIE +P DTV  VKK IE +QG + YP  Q +LIHQGKVLKD TT+E
Sbjct  1     MKLSVKTLKGNRFEIEAQPNDTVMAVKKQIEEIQGKDTYPCGQQLLIHQGKVLKDDTTIE  60

Query  419   ENKVAENNF-VVVMMaktksssgegsasstattktiapasstsastapapvpasapapvp  595
             +N + EN F VV++     SS+   S++STA+T      S+  A  +     AS      
Sbjct  61    DNTITENGFLVVMLTKSKTSSAVGASSTSTASTVQPTQTSTPPAPASNPVEVASPVVSQL  120

Query  596   asapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRA  775
              +     +  AP       + D YG+AAS LVAG+NLE  IQQ+LDMGGG+WDR+TVVRA
Sbjct  121   PAVAPAASVSAPETTAVQANADPYGEAASILVAGSNLEQTIQQMLDMGGGSWDRDTVVRA  180

Query  776   LRAAYNNPERAVEYLYSGIPESAEV-------PPAEGnpppvlqppnqaaqpqqaaqpap  934
             LRAAYNNPERAVEYLYSGIPE+AE+       PP+   P    Q  N     +  +  A 
Sbjct  181   LRAAYNNPERAVEYLYSGIPETAEIAVPVARSPPSN--PGATDQGTNNVIAGESDSAEAT  238

Query  935   vpssapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQ  1114
              PS  PNA PL+LFPQGLPN+    A G   L+FLRN+ QFQALR MVQANPQILQPMLQ
Sbjct  239   APSGGPNAAPLNLFPQGLPNL--GAAAGGGALDFLRNNPQFQALRTMVQANPQILQPMLQ  296

Query  1115  ELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERL  1294
             EL KQNP LMRLIQ+HQA+FL LINE  +G   ++LGQ AA MPQ++ VTPEEREAIERL
Sbjct  297   ELSKQNPQLMRLIQDHQAEFLHLINEETDG---DLLGQFAAEMPQSINVTPEEREAIERL  353

Query  1295  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             EAMGFDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  354   EAMGFDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   373 bits (957),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 220/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+GIPE
Sbjct  161   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTGIPE  220

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE P      P   QP N  A   Q AQPAPV S+ PNANPLDLFPQGLPN+  S A G
Sbjct  221   QAEAP-LVAQVPASAQPTNPPADAPQTAQPAPVTSAGPNANPLDLFPQGLPNV-GSGAAG  278

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP 
Sbjct  279   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPA  338

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  339   EGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  398

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  399   LDHMHEFEE  407


 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   372 bits (954),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 212/246 (86%), Gaps = 3/246 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VY QAAS+LVAGNNLE A+QQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSGIPE 
Sbjct  136   VYDQAASSLVAGNNLEVAVQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSGIPEQ  195

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AE PP      P+ +    A   Q   Q A VPS  PNANPLDLFPQGLP I  S AGGA
Sbjct  196   AEAPPV--AQIPIGRQAPAAQPQQHPTQTAAVPSGGPNANPLDLFPQGLP-IVGSGAGGA  252

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMR IQEHQ DFLRLINEPVE
Sbjct  253   GTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRFIQEHQDDFLRLINEPVE  312

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
              GEGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL
Sbjct  313   SGEGNVLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  372

Query  1382  DHMHEF  1399
             DHMHEF
Sbjct  373   DHMHEF  378


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENK+ EN+FVV+M+
Sbjct  61   ENKIVENSFVVIML  74



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   373 bits (957),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 220/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLEG IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+GIPE
Sbjct  163   DIYGQAASNLVAGSNLEGTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTGIPE  222

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE P      P   QP N  A   Q AQPAPV S+ PNANPLDLFPQGLPN+  S A G
Sbjct  223   QAEAP-LVAQVPASAQPTNPPADAPQTAQPAPVTSAGPNANPLDLFPQGLPNV-GSGAAG  280

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP 
Sbjct  281   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPA  340

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGNILGQ+A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  341   EGAEGNILGQMASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  400

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  401   LDHMHEFEE  409


 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN F+V+M+
Sbjct  61   ENKVVENTFIVIML  74



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   372 bits (955),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 203/256 (79%), Positives = 219/256 (86%), Gaps = 8/256 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLEG IQ+IL+MGGGTWDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  147   DVYGQAASNLVAGSNLEGTIQEILEMGGGTWDRDTVVRALRAAFNNPERAVEYLYSGIPP  206

Query  839   SAEVPPA-------EGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNI  997
              AEVP A       +   PP          P   + P  VPSS PNANPLDLFPQGLP++
Sbjct  207   QAEVPSAARVPPGAQAANPPAQPAQPAQPAPVPLSGPNAVPSSGPNANPLDLFPQGLPSV  266

Query  998   PSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL  1177
               S A GA TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL
Sbjct  267   -GSGAAGAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL  325

Query  1178  RLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNE  1357
             RLINEP+EGGEGNILGQLA+SMPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNE
Sbjct  326   RLINEPLEGGEGNILGQLASSMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNE  385

Query  1358  ELAANYLLDHMHEFED  1405
             ELAANYLLDH+HE+ED
Sbjct  386   ELAANYLLDHIHEYED  401


 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENK+ E +F+V+M+
Sbjct  61   ENKIVEGSFIVIML  74



>ref|XP_012077957.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Jatropha 
curcas]
Length=382

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 214/249 (86%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLE  IQQILDMGGG+W RETVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  141   DVYGQAASNLVAGNNLEATIQQILDMGGGSWTRETVVRALRAAYNNPERAVEYLYSGIPE  200

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEV P       +         P Q  QPA   S+ PNANPLDLFPQGLPN+ S+ + G
Sbjct  201   QAEVQPV----AQIPASAQATNPPAQVGQPAAPTSAGPNANPLDLFPQGLPNMGSNASAG  256

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  257   --TLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  314

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  315   EG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYL  373

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  374   LDHMHEFEE  382


 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKP++TVADVKK IET QG++VYPA Q MLI+QGKVLKD  TLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPDETVADVKKFIETAQGADVYPAEQQMLIYQGKVLKDSRTLE  60

Query  419  ENKVAENNFVVVMM  460
            E KVAEN+F VVM+
Sbjct  61   EIKVAENSFFVVML  74



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 215/248 (87%), Gaps = 3/248 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYGQAASNLVAGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+GIPE 
Sbjct  108   VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTGIPEQ  167

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AE PP      PV +    A   QQ AQP  VP+  PNANPLDLFPQGLPNI  S A  A
Sbjct  168   AEAPPV--AQVPVSEQAPAAQPRQQPAQPTTVPAGGPNANPLDLFPQGLPNI-GSGAAEA  224

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE
Sbjct  225   GTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVE  284

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGEGN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLL
Sbjct  285   GGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLL  344

Query  1382  DHMHEFED  1405
             DH+HEFED
Sbjct  345   DHIHEFED  352


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  MLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            MLI+QGKVLKD TTL ENKVAEN+FVV+M+
Sbjct  1    MLIYQGKVLKDDTTLGENKVAENSFVVIML  30



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   370 bits (951),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 215/248 (87%), Gaps = 3/248 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYGQAASNLVAGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+GIPE 
Sbjct  152   VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTGIPEQ  211

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AE PP      PV +    A   QQ AQP  VP+  PNANPLDLFPQGLPNI  S A  A
Sbjct  212   AEAPPV--AQVPVSEQAPAAQPRQQPAQPTTVPAGGPNANPLDLFPQGLPNI-GSGAAEA  268

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE
Sbjct  269   GTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVE  328

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGEGN+ G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLL
Sbjct  329   GGEGNVSGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLL  388

Query  1382  DHMHEFED  1405
             DH+HEFED
Sbjct  389   DHIHEFED  396


 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   369 bits (948),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 203/250 (81%), Positives = 216/250 (86%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  162   DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  221

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP     PP           Q   QPA  P+S PNANPLDLFPQGLPN+ S+   G
Sbjct  222   QAEVPPV--TRPPASGGQPTNPPAQSQQQPAVAPTSGPNANPLDLFPQGLPNVGSNT--G  277

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  278   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  337

Query  1199  EGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EGGE GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  338   EGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  397

Query  1376  LLDHMHEFED  1405
             LLDH+HEF++
Sbjct  398   LLDHIHEFDE  407


 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 213/248 (86%), Gaps = 3/248 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYGQAASNLVAGNNLEGA+QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY+GIPE 
Sbjct  144   VYGQAASNLVAGNNLEGAVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYTGIPEQ  203

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AE PP      PV +        QQ AQP  VP+  PNANPLDLFPQGLPNI S  A   
Sbjct  204   AEAPPV--AQVPVSEQAPATQPRQQPAQPTTVPAGGPNANPLDLFPQGLPNIGSGTAE-V  260

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE
Sbjct  261   GTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVE  320

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGEGNI G LAA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLL
Sbjct  321   GGEGNISGPLAAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLL  380

Query  1382  DHMHEFED  1405
             DH+HEFED
Sbjct  381   DHIHEFED  388


 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 219/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQ ASNLVAG+N EG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  94    DVYGQTASNLVAGSNFEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  153

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+  P   + P V Q  + A  PQQ AQ A +P+S PN+NPLDLFPQGLPN+ +S AG 
Sbjct  154   QADATPV-AHAPVVGQTTSPAEPPQQPAQMAAIPTSGPNSNPLDLFPQGLPNMGASGAG-  211

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP 
Sbjct  212   AGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEPA  271

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYL
Sbjct  272   EGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYL  331

Query  1379  LDHMHEFED  1405
             LDHMH+F+D
Sbjct  332   LDHMHDFQD  340



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 219/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQ ASNLVAG+N EG IQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  138   DVYGQTASNLVAGSNFEGTIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+  P   + P V Q  + A  PQQ AQ A +P+S PN+NPLDLFPQGLPN+ +S AG 
Sbjct  198   QADATPV-AHAPVVGQTTSPAEPPQQPAQMAAIPTSGPNSNPLDLFPQGLPNMGASGAG-  255

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP 
Sbjct  256   AGSLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEPA  315

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYL
Sbjct  316   EGGEGNILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYL  375

Query  1379  LDHMHEFED  1405
             LDHMH+F+D
Sbjct  376   LDHMHDFQD  384


 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI +GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIFKGKVLKDDTTLA  60

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  61   ENSVNENSFIVIML  74



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 203/250 (81%), Positives = 216/250 (86%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  190   DVYGQAASNLVAGSNLEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  249

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP     PP           Q   QPA  P+S PNANPLDLFPQGLPN+ S+   G
Sbjct  250   QAEVPPV--TRPPASGGQPTNPPAQSQQQPAVAPTSGPNANPLDLFPQGLPNVGSNT--G  305

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  306   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  365

Query  1199  EGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EGGE GNI+ QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  366   EGGEGGNIINQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  425

Query  1376  LLDHMHEFED  1405
             LLDH+HEF++
Sbjct  426   LLDHIHEFDE  435


 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_008650775.1| PREDICTED: uncharacterized protein LOC100191313 isoform X1 [Zea 
mays]
 gb|ACF84200.1| unknown [Zea mays]
 gb|ACG34516.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA61376.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=386

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 227/391 (58%), Positives = 269/391 (69%), Gaps = 16/391 (4%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1     MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61    ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121   APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE  EVP            P  ++QP    Q      + PNA
Sbjct  181   RAAYNNPERAVEYLYSGIPEQMEVP-----------APPPSSQPVDPVQAVQPAQAGPNA  229

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQ LPN  S+NA   N L+ LRN+ QFQ L  +VQANPQILQP+LQEL KQNP 
Sbjct  230   NPLDLFPQSLPND-SANANTGN-LDVLRNNSQFQNLLGLVQANPQILQPLLQELRKQNPR  287

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             +M+LIQE+QA+F+RLI+EP+EG E N  +L Q+A +  + + VTPEE EAI RLE MGFD
Sbjct  288   VMQLIQENQAEFMRLISEPLEGDEENEMMLDQMADAT-ETIAVTPEENEAILRLEGMGFD  346

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALVLEVFFACNKNE+LAANYLLDHMHEF++
Sbjct  347   RALVLEVFFACNKNEQLAANYLLDHMHEFDN  377



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   367 bits (943),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 222/249 (89%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  153   DVYGQAASNLVAGSNLEETVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPE  212

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE P A    P   QP N AA   QAAQPAPV SS PNANPLDLFPQGLPNI  S A G
Sbjct  213   QAEAP-AASRVPASAQPANPAAAAPQAAQPAPVTSSGPNANPLDLFPQGLPNI-GSGAAG  270

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP+
Sbjct  271   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPM  330

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQ+A  MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  331   EGGEGNLLGQMAGGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  390

Query  1379  LDHMHEFED  1405
             LDH+HEF++
Sbjct  391   LDHIHEFDE  399


 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIHQGKVLKDGT+LE
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIHQGKVLKDGTSLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 212/249 (85%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  217   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  273

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQ    ELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  274   AGTLDFLRNSQQFQALRTMVQANPQILQ----ELGKQNPHLMRLIQEHQTDFLRLINEPV  329

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  330   EGGEGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  389

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  390   LDHMHEFED  398


 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 210/249 (84%), Gaps = 2/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDRETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  145   DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVVRALRAAFNNPERAVEYLYSGIPE  204

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PPA   P         AA P   A     P+  PNANPLDLFPQGLPN+  +NAG 
Sbjct  205   QAEAPPAAQVPAGEQAANPPAANPPAQAPQPIAPTGGPNANPLDLFPQGLPNM-GANAGA  263

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPV
Sbjct  264   GN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPV  322

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYL
Sbjct  323   EGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYL  382

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  383   LDHMHEFEE  391


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK++VKTLKGT+FEIEVK E+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            +N VAEN+F+V+M+
Sbjct  61   QNNVAENSFIVIML  74



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   366 bits (939),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 214/392 (55%), Positives = 267/392 (68%), Gaps = 7/392 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1     MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMa--ktksssgegsasstattktiapasstsastapapvpasapapv  592
             ENKV EN+F+V+M+   K  SSS   ++ + +           + ++     PA+     
Sbjct  61    ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  593   pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  772
              ++      A        +   D YGQA SNLVAG+NLE  IQ IL+MGGG WDR+ V+ 
Sbjct  121   VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  773   ALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssap  952
             AL AA+NNPERAVEYLYSG+PE  ++P     PP +       A          + SS P
Sbjct  181   ALSAAFNNPERAVEYLYSGVPEQMDIP---VPPPSIQPANPTQASQATQPAAPSILSSGP  237

Query  953   nanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  1132
             NA+PLDLFPQ LPN  S++A G   L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQN
Sbjct  238   NASPLDLFPQALPNA-STDAAGLGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQN  296

Query  1133  PHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGF  1309
             P +++LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLEAMGF
Sbjct  297   PQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEENEAILRLEAMGF  356

Query  1310  DRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             DRALVL+VFFACNK+E+LAANYLLDHM+EF+D
Sbjct  357   DRALVLDVFFACNKDEQLAANYLLDHMNEFDD  388



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   365 bits (937),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 199/250 (80%), Positives = 212/250 (85%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  138   DIYGQAASNLVAGSNLEATIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP      P           Q   QPA  P+S PNANPLDLFPQGLPN+ S+   G
Sbjct  198   QAEVPPV--AQAPASGGQPTNPPAQAGQQPAAAPTSGPNANPLDLFPQGLPNVGSNT--G  253

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  254   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  313

Query  1199  EGGE-GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EGGE GNI  QL  +MPQA+QVTPEEREAIERLEAMGF+R LVLEVFFACNKNEELAANY
Sbjct  314   EGGEGGNISSQLGGAMPQAIQVTPEEREAIERLEAMGFERGLVLEVFFACNKNEELAANY  373

Query  1376  LLDHMHEFED  1405
             LLDHMHEF++
Sbjct  374   LLDHMHEFDE  383


 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIHQGKVL+D TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIHQGKVLRDETTME  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAE +F+V+M+
Sbjct  61   ENKVAEKSFIVIML  74



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 214/248 (86%), Gaps = 2/248 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE 
Sbjct  145   VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPEQ  204

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AEV P     P   Q  N   Q  Q  QPAPV SS PNANPLDLFPQGLP++  S A GA
Sbjct  205   AEVQPV-ARAPGNGQAANSPTQMPQPTQPAPVTSSGPNANPLDLFPQGLPDV-GSGAAGA  262

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+
Sbjct  263   GSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ  322

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLL
Sbjct  323   GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL  382

Query  1382  DHMHEFED  1405
             DHMHEFED
Sbjct  383   DHMHEFED  390


 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   365 bits (937),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 200/253 (79%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVVRALRAA+NNPERAVEYLY+GIPE
Sbjct  170   DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYTGIPE  229

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A    Q  QPA  P+S PNANPLDLFPQGLPN+      G
Sbjct  230   QAEVPPV---ARAPASFGQPANPSAQTQQPAAAPASGPNANPLDLFPQGLPNV--GGNPG  284

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  285   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  344

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LGQ+AA M  PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA
Sbjct  345   EGGGESGNLLGQMAAGMPQPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  404

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  405   ANYLLDHMHEFEE  417


 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVK ED+VADVKK+IETVQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+VVM+
Sbjct  61   ENKVAENSFIVVML  74



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 206/277 (74%), Positives = 216/277 (78%), Gaps = 31/277 (11%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  217   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  273

Query  1019  ANTLEFLRNSQQ----------------------------FQALRAMVQANPQILQPMLQ  1114
             A TL+FLRNSQQ                            FQALR MVQANPQILQPMLQ
Sbjct  274   AGTLDFLRNSQQVSMMFYLFASLLFICDVFWYSYFRLLFQFQALRTMVQANPQILQPMLQ  333

Query  1115  ELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERL  1294
             ELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQLA++MPQAV VTPEEREAIERL
Sbjct  334   ELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQLASAMPQAVTVTPEEREAIERL  393

Query  1295  EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  394   EAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  430


 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 214/248 (86%), Gaps = 2/248 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE 
Sbjct  122   VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPEQ  181

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AEV P     P   Q  N   Q  Q  QPAPV SS PNANPLDLFPQGLP++  S A GA
Sbjct  182   AEVQPV-ARAPGNGQAANSPTQMPQPTQPAPVTSSGPNANPLDLFPQGLPDV-GSGAAGA  239

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+
Sbjct  240   GSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ  299

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLL
Sbjct  300   GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL  359

Query  1382  DHMHEFED  1405
             DHMHEFED
Sbjct  360   DHMHEFED  367


 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  305  VADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            V DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLEENKVAEN+FVV+M+
Sbjct  1    VFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLEENKVAENSFVVIML  52



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 214/248 (86%), Gaps = 2/248 (1%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VYG AASNLVAGNNLEGAIQQILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE 
Sbjct  145   VYGHAASNLVAGNNLEGAIQQILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPEQ  204

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AEV P     P   Q  N   Q  Q  QPAPV SS PNANPLDLFPQGLP++  S A GA
Sbjct  205   AEVQPV-ARAPGNGQAANSPTQMPQPTQPAPVTSSGPNANPLDLFPQGLPDV-GSGAAGA  262

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              +L+FLRNS QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+
Sbjct  263   GSLDFLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQ  322

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGEGN+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLL
Sbjct  323   GGEGNLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLL  382

Query  1382  DHMHEFED  1405
             DHMHEFED
Sbjct  383   DHMHEFED  390


 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  62   ENKVAENSFVVIML  75



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 213/392 (54%), Positives = 265/392 (68%), Gaps = 7/392 (2%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1     MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  419   ENKVAENNFVVVMMa--ktksssgegsasstattktiapasstsastapapvpasapapv  592
             ENKV EN+F+V+M+   K  SSS   ++ + +           + ++     PA+     
Sbjct  61    ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT  120

Query  593   pasapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVR  772
              ++      A        +   D YGQA SNLVAG+NLE  IQ IL+MGGG WDR+ V+ 
Sbjct  121   VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH  180

Query  773   ALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssap  952
             AL AA+NNPERAVEYLYSG+PE  ++P     PP +       A          + SS P
Sbjct  181   ALSAAFNNPERAVEYLYSGVPEQMDIP---VPPPSIQPANPTQASQATQPAAPSILSSGP  237

Query  953   nanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQN  1132
             NA+PLDLFPQ LPN  S++A G   L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQN
Sbjct  238   NASPLDLFPQALPNA-STDAAGLGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQN  296

Query  1133  PHLMRLIQEHQADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGF  1309
             P +++LIQE+QA+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLE MGF
Sbjct  297   PQILQLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEEDEAILRLEPMGF  356

Query  1310  DRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             DRALVL+VFFACNK+E+LAANYLLDHM+EF D
Sbjct  357   DRALVLDVFFACNKDEQLAANYLLDHMNEFAD  388



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   362 bits (930),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 216/249 (87%), Gaps = 1/249 (0%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYG AASNLVAG+NLEG IQQI+DMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  154   DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  213

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE P     P         AA   Q AQPAPV S+ PNANPLDLFPQGLPN+  + A G
Sbjct  214   QAEAPAVARAPAGAQPANPPAAAAPQTAQPAPVTSTGPNANPLDLFPQGLPNV-GAGAAG  272

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPV
Sbjct  273   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPV  332

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  333   EGGEGNILGQLAGGMPQAVSVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  392

Query  1379  LDHMHEFED  1405
             LDH+HEF++
Sbjct  393   LDHIHEFDE  401


 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74



>ref|XP_007135849.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
 gb|ESW07843.1| hypothetical protein PHAVU_010G163300g [Phaseolus vulgaris]
Length=371

 Score =   361 bits (927),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 206/389 (53%), Positives = 263/389 (68%), Gaps = 18/389 (5%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1     MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             +NKV+E+ F+VVM++K+K+S    + S    +   +  S+++ + A  P   +       
Sbjct  61    DNKVSEDGFLVVMLSKSKASGSAAAPSVQPASTPASTVSTSNTNPASDPPVQTQAVNNIT  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             S                   D YGQAASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  121   STTDAPTTNVSA--------DTYGQAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVTRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERA++YLYSGIPE+AEV          +     +   + A   +      PN+
Sbjct  173   RAAYNNPERAIDYLYSGIPEAAEV-------AVPVPNYPGSQTTETAGISSGAVPVGPNS  225

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PL++FPQ      SS   G  +L+FLRN+ QFQALR+MVQ+NPQILQP+LQELGKQNP 
Sbjct  226   SPLNMFPQ---EAISSTGAGLGSLDFLRNNPQFQALRSMVQSNPQILQPVLQELGKQNPS  282

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             L+RLIQEH  +FL+LINEP+EG EG+I  Q    MP A+ VTP E+EAI RLEAMGFDRA
Sbjct  283   LLRLIQEHHGEFLQLINEPIEGSEGDIFDQPEQDMPHAINVTPAEQEAIGRLEAMGFDRA  342

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
              V+E F AC+++E+LAANYLL++  +FED
Sbjct  343   SVIEAFLACDRDEQLAANYLLENAGDFED  371



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   362 bits (929),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 208/250 (83%), Gaps = 9/250 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  158   DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSGIPE  217

Query  839   SAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAG  1015
              AEVPP A+G    V   P   AQ   A       ++       DLFPQGLP+   SNAG
Sbjct  218   QAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANPL-----DLFPQGLPST-GSNAG  271

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
               N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  272   AGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  330

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  331   VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  389

Query  1376  LLDHMHEFED  1405
             LLDHMHEF++
Sbjct  390   LLDHMHEFDE  399


 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 208/250 (83%), Gaps = 9/250 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  158   DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSGIPE  217

Query  839   SAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAG  1015
              AEVPP A+G    V   P   AQ   A       ++       DLFPQGLP+   SNAG
Sbjct  218   QAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANPL-----DLFPQGLPST-GSNAG  271

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
               N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  272   AGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  330

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  331   VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  389

Query  1376  LLDHMHEFED  1405
             LLDHMHEF++
Sbjct  390   LLDHMHEFDE  399


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 208/250 (83%), Gaps = 9/250 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  157   DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSGIPE  216

Query  839   SAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAG  1015
              AEVPP A+G    V   P   AQ   A       ++       DLFPQGLP+   SNAG
Sbjct  217   QAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANPL-----DLFPQGLPST-GSNAG  270

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
               N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  271   AGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  329

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  330   VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  388

Query  1376  LLDHMHEFED  1405
             LLDHMHEF++
Sbjct  389   LLDHMHEFDE  398


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 215/249 (86%), Gaps = 1/249 (0%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYG AASNLVAG+NLEG IQQI+DMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  152   DVYGLAASNLVAGSNLEGTIQQIIDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  211

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE P     P         AA   Q  QPAPV S+ PNANPLDLFPQGLPN+  + A G
Sbjct  212   QAEAPVVARAPAGAQPANPPAAAAPQTEQPAPVTSTGPNANPLDLFPQGLPNV-GAGAAG  270

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPV
Sbjct  271   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPV  330

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGNILGQLA  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  331   EGGEGNILGQLAGGMPQAVTVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  390

Query  1379  LDHMHEFED  1405
             LDH+HEF++
Sbjct  391   LDHIHEFDE  399


 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   362 bits (928),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/258 (75%), Positives = 207/258 (80%), Gaps = 19/258 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNL AG+NL+  IQQILDMGGGTWDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  172   DIYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALRAAFNNPERAVEYLYSGIPE  231

Query  839   SAEVP-----PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
              AEVP     PA G  P       Q      A+ P   P         DLFPQGLPN+  
Sbjct  232   QAEVPAVFRAPASGGQPANPPAQTQQPAAAPASGPTANPL--------DLFPQGLPNV--  281

Query  1004  SNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL  1183
                 GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRL
Sbjct  282   GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRL  341

Query  1184  INEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  1351
             INEPVEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNK
Sbjct  342   INEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNK  401

Query  1352  NEELAANYLLDHMHEFED  1405
             NEELAANYLLDHMHEFE+
Sbjct  402   NEELAANYLLDHMHEFEE  419


 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD  T+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDEKTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 210/249 (84%), Gaps = 6/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNN E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+VP A   P    Q  N A  P        VPS+ PNANPLDLFPQGLP++ S  A G
Sbjct  205   QADVPLAV-RPAASGQDVNSAQAPAPQPAQPTVPSTGPNANPLDLFPQGLPSMGS--AAG  261

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  262   AGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  321

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  322   EGGEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  378

Query  1379  LDHMHEFED  1405
             LDH+HEFED
Sbjct  379   LDHIHEFED  387


 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 199/249 (80%), Positives = 210/249 (84%), Gaps = 6/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNN E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  144   DAYGQAASNLVAGNNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  203

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+VP A   P    Q  N A  P        VPS+ PNANPLDLFPQGLP++ S  A G
Sbjct  204   QADVPLAV-RPAASGQDVNSAQAPAPQPAQPTVPSTGPNANPLDLFPQGLPSMGS--AAG  260

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  261   AGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  320

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  321   EGGEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  377

Query  1379  LDHMHEFED  1405
             LDH+HEFED
Sbjct  378   LDHIHEFED  386


 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   359 bits (921),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 208/250 (83%), Gaps = 9/250 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D+YGQAASNLVAG+NLE  IQQILDMGGG+W+RETVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  123   DMYGQAASNLVAGSNLEATIQQILDMGGGSWNRETVVRALRAAFNNPERAVEYLYSGIPE  182

Query  839   SAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAG  1015
              AEVPP A+G    V   P   AQ   A       ++       DLFPQGLP+   SNAG
Sbjct  183   QAEVPPVAQGPASGVAVNPPAQAQQPAAPPSGGPNANPL-----DLFPQGLPST-GSNAG  236

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
               N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEP
Sbjct  237   AGN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEP  295

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             VEG EGN+LGQLA+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANY
Sbjct  296   VEG-EGNVLGQLASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANY  354

Query  1376  LLDHMHEFED  1405
             LLDHMHEF++
Sbjct  355   LLDHMHEFDE  364


 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            E+KVAEN+F+VVM+
Sbjct  61   ESKVAENSFIVVML  74



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   359 bits (921),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDR TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  125   DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRNTVVRALRAAFNNPERAVEYLYSGIPE  184

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P Q  QPA  P++ PNANPLDLFPQGLPN+ ++   G
Sbjct  185   QAEVPPV---ARAPASGGQPAIPPAQTQQPAAAPATGPNANPLDLFPQGLPNVGANP--G  239

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  240   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  299

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELA
Sbjct  300   EGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELA  359

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  360   ANYLLDHMHEFEE  372


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +2

Query  371  MLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            MLIHQGKVLKD TT+EENKVAEN+F+V+MM
Sbjct  1    MLIHQGKVLKDETTIEENKVAENSFIVIMM  30



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   361 bits (927),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 211/249 (85%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY +AASNLVAG NLEG IQQI+DMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  203   DVYSEAASNLVAGTNLEGTIQQIIDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPE  262

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP          P  Q A          VPS  PN+NPLDLFPQGLP++  SNAGG
Sbjct  263   QAEVPPV-----AQPPPGGQPATTPVQDTQPAVPSGGPNSNPLDLFPQGLPSM-GSNAGG  316

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNSQQFQALRA+VQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPV
Sbjct  317   GNNLDFLRNSQQFQALRAVVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPV  376

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG +GN+LGQLA +MPQ+V VT EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  377   EG-DGNVLGQLAEAMPQSVAVTAEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  435

Query  1379  LDHMHEFED  1405
             LDHMHEF+D
Sbjct  436   LDHMHEFDD  444


 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = +2

Query  236  NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  415
            +MKIFVKTLKGTHFEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIHQGKVLKD TTL
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIHQGKVLKDETTL  124

Query  416  EENKVAENNFVVVMM  460
            EENKVAE +FVVVM+
Sbjct  125  EENKVAEKSFVVVML  139



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   360 bits (925),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 193/258 (75%), Positives = 206/258 (80%), Gaps = 19/258 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NL+  IQQILDMGGGTWDR+TVV ALRAA+NNPERAVEYLYSGIPE
Sbjct  173   DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVHALRAAFNNPERAVEYLYSGIPE  232

Query  839   SAEVP-----PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
              AEVP     PA G  P       Q      A+ P   P         DLFPQGLPN+  
Sbjct  233   QAEVPTVFRAPASGGQPANPSTQTQQPAAAPASGPNANPL--------DLFPQGLPNV--  282

Query  1004  SNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL  1183
                 GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRL
Sbjct  283   GGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRL  342

Query  1184  INEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  1351
             INEPVEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNK
Sbjct  343   INEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNK  402

Query  1352  NEELAANYLLDHMHEFED  1405
             NEELAANYLLDHMHEFE+
Sbjct  403   NEELAANYLLDHMHEFEE  420


 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|ACU20959.1| unknown [Glycine max]
Length=363

 Score =   358 bits (918),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 263/389 (68%), Gaps = 26/389 (7%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1     MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV+E+ F+VVM++K+K+S    ++S    +      S+++++    P   +  A    
Sbjct  61    ENKVSEDGFLVVMLSKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQTQAANNST  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             S+                  D YG AASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  121   SSTDAPTTNVSA--------DTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERA++YLYSGIPE+AEV                   PQ A   +      PN+
Sbjct  173   RAAYNNPERAIDYLYSGIPEAAEV---------------AVPVPQTAGISSGAVPVGPNS  217

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PL++FPQ      SS   G  +L+FLRN+ QFQALR+MVQ+NPQILQP+LQELGKQNP 
Sbjct  218   SPLNMFPQ---ETISSTGAGLGSLDFLRNNPQFQALRSMVQSNPQILQPVLQELGKQNPG  274

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             L+RLIQEH  +FL+LINEPV+G EG+I  Q    MP A+ VTP E+EAI RLEAMGFDRA
Sbjct  275   LLRLIQEHHGEFLQLINEPVDGSEGDIFEQPEQDMPHAINVTPTEQEAIGRLEAMGFDRA  334

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
              V+E F AC+++E+LAANYLL++  +FED
Sbjct  335   SVIEAFLACDRDEQLAANYLLENAGDFED  363



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   358 bits (920),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 207/248 (83%), Gaps = 5/248 (2%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
             VY QAASNLVAG+ LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIPE 
Sbjct  139   VYDQAASNLVAGSTLETTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPEQ  198

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             AE+PP                  Q AA P   P   PNANPLDLFPQGLPN+  SNA  A
Sbjct  199   AEIPPV---AQLPAGGQPVIPSTQAAAPPVAAPGGGPNANPLDLFPQGLPNMGGSNAS-A  254

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
              TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVE
Sbjct  255   GTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVE  314

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             G EGNILGQLA +MPQ V VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL
Sbjct  315   G-EGNILGQLAEAMPQTVNVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  373

Query  1382  DHMHEFED  1405
             DHMHEF+D
Sbjct  374   DHMHEFDD  381


 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
             N VAE +FVV+M+
Sbjct  61   ANNVAEKSFVVIML  74



>ref|XP_003529480.1| PREDICTED: ubiquitin receptor RAD23b-like isoform 1 [Glycine 
max]
 gb|KHN39368.1| Putative DNA repair protein RAD23-1 [Glycine soja]
Length=363

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 262/389 (67%), Gaps = 26/389 (7%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1     MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV+E+ F+VVM++K+K+S    ++S    +      S ++++    P   +  A    
Sbjct  61    ENKVSEDGFLVVMLSKSKTSGSAAASSVQPASNPATTVSMSNSTPPSDPPVQTQAANNST  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             S+                  D YG AASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  121   SSTDAPTTNVSA--------DTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERA++YLYSGIPE+AEV                   PQ A   +      PN+
Sbjct  173   RAAYNNPERAIDYLYSGIPEAAEV---------------AVPVPQTAGMSSGAVPVGPNS  217

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PL++FPQ      SS   G  +L+FLRN+ QFQALR+MVQ+NPQILQP+LQELGKQNP 
Sbjct  218   SPLNMFPQ---ETISSTGAGLGSLDFLRNNPQFQALRSMVQSNPQILQPVLQELGKQNPG  274

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             L+RLIQEH  +FL+LINEPVEG EG++  Q    MP A+ VTP E+EAI RLEAMGFDRA
Sbjct  275   LLRLIQEHHGEFLQLINEPVEGSEGDMFEQPEQDMPHAINVTPAEQEAIGRLEAMGFDRA  334

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
              V+E F AC+++E+LAANYLL++  +FED
Sbjct  335   SVIEAFLACDRDEQLAANYLLENAGDFED  363



>ref|NP_001240038.1| uncharacterized protein LOC100819019 [Glycine max]
 gb|ACU24437.1| unknown [Glycine max]
Length=363

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 263/389 (68%), Gaps = 26/389 (7%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1     MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV+E+ F+VVM++K+K+S    ++S    +      S+++++    P   +  A    
Sbjct  61    ENKVSEDGFLVVMLSKSKTSGSAAASSVQPASNPPTTVSTSNSTPPSDPPVQTQAANNST  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             S+                  D YG AASNLVAG+NLE  IQQI+DMGGG WDR+TV RAL
Sbjct  121   SSTDAPTTNVSA--------DTYGLAASNLVAGSNLEQTIQQIMDMGGGNWDRDTVSRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERA++YLYSGIPE+AEV                   PQ A   +      PN+
Sbjct  173   RAAYNNPERAIDYLYSGIPEAAEV---------------AVPVPQTAGISSGAVPVGPNS  217

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PL++FPQ      SS   G  +L+FLRN+ QFQALR+MVQ+NPQILQP+LQELGKQNP 
Sbjct  218   SPLNMFPQ---ETISSTGAGLGSLDFLRNNPQFQALRSMVQSNPQILQPVLQELGKQNPG  274

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRA  1318
             L+RLIQEH  +FL+LINEPV+G EG+I  Q    MP A+ VTP E+EAI RLEAMGFDRA
Sbjct  275   LLRLIQEHHGEFLQLINEPVDGSEGDIFEQPEQDMPHAINVTPAEQEAIGRLEAMGFDRA  334

Query  1319  LVLEVFFACNKNEELAANYLLDHMHEFED  1405
              V+E F AC+++E+LAANYLL++  +FED
Sbjct  335   SVIEAFLACDRDEQLAANYLLENAGDFED  363



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  180   DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRDTVVRALRAAFNNPERAVEYLYSGIPE  239

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A+ P Q  QPA  P+S PNANPL+LFPQGLPN+      G
Sbjct  240   QAEVPPVS---RAPASGGQPASPPAQTQQPAAAPASGPNANPLNLFPQGLPNV--GGNPG  294

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  295   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  354

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LG +AA +  PQA+QVTPEEREAIERLE MGFDRALVLEVFFACNKNEELA
Sbjct  355   EGGGESGNLLGHMAAGIPQPQAIQVTPEEREAIERLEGMGFDRALVLEVFFACNKNEELA  414

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  415   ANYLLDHMHEFEE  427


 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VKTLKGTHFEIEVKPED+++DVKK+IET QG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 198/253 (78%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDR TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  169   DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRNTVVRALRAAFNNPERAVEYLYSGIPE  228

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P Q  QPA  P++ PNANPLDLFPQGLPN+ ++   G
Sbjct  229   QAEVPPV---ARAPASGGQPAIPPAQTQQPAAAPATGPNANPLDLFPQGLPNVGANP--G  283

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  284   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  343

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+ GQL A M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELA
Sbjct  344   EGGGESGNLFGQLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELA  403

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  404   ANYLLDHMHEFEE  416


 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG HFEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/251 (80%), Positives = 221/251 (88%), Gaps = 3/251 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLEG +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSGIPE
Sbjct  147   DVYGQAASNLVAGSNLEGTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSGIPE  206

Query  839   SAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAG  1015
              AE P  A          P  AA   QAAQPAPV SS PNANPLDLFPQGLPNI  + A 
Sbjct  207   QAEAPAVARVPASAQPVNPEAAAAAPQAAQPAPVTSSGPNANPLDLFPQGLPNI-GAGAA  265

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
             GA +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP
Sbjct  266   GAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEP  325

Query  1196  VEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             +EGGEG N+LGQ+AA MPQ+V VTPEER+AIERLEAMGFDRA+VLEVFFACNKNEELAAN
Sbjct  326   MEGGEGNNLLGQMAAGMPQSVTVTPEERQAIERLEAMGFDRAIVLEVFFACNKNEELAAN  385

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEF++
Sbjct  386   YLLDHMHEFDE  396


 Score =   130 bits (327),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   358 bits (919),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 193/257 (75%), Positives = 206/257 (80%), Gaps = 18/257 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NL+  IQQILDMGGGTWDR+TVVRAL AA+NNPERAVEYLYSGIPE
Sbjct  176   DVYGQAASNLAAGSNLDSTIQQILDMGGGTWDRDTVVRALHAAFNNPERAVEYLYSGIPE  235

Query  839   SAEVP----PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSS  1006
              AEVP    PA G  P       Q      A+ P   P         DLFPQGLPN+   
Sbjct  236   QAEVPVFRAPASGGQPGNPPAQTQQPAAAPASGPNANPL--------DLFPQGLPNV--G  285

Query  1007  NAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLI  1186
                GA TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLI
Sbjct  286   GNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLI  345

Query  1187  NEPVEGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKN  1354
             NEPVEGG   GNILGQLAA M  PQA+QVTPEEREAIERLEAMGF+RALVLEVFFACNKN
Sbjct  346   NEPVEGGGESGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKN  405

Query  1355  EELAANYLLDHMHEFED  1405
             EELAANYLLDHMHEFE+
Sbjct  406   EELAANYLLDHMHEFEE  422


 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 209/249 (84%), Gaps = 8/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  IQQILDMGGG+WDR+TV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  147   DVYGQAASNLVAGTTLESTIQQILDMGGGSWDRDTVIRALRAAYNNPERAVEYLYSGIPE  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AE     G PP       Q+  P   A    VPSS PNANPLDLFPQGLP+        
Sbjct  207   AAE-----GPPPAQAPASAQSVNPSAQAPQPAVPSSGPNANPLDLFPQGLPS--GGTNAS  259

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  260   AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  319

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFD ALVLEVFFACNKNEELAANYL
Sbjct  320   EG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDPALVLEVFFACNKNEELAANYL  378

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  379   LDHMHEFDE  387


 Score =   128 bits (322),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   357 bits (915),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYLY+GIPE
Sbjct  172   DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPE  231

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP      P       A  P Q  QPA  P+S PNANPLDLFPQGLPN+      G
Sbjct  232   QAEVPPV---ARPPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNV--GGNPG  286

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  287   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  346

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELA
Sbjct  347   EGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELA  406

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  407   ANYLLDHMHEFEE  419


 Score =   132 bits (332),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   356 bits (914),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQQILDMGGGTW R+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  165   DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNNPERAVEYLYSGIPE  224

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AE PP      P  +    A         A VPS  PNANPLDLFPQGLPN+  SNAGG
Sbjct  225   NAEAPPV--ARAPASEQTTNAPAQAPQPVQAAVPSGGPNANPLDLFPQGLPNV-GSNAGG  281

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP 
Sbjct  282   G-SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPA  340

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYL
Sbjct  341   EGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYL  400

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  401   LDHMHEFED  409


 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYLY+GIPE
Sbjct  90    DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPE  149

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP      P       A  P Q  QPA  P+S PNANPLDLFPQGLPN+      G
Sbjct  150   QAEVPPV---ARPPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNV--GGNPG  204

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  205   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  264

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELA
Sbjct  265   EGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELA  324

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  325   ANYLLDHMHEFEE  337


 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTT  412
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETT  58



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQQILDMGGGTW R+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  164   DAYGQAASNLVAGNTLEQTIQQILDMGGGTWARDTVVRALRAAYNNPERAVEYLYSGIPE  223

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AE PP      P  +    A         A VPS  PNANPLDLFPQGLPN+  SNAGG
Sbjct  224   NAEAPPV--ARAPASEQTTNAPAQAPQPVQAAVPSGGPNANPLDLFPQGLPNV-GSNAGG  280

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP 
Sbjct  281   G-SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPA  339

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN LGQLA  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYL
Sbjct  340   EGTEGNPLGQLAGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYL  399

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  400   LDHMHEFED  408


 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV E+ F+V+M+
Sbjct  61   ENKVCESTFLVIML  74



>ref|XP_008462953.1| PREDICTED: ubiquitin receptor RAD23b isoform X1 [Cucumis melo]
Length=387

 Score =   355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 217/394 (55%), Positives = 263/394 (67%), Gaps = 12/394 (3%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V+  DTV  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1     MKLTVKTLKGSHFEIRVQLTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLA  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV+E  F+VVM++K+K+S+  G +S+             S++ A    P+  PAP   
Sbjct  61    ENKVSEEGFLVVMLSKSKTSASAGQSSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAP  120

Query  599   sapvpvaapaptpaptagsgDV----YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETV  766
             +     A    T      + +V    YGQAASNLVAGNNLE  +QQ++DMGGGTWDRETV
Sbjct  121   TQAPSSALKNTTSTSDRVTDNVQTDTYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETV  180

Query  767   VRALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpss  946
             VRALRAAYNNPERAV+YLYSGIPESAEV    G               +  A      S 
Sbjct  181   VRALRAAYNNPERAVDYLYSGIPESAEVAVPVG-------RFGSGQATETDASVPAPVSG  233

Query  947   apnanplDLFPQ-GLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELG  1123
             APN  PL++FPQ  L        G   +LEFLRN+ QFQALR MV  NPQILQPMLQELG
Sbjct  234   APNTAPLNMFPQEALSAGGGGGGGNLGSLEFLRNNPQFQALRTMVHTNPQILQPMLQELG  293

Query  1124  KQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAM  1303
             KQNP L+RLIQ+H A+FL+LINEPV+  EG +  Q    MP A+ VTP E+ AIERLEAM
Sbjct  294   KQNPQLLRLIQDHHAEFLQLINEPVDNFEGEMFEQAEPDMPHAINVTPAEQAAIERLEAM  353

Query  1304  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             GFDRALV+E F AC++NEELAANYLL++  +F+D
Sbjct  354   GFDRALVIEAFLACDRNEELAANYLLENSGDFDD  387



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   356 bits (913),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGGTWDRETVV ALRAA+NNPERAVEYLY+GIPE
Sbjct  171   DVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVLALRAAFNNPERAVEYLYTGIPE  230

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP      P       A  P Q  QPA  P+S PNANPLDLFPQGLPN+      G
Sbjct  231   QAEVPPV---ARPPASAGQPANPPAQTQQPAAAPASGPNANPLDLFPQGLPNV--GGNPG  285

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  286   AGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  345

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LGQ+AA M  PQA+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELA
Sbjct  346   EGGGESGNLLGQMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELA  405

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDHMHEFE+
Sbjct  406   ANYLLDHMHEFEE  418


 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 207/249 (83%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG NLE  IQ ILDMGGGTWDR+ VVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DVYGQAASNLVAGTNLEQTIQHILDMGGGTWDRDIVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP         Q P         A    VPSS PNANPLDLFPQGLP++  SNAG 
Sbjct  205   QAEAPPVS-------QAPTSPPVQAPQAGQPAVPSSGPNANPLDLFPQGLPSM-GSNAG-  255

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP 
Sbjct  256   AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPT  315

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E ++LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  316   EGAESDLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  375

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  376   LDHMHEFED  384


 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIF+KTLKGTHFEIEVKPEDTV DVK++IE  QG +VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIHQGKILKDETTLQ  60

Query  419  ENKVAENNFVVVMM  460
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 193/249 (78%), Positives = 209/249 (84%), Gaps = 10/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSGIPE
Sbjct  146   DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSGIPE  205

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA            QA  P   A P  VPS  PNANPLDLFPQGLPN+  SN G 
Sbjct  206   QAEIPPA-------APVSGQAVNPPVQASPPAVPSGGPNANPLDLFPQGLPNV-GSNVGA  257

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  258   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  316

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEE+AANYL
Sbjct  317   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEEMAANYL  375

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  376   LDHMHEFDE  384


 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQ KVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQVKVLKDPTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   350 bits (899),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 212/249 (85%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYLYSGIP+
Sbjct  93    NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYLYSGIPQ  152

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP            N A  P  A QP   P+S PNANPLDLFPQG      SNAG 
Sbjct  153   QAEVPPV-AQVVQGPASGNAANPPALAPQPVVAPNSGPNANPLDLFPQGHHRT-GSNAGT  210

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  211   GN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPV  269

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  270   EG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  328

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  329   LDHMHEFDE  337



>ref|NP_850982.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 sp|Q84L33.3|RD23B_ARATH RecName: Full=Ubiquitin receptor RAD23b; Short=AtRAD23b; AltName: 
Full=Putative DNA repair protein RAD23-1; AltName: Full=RAD23-like 
protein 1; Short=AtRAD23-1 [Arabidopsis thaliana]
 gb|AAM65583.1| DNA repair protein RAD23, putative [Arabidopsis thaliana]
 gb|ABG89118.1| Rad23-3Aii [synthetic construct]
 gb|AEE36281.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=371

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 212/391 (54%), Positives = 269/391 (69%), Gaps = 22/391 (6%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1     MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV E  F+VVM++K+KS    G AS   ++ +   +++TS++   AP    +     +
Sbjct  61    ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P      A T        D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121   PIPAQEQPAAQT--------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAV+YLYSGIP++AEV            P  +A      A P    S  PN+
Sbjct  173   RAAYNNPERAVDYLYSGIPQTAEV----------AVPVPEAQIAGSGAAPVAPASGGPNS  222

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PLDLFPQ    + ++ +G   TLEFLRN+ QFQ LR MV +NPQILQPMLQELGKQNP 
Sbjct  223   SPLDLFPQ--ETVAAAGSGDLGTLEFLRNNDQFQQLRTMVHSNPQILQPMLQELGKQNPQ  280

Query  1139  LMRLIQEHQADFLRLINEPVEG--GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             L+RLIQE+QA+FL+L+NEP EG  GEG++  Q    MP A+ VTP E+EAI+RLEAMGFD
Sbjct  281   LLRLIQENQAEFLQLVNEPYEGSDGEGDMFDQPEQEMPHAINVTPAEQEAIQRLEAMGFD  340

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALV+E F AC++NEELAANYLL++  +FED
Sbjct  341   RALVIEAFLACDRNEELAANYLLENSGDFED  371



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSGIPE
Sbjct  126   DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSGIPE  185

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PP      P       +           VPSS PNANPLDLFPQGLPN+ S    G
Sbjct  186   HVEAPPV--AQAPATGQAASSPVQAPQPVQPAVPSSGPNANPLDLFPQGLPNVRS----G  239

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP 
Sbjct  240   ASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPA  299

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  300   EG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  358

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  359   LDHMHEFED  367


 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   351 bits (901),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSGIPE
Sbjct  129   DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSGIPE  188

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PP      P       +           VPSS PNANPLDLFPQGLPN+ S    G
Sbjct  189   HVEAPPV--AQAPATGQAASSPVQAPQPVQPAVPSSGPNANPLDLFPQGLPNVRS----G  242

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP 
Sbjct  243   ASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPA  302

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  303   EG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  361

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  362   LDHMHEFED  370


 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   352 bits (902),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 201/254 (79%), Gaps = 18/254 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+N E AI+QILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  143   DVYGQAASNLVAGSNFEEAIKQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  202

Query  839   SAEVP-----PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
              A+VP     PA G          Q AQP   +               DLFPQGLPN+ +
Sbjct  203   QADVPLVARPPASGQAVNPPAQAPQPAQPAVPSSGPNANPL-------DLFPQGLPNVGA  255

Query  1004  SNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL  1183
             +   G  TL+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL
Sbjct  256   T--AGTGTLDFLRNSPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL  313

Query  1184  INEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  1363
             INEPVE GEGN+ GQ+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL
Sbjct  314   INEPVE-GEGNLFGQMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  369

Query  1364  AANYLLDHMHEFED  1405
             AANYLLDH+HEFE+
Sbjct  370   AANYLLDHIHEFEE  383


 Score =   127 bits (320),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   352 bits (902),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSGIPE
Sbjct  147   DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSGIPE  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PP      P       +           VPSS PNANPLDLFPQGLPN+ S    G
Sbjct  207   HVEAPPV--AQAPATGQAASSPVQAPQPVQPAVPSSGPNANPLDLFPQGLPNVRS----G  260

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP 
Sbjct  261   ASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPA  320

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  321   EG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  379

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  380   LDHMHEFED  388


 Score =   122 bits (306),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   352 bits (902),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGNNLE  IQQILDMGGGTW+R+TVVRAL AAYNNPERAVEYLYSGIPE
Sbjct  150   DAYGQAASNLVAGNNLEKTIQQILDMGGGTWERDTVVRALHAAYNNPERAVEYLYSGIPE  209

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PP      P       +           VPSS PNANPLDLFPQGLPN+ S    G
Sbjct  210   HVEAPPV--AQAPATGQAASSPVQAPQPVQPAVPSSGPNANPLDLFPQGLPNVRS----G  263

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A++L+FLRNS QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP 
Sbjct  264   ASSLDFLRNSPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPA  323

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  324   EG-ESNLLGQLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  382

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  383   LDHMHEFED  391


 Score =   122 bits (306),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+EN+F+V+M+
Sbjct  61   DNKVSENSFIVIML  74



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   351 bits (900),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 212/249 (85%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYLYSGIP+
Sbjct  129   NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYLYSGIPQ  188

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP            N A  P  A QP   P+S PNANPLDLFPQG      SNAG 
Sbjct  189   QAEVPPV-AQVVQGPASGNAANPPALAPQPVVAPNSGPNANPLDLFPQGHHRT-GSNAGT  246

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  247   GN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPV  305

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  306   EG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  364

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  365   LDHMHEFDE  373


 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   351 bits (901),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 212/249 (85%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYLYSGIP+
Sbjct  147   NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYLYSGIPQ  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP            N A  P  A QP   P+S PNANPLDLFPQG      SNAG 
Sbjct  207   QAEVPPV-AQVVQGPASGNAANPPALAPQPVVAPNSGPNANPLDLFPQGHHRT-GSNAGT  264

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  265   GN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPV  323

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  324   EG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  382

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  383   LDHMHEFDE  391


 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 212/249 (85%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             ++YGQAASNLVAG+NLE  IQQILDMGGG W+RETVVRALRAA+NNPERAVEYLYSGIP+
Sbjct  146   NMYGQAASNLVAGSNLEATIQQILDMGGGDWNRETVVRALRAAFNNPERAVEYLYSGIPQ  205

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP            N A  P  A QP   P+S PNANPLDLFPQG      SNAG 
Sbjct  206   QAEVPPV-AQVVQGPASGNAANPPALAPQPVVAPNSGPNANPLDLFPQGHHRT-GSNAGT  263

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  264   GN-LDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPV  322

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYL
Sbjct  323   EG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYL  381

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  382   LDHMHEFDE  390


 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E++F VVM+
Sbjct  61   ENKVSESSFFVVML  74



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  178   DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNNPERAVEYLYSGIPE  237

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P Q  QPA  P++ PNANPLDLFPQGLPN+ ++ + G
Sbjct  238   QAEVPPV---ARAPASGGQPANLPTQTQQPAAAPATGPNANPLDLFPQGLPNVGANPSAG  294

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRNSQQFQ LRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  295   --TLDFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  352

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELA
Sbjct  353   EGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELA  412

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDH+HEFE+
Sbjct  413   ANYLLDHIHEFEE  425


 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 213/253 (84%), Gaps = 9/253 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  IQQILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  188   DVYGQAASNLAAGSNLESTIQQILDMGGGNWDRDTVVRALRAAFNNPERAVEYLYSGIPE  247

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P Q  QPA  P++ PNANPLDLFPQGLPN+ ++ + G
Sbjct  248   QAEVPPV---ARAPASGGQPANLPTQTQQPAAAPATGPNANPLDLFPQGLPNVGANPSAG  304

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRNSQQFQ LRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPV
Sbjct  305   --TLDFLRNSQQFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPV  362

Query  1199  EGG--EGNILGQLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELA  1366
             EGG   GN+LGQLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELA
Sbjct  363   EGGAETGNLLGQLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELA  422

Query  1367  ANYLLDHMHEFED  1405
             ANYLLDH+HEFE+
Sbjct  423   ANYLLDHIHEFEE  435


 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/249 (75%), Positives = 204/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+ LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERAVEYLYSGIP+
Sbjct  147   DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAVEYLYSGIPD  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE  P      P       +           VPSS PNANPLD+FPQGLPN+ S   GG
Sbjct  207   HAEAAPV--ARAPASGQTVNSPVEAPQPVQPAVPSSGPNANPLDIFPQGLPNVGSHAGGG  264

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP 
Sbjct  265   --SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPA  322

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYL
Sbjct  323   EGTEGNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYL  382

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  383   LDHMHEFED  391


 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 207/249 (83%), Gaps = 13/249 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSGIPE
Sbjct  148   DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSGIPE  207

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP              + Q       A  PSS PNANPLDLFPQGLPN+  +NAG 
Sbjct  208   QAEIPPV----------APASGQAVNPPVQASQPSSGPNANPLDLFPQGLPNV-GANAGA  256

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  257   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  315

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYL
Sbjct  316   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYL  374

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  375   LDHMHEFDE  383


 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 205/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLVAG+ LE  +Q ILDMGGG+WDRETVVRALRAAYNNPERAV+YLYSGIPE
Sbjct  143   DVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVRALRAAYNNPERAVDYLYSGIPE  202

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P                    Q A    VPSS PNANPLDLFPQGLPN+  SNAG 
Sbjct  203   QAEIP-PVAPTAAATASGQAVNPSAQEASQPAVPSSGPNANPLDLFPQGLPNV-GSNAGS  260

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNS QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  261   GN-LDFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPV  319

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYL
Sbjct  320   EG-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYL  378

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  379   LDHMHEFDE  387


 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 207/249 (83%), Gaps = 13/249 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSGIPE
Sbjct  146   DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSGIPE  205

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP              + Q       A  PSS PNANPLDLFPQGLPN+  +NAG 
Sbjct  206   QAEIPPV----------APASGQAVNPPVQASQPSSGPNANPLDLFPQGLPNV-GANAGA  254

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  255   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  313

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYL
Sbjct  314   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYL  372

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  373   LDHMHEFDE  381


 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 207/249 (83%), Gaps = 10/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSGIPE
Sbjct  144   DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSGIPE  203

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA            QA  P   A    VPS  PNANPLDLFPQGLPN+  SN G 
Sbjct  204   QAEIPPA-------APASGQAVNPPVQASQPAVPSGGPNANPLDLFPQGLPNV-GSNVGA  255

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  256   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  314

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFAC KNEE+AANYL
Sbjct  315   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACXKNEEMAANYL  373

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  374   LDHMHEFDE  382


 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI  GKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIPPGKVLKDPTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/250 (77%), Positives = 206/250 (82%), Gaps = 4/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIP 
Sbjct  137   DVYGQAASNLVAGSNLESTIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPA  196

Query  839   SAEVPP-AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAG  1015
              AEVP  A+  P        QA   Q A      P+  PNANPL+LFPQGLP   +    
Sbjct  197   QAEVPQVAQAPPSGGQTTNPQAQAQQPAPAAPAAPAGGPNANPLNLFPQGLPT--AGADA  254

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
             GA  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINEP
Sbjct  255   GAGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINEP  314

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
              EG E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  315   AEGEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  373

Query  1376  LLDHMHEFED  1405
             LLDH+HEFED
Sbjct  374   LLDHIHEFED  383


 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENK++EN F+V+M+
Sbjct  61   ENKISENGFIVIML  74



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   348 bits (894),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 188/249 (76%), Positives = 207/249 (83%), Gaps = 13/249 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+W+R+TVVRALRAAYNNPERA+EYLYSGIPE
Sbjct  130   DVYGQAASNLVAGSTLETTVQQILDMGGGSWERDTVVRALRAAYNNPERAIEYLYSGIPE  189

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP              + Q       A  PSS PNANPLDLFPQGLPN+  +NAG 
Sbjct  190   QAEIPPV----------APASGQAVNPPVQASQPSSGPNANPLDLFPQGLPNV-GANAGA  238

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  239   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  297

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYL
Sbjct  298   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYL  356

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  357   LDHMHEFDE  365


 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   352 bits (904),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 211/249 (85%), Gaps = 8/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLVAGNN+E  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIP 
Sbjct  247   DVYSQAASNLVAGNNIEAIIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPA  306

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A V               QAA P   AQ    P+S PNANPLDLFPQGLPN   SNAG 
Sbjct  307   QAAV-----PAVARAPAAGQAANPPAQAQQPAAPTSGPNANPLDLFPQGLPNT-GSNAG-  359

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  360   AGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  419

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+LGQLAA+MPQAV VTPEEREAIERLEAMGFDR +VLEVFFACNKNEELAANYL
Sbjct  420   EG-EGNLLGQLAAAMPQAVTVTPEEREAIERLEAMGFDRNIVLEVFFACNKNEELAANYL  478

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  479   LDHMHEFEE  487


 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  419  ENKVAENNFVVVMM  460
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>dbj|BAC76389.1| RAD23-like protein [Arabidopsis thaliana]
Length=371

 Score =   348 bits (892),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 268/391 (69%), Gaps = 22/391 (6%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1     MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV E  F+VVM++K+KS    G AS   ++ +   +++TS++   AP    +     +
Sbjct  61    ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P      A T        D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121   PIPAQEQPAAQT--------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAV+YLYSGIP++AEV            P  +A      A P    S  PN+
Sbjct  173   RAAYNNPERAVDYLYSGIPQTAEV----------AVPVPEAQIAGSGAAPVAPASGGPNS  222

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PLDLFPQ    + ++ +G   TLEFLRN+ Q + LR MV +NPQILQPMLQELGKQNP 
Sbjct  223   SPLDLFPQ--ETVAAAGSGDLGTLEFLRNNDQLEQLRTMVHSNPQILQPMLQELGKQNPQ  280

Query  1139  LMRLIQEHQADFLRLINEPVEG--GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             L+RLIQE+QA+FL+L+NEP EG  GEG++  Q    MP A+ VTP E+EAI+RLEAMGFD
Sbjct  281   LLRLIQENQAEFLQLVNEPYEGSDGEGDMFDQPEQEMPHAINVTPAEQEAIQRLEAMGFD  340

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALV+E F AC++NEELAANYLL++  +FED
Sbjct  341   RALVIEAFLACDRNEELAANYLLENSGDFED  371



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 208/249 (84%), Gaps = 8/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+RALRAA+NNPERA+EYLYSGIPE
Sbjct  125   DVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRALRAAFNNPERAIEYLYSGIPE  184

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+      PP       QA  P   A    VPS  PNANPLDLFPQGLPN+  SNAG 
Sbjct  185   QAEI-----PPPAPAPASGQAVNPPVQASQPAVPSGGPNANPLDLFPQGLPNV-GSNAGA  238

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  239   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  297

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYL
Sbjct  298   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYL  356

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  357   LDHMHEFDE  365


 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 203/254 (80%), Gaps = 8/254 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPP-----AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
              AE PP     A G          Q AQ  Q AQPA   S        DLFPQGLP++ S
Sbjct  205   QAEAPPVAQAPASGQMANPPVQAPQPAQAPQPAQPAVPSSGPNANPL-DLFPQGLPSMGS  263

Query  1004  SNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL  1183
             + + G  +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL
Sbjct  264   NASAG--SLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRL  321

Query  1184  INEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  1363
             +NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL
Sbjct  322   LNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL  381

Query  1364  AANYLLDHMHEFED  1405
             AANYLLDHMHEFED
Sbjct  382   AANYLLDHMHEFED  395


 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFVVVMM  460
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   346 bits (887),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 209/249 (84%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  +QQILDMGGG+WDR+TV+RALRAA+NNPERA+EYLYSGIPE
Sbjct  125   DVYGQAASNLVAGSTLEATVQQILDMGGGSWDRDTVIRALRAAFNNPERAIEYLYSGIPE  184

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P      P +     QA  P   A    VPS  PNANPLDLFPQGLPN+  SNAG 
Sbjct  185   QAEIP-PAAPAPALAPASGQAVNPPVQASQPAVPSGGPNANPLDLFPQGLPNV-GSNAGA  242

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  243   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  301

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYL
Sbjct  302   EG-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYL  360

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  361   LDHMHEFDE  369


 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/250 (75%), Positives = 204/250 (82%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+ LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERAVEYLYSGIP+
Sbjct  147   DSYGQAASNLVAGSTLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAVEYLYSGIPD  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE  P      P       +           VPSS PNANPLD+FPQGLPN+ S   GG
Sbjct  207   HAEAAPV--ARAPASGQTVNSPVEAPQPVQPAVPSSGPNANPLDIFPQGLPNVGSHAGGG  264

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNS QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP 
Sbjct  265   --SLDFLRNSPQFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPA  322

Query  1199  EGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EG EG N+LGQLAA MPQA+ VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANY
Sbjct  323   EGTEGSNVLGQLAAGMPQALTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANY  382

Query  1376  LLDHMHEFED  1405
             LLDHMHEFED
Sbjct  383   LLDHMHEFED  392


 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN+F+V+M+
Sbjct  61   ENKVFENSFLVIML  74



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 191/251 (76%), Positives = 211/251 (84%), Gaps = 7/251 (3%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             YGQAAS+LVAGNNLEG IQ ILDMGGGTWDR+TVVRALRAA+NNP RA++YLYSGIPE  
Sbjct  154   YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNNPARAIDYLYSGIPEQP  213

Query  845   EVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGAN  1024
             E P A    P  +          Q+AQPA VPS+ PNANPLDLFPQGLPN+ ++   GA 
Sbjct  214   EAPAA---APTRVSGEAANVSAPQSAQPASVPSTGPNANPLDLFPQGLPNLGAAAGAGAG  270

Query  1025  T----LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  1192
             T    L+FLR+S QFQALRAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINE
Sbjct  271   TGVGDLDFLRDSPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINE  330

Query  1193  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             PVEGGEG++LGQL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAAN
Sbjct  331   PVEGGEGDVLGQLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAAN  390

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEFED
Sbjct  391   YLLDHMHEFED  401


 Score =   128 bits (321),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 191/251 (76%), Positives = 211/251 (84%), Gaps = 7/251 (3%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             YGQAAS+LVAGNNLEG IQ ILDMGGGTWDR+TVVRALRAA+NNP RA++YLYSGIPE  
Sbjct  153   YGQAASDLVAGNNLEGTIQHILDMGGGTWDRDTVVRALRAAFNNPARAIDYLYSGIPEQP  212

Query  845   EVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGAN  1024
             E P A    P  +          Q+AQPA VPS+ PNANPLDLFPQGLPN+ ++   GA 
Sbjct  213   EAPAA---APTRVSGEAANVSAPQSAQPASVPSTGPNANPLDLFPQGLPNLGAAAGAGAG  269

Query  1025  T----LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  1192
             T    L+FLR+S QFQALRAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINE
Sbjct  270   TGVGDLDFLRDSPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINE  329

Query  1193  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             PVEGGEG++LGQL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAAN
Sbjct  330   PVEGGEGDVLGQLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAAN  389

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEFED
Sbjct  390   YLLDHMHEFED  400


 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+EN+FVV+M+
Sbjct  61   ENKVSENSFVVIML  74



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   345 bits (884),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 186/249 (75%), Positives = 203/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSGIP 
Sbjct  137   DVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSGIPA  196

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA    P             Q        +  PNANPL+LFPQG+P   +    G
Sbjct  197   QAEIPPAP-QAPATGGQAANPLAQTQQEATPVPATGGPNANPLNLFPQGMPA--ADAGAG  253

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  254   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  313

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  314   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  372

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  373   LDHMHEFEE  381


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   345 bits (884),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 193/251 (77%), Positives = 210/251 (84%), Gaps = 8/251 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A    QA QPA  P++ PNANPLDLFPQGLPN+ ++  GG
Sbjct  217   QAEVPPV---ARAPASGGQPANPAAQAQQPAAAPATGPNANPLDLFPQGLPNVGANPGGG  273

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  274   --TLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPV  331

Query  1199  EGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAAN
Sbjct  332   EGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAAN  390

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEFE+
Sbjct  391   YLLDHMHEFEE  401


 Score =   137 bits (344),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   344 bits (883),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 211/251 (84%), Gaps = 8/251 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  159   DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYLYSGIPE  218

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P QA QPA  P++ PNANPLDLFPQGLPN+ ++  GG
Sbjct  219   QAEVPPV---ARAPASGGQPANPPAQAQQPAAAPATGPNANPLDLFPQGLPNVGANPGGG  275

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  276   --TLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPV  333

Query  1199  EGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAAN
Sbjct  334   EGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAAN  392

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEFE+
Sbjct  393   YLLDHMHEFEE  403


 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQG+VLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGRVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   344 bits (882),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 211/251 (84%), Gaps = 8/251 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNL AG+NLE  I QILDMGGG WDR+TVVRALRAA+NNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLAAGSNLESTILQILDMGGGAWDRDTVVRALRAAFNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEVPP              A  P QA QPA  P++ PNANPLDLFPQGLPN+ ++  GG
Sbjct  217   QAEVPPV---ARAPASGGQPANPPAQAQQPAAAPATGPNANPLDLFPQGLPNVGANPGGG  273

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRNSQQFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPV
Sbjct  274   --TLDFLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPV  331

Query  1199  EGG-EG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EGG EG N+ G+     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAAN
Sbjct  332   EGGAEGANLFGE-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAAN  390

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEFE+
Sbjct  391   YLLDHMHEFEE  401


 Score =   137 bits (344),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+MM
Sbjct  61   ENKVAENSFIVIMM  74



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   343 bits (880),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  136   DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPS  195

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA    P       QAA P          +  PNANPLDLFPQG+P   +    G
Sbjct  196   QAEIPPA----PQAPATGGQAANPLAQEAAPVSATGGPNANPLDLFPQGMPA--ADAGAG  249

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  250   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  309

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  310   EGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  368

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  369   LDHMHEFEE  377


 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   343 bits (879),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 204/249 (82%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+ LE  IQ ILDMGGGTW+R+ VVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DVYGQAASNLVAGSGLEQTIQHILDMGGGTWERDIVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE PP         + P         A    VPSS PNANPLDLFPQGLP++ S+ + G
Sbjct  205   QAEAPPV-------ARAPASPPVQSPQATQPAVPSSGPNANPLDLFPQGLPSMGSNASAG  257

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP 
Sbjct  258   --SLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPA  315

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E ++LGQ A+ MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  316   EGAESDLLGQFASPMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  375

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  376   LDHMHEFED  384


 Score =   124 bits (312),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+QGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIYQGKILKDETTLQ  60

Query  419  ENKVAENNFVVVMM  460
            ++KVAEN+FVV+M+
Sbjct  61   DSKVAENSFVVIML  74



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 203/255 (80%), Gaps = 9/255 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPP-----AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIP  1000
              AE PP     A G          Q AQ  Q AQPA   S        DLFPQ GLP++ 
Sbjct  205   QAEAPPVAQAPASGQMANPPVQAPQPAQAPQPAQPAVPSSGPNANPL-DLFPQQGLPSMG  263

Query  1001  SSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLR  1180
             S+ + G  +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLR
Sbjct  264   SNASAG--SLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLR  321

Query  1181  LINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  1360
             L+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEE
Sbjct  322   LLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  381

Query  1361  LAANYLLDHMHEFED  1405
             LAANYLLDHMHEFED
Sbjct  382   LAANYLLDHMHEFED  396


 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFVVVMM  460
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   342 bits (877),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  136   DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  195

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA    P       QAA P          +  PNANPLDLFPQG+P   +    G
Sbjct  196   QAEIPPA----PQAPATGGQAANPLAQEAAPVPATGGPNANPLDLFPQGMPA--ADAGAG  249

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  250   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  309

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  310   EGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  368

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  369   LDHMHEFEE  377


 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 205/248 (83%), Gaps = 3/248 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLVAG+NLE  IQQILDMG G WDR+TVVRALRAAYNNPERAV+YLYSGIPE
Sbjct  174   DVYSQAASNLVAGSNLEETIQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYLYSGIPE  233

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PPA   P  V      A   Q A   +   S+ PNANPLDLFPQGLPNI  S A G
Sbjct  234   QVEAPPAR-VPSTVQASNPSAQPAQPAQPASVPSSAGPNANPLDLFPQGLPNI-GSGAVG  291

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             + +L+FLRNS QFQALRAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+
Sbjct  292   SGSLDFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEPL  351

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANYL
Sbjct  352   EG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANYL  410

Query  1379  LDHMHEFE  1402
             LDH+HEFE
Sbjct  411   LDHIHEFE  418


 Score =   131 bits (330),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   342 bits (877),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 204/249 (82%), Gaps = 7/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  138   DVYGQAASNLVAGNTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA    P       QAA P          +  PNANPLDLFPQG+P   +    G
Sbjct  198   QAEIPPA----PQAPATGGQAANPLAQEAAPVPATGGPNANPLDLFPQGMPA--ADAGAG  251

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  252   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  311

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  312   EGEE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  370

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  371   LDHMHEFEE  379


 Score =   110 bits (275),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   342 bits (876),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  133   DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  192

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP     P   +         Q A      +  PNANPL+LFPQG+P   +    G
Sbjct  193   QAEIPPV-AQAPATGEQAANPLAQPQQAAAPAAATGGPNANPLNLFPQGMPA--ADAGAG  249

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  250   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  309

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYL
Sbjct  310   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYL  368

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  369   LDHMHEFED  377


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   341 bits (874),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 186/249 (75%), Positives = 202/249 (81%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  133   DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  192

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP      P         Q Q         +  PNANPL+LFPQG+P   +  A G
Sbjct  193   QAEIPPV--AQAPSTGEQPANPQAQPQQAAPVAATGGPNANPLNLFPQGMPA--ADAAAG  248

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQ+FQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  249   AGNLDFLRNSQKFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  308

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  309   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  367

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  368   LDHMHEFED  376


 Score =   114 bits (284),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL GT+FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   341 bits (875),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 206/249 (83%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLVAG+ LE  +Q ILDMGGG+WDRETVVRALRAAYNNPERAV+YLYSG+PE
Sbjct  143   DVYDQAASNLVAGSKLEATVQHILDMGGGSWDRETVVRALRAAYNNPERAVDYLYSGVPE  202

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P      P +     QA  P   A    VPS  PNANPLDLFPQGLPN+  SNAG 
Sbjct  203   QAEIP-PAAPAPALAPASGQAVNPPVQASQPAVPSGGPNANPLDLFPQGLPNV-GSNAGA  260

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FL NS QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  261   GN-LDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  319

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             E  EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYL
Sbjct  320   ES-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYL  378

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  379   LDHMHEFDE  387


 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 200/249 (80%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  133   DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  192

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP      P         Q Q         +  PNANPL+LFPQG+P   +    G
Sbjct  193   QAELPPV--AQAPSTGEQAANPQAQPQQAAPAAATGGPNANPLNLFPQGMPA--ADAGAG  248

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPV
Sbjct  249   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPV  308

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  309   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  367

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  368   LDHMHEFED  376


 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYG AASNLVAG NLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSGIP 
Sbjct  144   DVYGHAASNLVAGTNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSGIPA  203

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P A                  Q       P+  PNANPL+LFPQG+P   +    G
Sbjct  204   QAEIP-AVAPAAATGGQAANPLAQPQQEAAPVPPTGGPNANPLNLFPQGMPA--ADAGAG  260

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  261   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  320

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  321   EGEE-NVIEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  379

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  380   LDHMHEFED  388


 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV   DT++DVKKSIET+ G   YPA+Q MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIEVNETDTISDVKKSIETIHGEQ-YPAAQQMLIHQGKVLKDETTLA  59

Query  419  ENKVAENNFVVVMM  460
            EN V E +F+V+M+
Sbjct  60   ENNVVEKSFIVIML  73



>ref|XP_011655771.1| PREDICTED: ubiquitin receptor RAD23d [Cucumis sativus]
 gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 205/248 (83%), Gaps = 3/248 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLVAG+NLE  +QQILDMG G WDR+TVVRALRAAYNNPERAV+YLYSGIPE
Sbjct  172   DVYSQAASNLVAGSNLEETVQQILDMGEGVWDRDTVVRALRAAYNNPERAVDYLYSGIPE  231

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PPA   P  V      A   Q A   +   S+ PNANPLDLFPQGLPN+  S A G
Sbjct  232   QVEAPPAR-VPSTVQASNPSAQPAQPAQPASAPSSTGPNANPLDLFPQGLPNL-GSGAVG  289

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             + +L+FLRNS QFQALRAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+
Sbjct  290   SGSLDFLRNSPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEPL  349

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EGNILGQLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANYL
Sbjct  350   EG-EGNILGQLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANYL  408

Query  1379  LDHMHEFE  1402
             LDH+HEFE
Sbjct  409   LDHIHEFE  416


 Score =   131 bits (330),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+F+V+M+
Sbjct  61   ENKVAENSFIVIML  74



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   340 bits (871),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  133   DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  192

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP     P   +         Q A      +  PNANPL+LFPQG+P   +    G
Sbjct  193   QAEIPPV-AQAPATGEQAANPLAQPQQAAAPAAATGGPNANPLNLFPQGMPA--ADAGAG  249

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  250   AGNLDFLRNSHQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  309

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYL
Sbjct  310   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYL  368

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  369   LDHMHEFED  377


 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 201/249 (81%), Gaps = 8/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  135   DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  194

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP             + A   QA       +  PNANPL+LFPQG+P   +    G
Sbjct  195   QAELPPV-----AQAPSTGEQAANPQAQPQQAAATGGPNANPLNLFPQGMPA--ADAGAG  247

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPV
Sbjct  248   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPV  307

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  308   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  366

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  367   LDHMHEFED  375


 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   339 bits (869),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 201/249 (81%), Gaps = 8/249 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  133   DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  192

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP             + A   QA       +  PNANPL+LFPQG+P   +    G
Sbjct  193   QAELPPV-----AQAPSTGEQAANPQAQPQQAAATGGPNANPLNLFPQGMPA--ADAGAG  245

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPV
Sbjct  246   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPV  305

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  306   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  364

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  365   LDHMHEFED  373


 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/248 (74%), Positives = 201/248 (81%), Gaps = 3/248 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDRETV+RALRAA+NNPERAVEYLYSGIPE
Sbjct  143   DVYGQAASNLVAGTTLESTVQQILDMGGGSWDRETVIRALRAAFNNPERAVEYLYSGIPE  202

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PPA   P         AA     A     P+   NANPLDLFPQGLPN+  +NAG 
Sbjct  203   QAEIPPAAQVPAGEQAAYPPAANLPAQAPQPAAPTGGSNANPLDLFPQGLPNM-GANAGA  261

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+FLRNS QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPV
Sbjct  262   GN-LDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPV  320

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA-NY  1375
             EGGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV EV+FACNKNEELA+  +
Sbjct  321   EGGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVPEVYFACNKNEELASIPF  380

Query  1376  LLDHMHEF  1399
             L    H+F
Sbjct  381   LCLGWHKF  388


 Score =   120 bits (300),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+F IEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
             N VAEN+F+V+M+
Sbjct  61   ANNVAENSFIVIML  74



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 191/263 (73%), Positives = 210/263 (80%), Gaps = 17/263 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYG AASNLVAG++LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  143   DVYGLAASNLVAGSHLETTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  202

Query  839   SAEVPPAEGnpppvlqppnq--------------aaqpqqaaqpapvpssapnanplDLF  976
              AEVPP    P        Q              A  P   A  A VP++ PNA+PLDLF
Sbjct  203   QAEVPPVARTPAAATATGAQAGNPLAQAGNPLAPAGNPLAQAPQATVPAAGPNASPLDLF  262

Query  977   PQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQ  1156
             PQGLPN+  SNAG A +L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ
Sbjct  263   PQGLPNV-GSNAG-AGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQ  320

Query  1157  EHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVF  1336
             +HQADFLRLINEPVE GEGN+L QL ++MP +V VTPEEREAIERLE MGF RA VL+V+
Sbjct  321   DHQADFLRLINEPVE-GEGNLLSQLTSAMPASVSVTPEEREAIERLEGMGFRRATVLQVY  379

Query  1337  FACNKNEELAANYLLDHMHEFED  1405
             FACNKNEELAANYLLDHM EFE+
Sbjct  380   FACNKNEELAANYLLDHMDEFEN  402


 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+   +DTVADVKKSIE +QG+  YPA+  MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIDANIDDTVADVKKSIEKIQGAETYPANLQMLIHQGKVLKDTTTLG  60

Query  419  ENKVAENNFVVVMM  460
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFLVIML  74



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   337 bits (865),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 203/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG NLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSGIP 
Sbjct  147   DVYGQAASNLVAGTNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSGIPA  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP     P    P        Q    A   +  PNANPL+LFPQG+P   +    G
Sbjct  207   QAEIPPV-AQAPATGGPAAIPQAQPQQEAAAVPATGGPNANPLNLFPQGMPA--ADAGAG  263

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  264   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  323

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             E GE N++ QL A+MPQAV VTPEEREAIERLEAMGF+RA+VLEVFFACNKNEELAANYL
Sbjct  324   E-GEENVIEQLEAAMPQAVTVTPEEREAIERLEAMGFERAMVLEVFFACNKNEELAANYL  382

Query  1379  LDHMHEFED  1405
             LDHMHEF++
Sbjct  383   LDHMHEFDE  391


 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIHQGK+L D +TLE
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIHQGKILNDASTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN VAEN+F+V+M+
Sbjct  60   ENNVAENSFIVIML  73



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   336 bits (862),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSGIP 
Sbjct  137   DVYGQAASNLVAGNNLESTVQQILDMGGGSWDRDTVIRALRAAFNNPERAVEYLYSGIPA  196

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P      P             Q        +  PNANPL+LFPQG+P   +    G
Sbjct  197   QAEIP-PAPQAPATAGQAANPLAQTQQEATPVPATGGPNANPLNLFPQGMPA--ADAGAG  253

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  254   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  313

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  314   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  372

Query  1379  LDHMHEFED  1405
             LDHMHEFE+
Sbjct  373   LDHMHEFEE  381


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V +N+F+V+M+
Sbjct  60   ENNVVDNSFIVIML  73



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 185/249 (74%), Positives = 200/249 (80%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG NLE  IQQILDMGGGTW+R+TVVRAL AA NNPERAVEYLYSGI E
Sbjct  147   DAYGQAASNLVAGGNLEQTIQQILDMGGGTWERDTVVRALHAACNNPERAVEYLYSGILE  206

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E  P      P       +         + VPSS PN NPLDLFPQGLPN+  SNAGG
Sbjct  207   HVEASPL--AQAPASGQAASSPVQASQPVQSAVPSSGPNTNPLDLFPQGLPNM-GSNAGG  263

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNS QFQA +A+VQANPQIL+PMLQELGKQNP +MRLIQEHQ +FL LINEP 
Sbjct  264   G-SLDFLRNSPQFQAFKALVQANPQILRPMLQELGKQNPLVMRLIQEHQDEFLCLINEPA  322

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGE N+LGQLAA+MPQA+ VTPEE EAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  323   EGGESNLLGQLAAAMPQALTVTPEECEAIERLEAMGFDRALVLEVFFACNKNEELAANYL  382

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  383   LDHMHEFED  391


 Score =   122 bits (305),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIHQGK+LKD TT+ 
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIHQGKILKDDTTMN  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+ENNF+++M+
Sbjct  61   DNKVSENNFIIIML  74



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 207/250 (83%), Gaps = 13/250 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LEG IQQILDMGGG WDR+TVVRALRAAYNNPERA++YLYSGIPE
Sbjct  138   DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNNPERAIDYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE              P   A      QPAPVPS  PNANPLDLFPQG P +  SNAGG
Sbjct  198   PAEA-----------PAPAPVANVPAQPQPAPVPSVGPNANPLDLFPQGFPTM-GSNAGG  245

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             AN L+FLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINEP+
Sbjct  246   ANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINEPI  305

Query  1199  EGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAANY
Sbjct  306   EGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAANY  365

Query  1376  LLDHMHEFED  1405
             LLDHMHEFE+
Sbjct  366   LLDHMHEFEE  375


 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 207/250 (83%), Gaps = 13/250 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LEG IQQILDMGGG WDR+TVVRALRAAYNNPERA++YLYSGIPE
Sbjct  139   DVYGQAASNLVAGNILEGTIQQILDMGGGIWDRDTVVRALRAAYNNPERAIDYLYSGIPE  198

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE              P   A      QPAPVPS  PNANPLDLFPQG P +  SNAGG
Sbjct  199   PAEA-----------PAPAPVANVPAQPQPAPVPSVGPNANPLDLFPQGFPTM-GSNAGG  246

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             AN L+FLRN+ QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINEP+
Sbjct  247   ANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINEPI  306

Query  1199  EGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAANY
Sbjct  307   EGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAANY  366

Query  1376  LLDHMHEFED  1405
             LLDHMHEFE+
Sbjct  367   LLDHMHEFEE  376


 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   330 bits (845),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 196/231 (85%), Gaps = 6/231 (3%)
 Frame = +2

Query  716   IQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppn  895
             IQQILDMGGG+WDR+TVVRALRAA+NNPERAV+YLYSGIPE AE PP       +     
Sbjct  2     IQQILDMGGGSWDRDTVVRALRAAFNNPERAVDYLYSGIPEQAEAPPV----TQMPASAQ  57

Query  896   qaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAM  1075
                 P  A Q A VPSS PNANPLDLFPQGLPN+  S   GA +L+FLRNSQQFQALRAM
Sbjct  58    PGNPPAAAPQLANVPSSGPNANPLDLFPQGLPNV-GSGPAGAGSLDFLRNSQQFQALRAM  116

Query  1076  VQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLA-ASMPQA  1252
             VQANPQILQPMLQELGKQNPHLMRLIQ+HQ DFLRLINEPVEGGEGNILGQ A A+MPQA
Sbjct  117   VQANPQILQPMLQELGKQNPHLMRLIQDHQVDFLRLINEPVEGGEGNILGQPAGAAMPQA  176

Query  1253  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             V VTPEEREAIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  177   VSVTPEEREAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  227



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   335 bits (860),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 199/249 (80%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY GIP 
Sbjct  134   DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYMGIPV  193

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P  E    P         QPQ         +  PNANPL+LFPQGLP     +  G
Sbjct  194   QAEIP--EAAQAPPSGGQATNPQPQAQQPVPAALTGGPNANPLNLFPQGLPTTGMDD--G  249

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE  
Sbjct  250   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQG  309

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANYL
Sbjct  310   EGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANYL  368

Query  1379  LDHMHEFED  1405
             LDH+HEFED
Sbjct  369   LDHIHEFED  377


 Score =   122 bits (305),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74



>ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23a [Brassica rapa]
 emb|CDY52848.1| BnaA09g56400D [Brassica napus]
Length=359

 Score =   334 bits (857),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 208/391 (53%), Positives = 260/391 (66%), Gaps = 34/391 (9%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V P DT+  VKK+IE  Q  + YP  Q +LIH GKVLKD TTL 
Sbjct  1     MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV E  F+VVM++K+K++S  G +S+  T+ T + A   +AST  +    ++ + +  
Sbjct  61    ENKVTEEGFLVVMLSKSKTASSAGPSSAQPTSTTTSSAMPAAASTTHSIPVPASVSTLAQ  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P   +             D   QAAS L +G++ E  +QQI++MGGG+WD+ETV RAL
Sbjct  121   EQPAAPS-------------DTNAQAASTLASGSSTEQMVQQIMEMGGGSWDKETVARAL  167

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAV+YLYSGIPE   VP                     A   AP  S  PN+
Sbjct  168   RAAYNNPERAVDYLYSGIPERETVP---------------LTNISGADLAAPPTSGGPNS  212

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PLDLFPQ       + AG   TL+FLR + QFQ LR+MV +NPQILQPMLQELGKQNP 
Sbjct  213   SPLDLFPQEA----EAGAGELGTLDFLRGNDQFQQLRSMVNSNPQILQPMLQELGKQNPQ  268

Query  1139  LMRLIQEHQADFLRLINEPVEG--GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             L+RLIQE+QA+FL+LINEP EG  GE +IL Q    MP AV VTP E+EAI+RLEAMGFD
Sbjct  269   LLRLIQENQAEFLQLINEPYEGSDGEMDILDQPEQEMPHAVNVTPAEQEAIQRLEAMGFD  328

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALV+E F AC++NEELAANYLL++  +FED
Sbjct  329   RALVIEAFLACDRNEELAANYLLENSADFED  359



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/249 (74%), Positives = 199/249 (80%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGN LE  +QQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLY GIP 
Sbjct  135   DVYGQAASNLVAGNKLESTVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYMGIPV  194

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+P  E    P         QPQ         +  PNANPL+LFPQGLP     +  G
Sbjct  195   QAEIP--EAAQAPPSGGQATNPQPQAQQPVPAALTGGPNANPLNLFPQGLPTTGMDD--G  250

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE  
Sbjct  251   AGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQG  310

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANYL
Sbjct  311   EGEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANYL  369

Query  1379  LDHMHEFED  1405
             LDH+HEFED
Sbjct  370   LDHIHEFED  378


 Score =   122 bits (306),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENK+AE  F+V+M+
Sbjct  61   ENKIAEKGFIVIML  74



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 203/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  206   DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSGIPE  265

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+         P                   VPSS PNANPLDLFPQGLP++  SNAG 
Sbjct  266   QADA--PPAAQAPTSGQMANPPVQAPEPAQPAVPSSGPNANPLDLFPQGLPSM-GSNAG-  321

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP 
Sbjct  322   AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPA  381

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  382   EGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  441

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  442   LDHMHEFED  450


 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRNG-DPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+V+M+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFIVIML  112



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 203/249 (82%), Gaps = 4/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  207   DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSGIPE  266

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A+         P                   VPSS PNANPLDLFPQGLP++  SNAG 
Sbjct  267   QADA--PPAAQAPTSGQMANPPVQAPEPAQPAVPSSGPNANPLDLFPQGLPSM-GSNAG-  322

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP 
Sbjct  323   AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPA  382

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  383   EGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  442

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  443   LDHMHEFED  451


 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRNG-DPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+V+M+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFIVIML  112



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   334 bits (857),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 199/249 (80%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  137   DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  196

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP      P         Q Q         +  PNANPL+LFPQG+P   +    G
Sbjct  197   QAELPPV--AQAPSTGEQAANPQAQPQQAAPAAATGGPNANPLNLFPQGMPA--ADAGAG  252

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQF+ALR MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPV
Sbjct  253   AGNLDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPV  312

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  313   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  371

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  372   LDHMHEFED  380


 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 199/249 (80%), Gaps = 5/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG  LE  +QQILDMGGG+WDR+TVVRALRAA+NNPERAVEYLYSGIP 
Sbjct  135   DVYGQAASNLVAGTVLESTVQQILDMGGGSWDRDTVVRALRAAFNNPERAVEYLYSGIPA  194

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE+PP      P         Q Q         +  PNANPL+LFPQG+P   +    G
Sbjct  195   QAELPPV--AQAPSTGEQAANPQAQPQQAAPAAATGGPNANPLNLFPQGMPA--ADAGAG  250

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLRNSQQF+ALR MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPV
Sbjct  251   AGNLDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPV  310

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYL
Sbjct  311   EGEE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYL  369

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  370   LDHMHEFED  378


 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFVVVMM  460
            EN V EN+F+V+M+
Sbjct  60   ENNVVENSFIVIML  73



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 188/224 (84%), Positives = 199/224 (89%), Gaps = 2/224 (1%)
 Frame = +2

Query  734   MGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpq  913
             MGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE AE PP     P V Q  N AAQPQ
Sbjct  1     MGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPEQAEAPPV-ARAPVVGQTTNSAAQPQ  59

Query  914   qaaqpapvpssapnanplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQ  1093
             Q AQ A +P+S PNANPLDLFPQGLPN+ +S AG A TL+FLRNS QFQALRAMVQANPQ
Sbjct  60    QPAQTAAIPASGPNANPLDLFPQGLPNMGASGAG-AGTLDFLRNSPQFQALRAMVQANPQ  118

Query  1094  ILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEE  1273
             ILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQLA +MPQAVQVTPEE
Sbjct  119   ILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQLAEAMPQAVQVTPEE  178

Query  1274  REAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             REAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  179   REAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  222



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   333 bits (854),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 203/280 (73%), Gaps = 34/280 (12%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPP-----AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
              AE PP     A G          Q AQ  Q AQPA   S        DLFPQGLP++ S
Sbjct  205   QAEAPPVAQAPASGQMANPPVQAPQPAQAPQPAQPAVPSSGPNANPL-DLFPQGLPSMGS  263

Query  1004  SNAGGANTLEFLRNSQQFQALRAMVQANPQILQ--------------------------P  1105
             + + G  +L+FLRNS QF+AL+ +VQANPQILQ                          P
Sbjct  264   NASAG--SLDFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQP  321

Query  1106  MLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAI  1285
             MLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAI
Sbjct  322   MLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAI  381

Query  1286  ERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             ERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  382   ERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  421


 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFVVVMM  460
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   331 bits (849),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 198/250 (79%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQQILDMGGGTWDR+TVVRALRAAYNNPERA+EYLYSGIPE
Sbjct  146   DAYGQAASNLVAGNTLEQIIQQILDMGGGTWDRDTVVRALRAAYNNPERAIEYLYSGIPE  205

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              A          P       +           VP   PNANPLDLFPQGLP++  SNAGG
Sbjct  206   HAAA--PPVAQAPPSGQTTDSPIQVPQPVQPAVPMGGPNANPLDLFPQGLPDV-GSNAGG  262

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FL+NS QF+AL+A+VQANPQ LQPMLQELGKQNP ++RLIQEHQ +FLRLINEP 
Sbjct  263   G-SLDFLQNSPQFRALQALVQANPQFLQPMLQELGKQNPQILRLIQEHQGEFLRLINEPA  321

Query  1199  EGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EG EG NILGQL   MPQA+ VTPEE EAIERLEAMGFDRALVL+VFFACNKNEELAANY
Sbjct  322   EGTEGGNILGQLPTGMPQALSVTPEEHEAIERLEAMGFDRALVLQVFFACNKNEELAANY  381

Query  1376  LLDHMHEFED  1405
             LLDHMHEFED
Sbjct  382   LLDHMHEFED  391


 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+EN+F+V+M+
Sbjct  61   ENKVSENSFLVIML  74



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   333 bits (853),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 203/250 (81%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  206   DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSGIPE  265

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIPSSNAG  1015
              A+         P                   VPSS PNANPLDLFPQ GLP++  SNAG
Sbjct  266   QADA--PPAAQAPTSGQMANPPVQAPEPAQPAVPSSGPNANPLDLFPQQGLPSM-GSNAG  322

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
              A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP
Sbjct  323   -AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEP  381

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
              EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  382   AEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  441

Query  1376  LLDHMHEFED  1405
             LLDHMHEFED
Sbjct  442   LLDHMHEFED  451


 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRNG-DPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+V+M+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFIVIML  112



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   333 bits (853),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 203/250 (81%), Gaps = 5/250 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+ LE  +Q ILDMGGGTWDR+TV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  207   DAYGQAASNLVAGSALEQTVQHILDMGGGTWDRDTVIRALRAAYNNPERAVEYLYSGIPE  266

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIPSSNAG  1015
              A+         P                   VPSS PNANPLDLFPQ GLP++  SNAG
Sbjct  267   QADA--PPAAQAPTSGQMANPPVQAPEPAQPAVPSSGPNANPLDLFPQQGLPSM-GSNAG  323

Query  1016  GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP  1195
              A +L+FLRNS QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP
Sbjct  324   -AGSLDFLRNSPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEP  382

Query  1196  VEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
              EG E N+LGQLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY
Sbjct  383   AEGAESNLLGQLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  442

Query  1376  LLDHMHEFED  1405
             LLDHMHEFED
Sbjct  443   LLDHMHEFED  452


 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRNG-DPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMM  460
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+V+M+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFIVIML  112



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 200/248 (81%), Gaps = 8/248 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             +VY  AAS LVAG+NLEGAIQQILDMGGGTWDR+TV+R +RAA+NNPERAVEYLYSGIPE
Sbjct  143   NVYDSAASLLVAGSNLEGAIQQILDMGGGTWDRDTVIRIVRAAFNNPERAVEYLYSGIPE  202

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AE       P P             AA      S+ PNANPLDLFPQGLP++  SNA G
Sbjct  203   QAEA--PPVAPSPPSGQAANPLDQPPAAAQPAPASAGPNANPLDLFPQGLPDM-GSNAAG  259

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A  L+FLR +QQFQALRAMVQ+NPQILQPMLQELGKQNPHLMRLIQEHQADFL+LINEP+
Sbjct  260   AGNLDFLRTNQQFQALRAMVQSNPQILQPMLQELGKQNPHLMRLIQEHQADFLQLINEPM  319

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGE N+LG      PQA+ VTPEER+AIERLEAMGFDR LVLEVFFACNKNEELAANYL
Sbjct  320   EGGE-NLLGH----GPQAISVTPEERDAIERLEAMGFDRELVLEVFFACNKNEELAANYL  374

Query  1379  LDHMHEFE  1402
             LDHMHEFE
Sbjct  375   LDHMHEFE  382


 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+QGKVLKDGTTL 
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIYQGKVLKDGTTLL  60

Query  419  ENKVAENNFVVVMM  460
            EN VAEN+F+V+M+
Sbjct  61   ENNVAENSFIVIML  74



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   328 bits (841),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 187/256 (73%), Positives = 204/256 (80%), Gaps = 9/256 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLE  +QQILDMGGG+WDR+TV+RALRAA+NNPERAVEYLYSGIPE
Sbjct  137   DVYGQAASNLVAGNNLEVIVQQILDMGGGSWDRDTVLRALRAAFNNPERAVEYLYSGIPE  196

Query  839   SAEVPPAEGnpppvlqppnqa-----aqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
              AEVPPA   P         A       P   A  A  P+  PNANPLDLFPQGLP++  
Sbjct  197   QAEVPPAAQVPVGEQAVNPLAGNPPAINPPAQAPQAAAPAGGPNANPLDLFPQGLPSV-G  255

Query  1004  SNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRL  1183
             +NAG  N L+FLRNS QFQALR MVQANPQILQPML ELGKQNPHLM+LIQ HQADFLRL
Sbjct  256   ANAGAGN-LDFLRNSPQFQALRTMVQANPQILQPMLLELGKQNPHLMQLIQAHQADFLRL  314

Query  1184  INEPV--EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNE  1357
             INEPV   G    +    +A+MPQAV VTPEEREAIERLEAMGF+RALVLEV+FACNKNE
Sbjct  315   INEPVEGGGEGNLLGQLGSAAMPQAVTVTPEEREAIERLEAMGFERALVLEVYFACNKNE  374

Query  1358  ELAANYLLDHMHEFED  1405
             ELAANYLLDHMHEFE+
Sbjct  375   ELAANYLLDHMHEFEE  390


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/281 (67%), Positives = 203/281 (72%), Gaps = 35/281 (12%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN LE  IQ ILDMGGGTWDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  145   DAYGQAASNLVAGNALEQTIQHILDMGGGTWDRDTVVRALRAAYNNPERAVEYLYSGIPE  204

Query  839   SAEVPP-----AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIP  1000
              AE PP     A G          Q AQ  Q AQPA   S        DLFPQ GLP++ 
Sbjct  205   QAEAPPVAQAPASGQMANPPVQAPQPAQAPQPAQPAVPSSGPNANPL-DLFPQQGLPSMG  263

Query  1001  SSNAGGANTLEFLRNSQQFQALRAMVQANPQILQ--------------------------  1102
             S+ + G  +L+FLRNS QF+AL+ +VQANPQILQ                          
Sbjct  264   SNASAG--SLDFLRNSPQFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQ  321

Query  1103  PMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREA  1282
             PMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREA
Sbjct  322   PMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREA  381

Query  1283  IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  382   IERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  422


 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFVVVMM  460
            +NKVAEN+F+V+M+
Sbjct  61   DNKVAENSFIVIML  74



>ref|XP_008462954.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Cucumis melo]
Length=364

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 244/369 (66%), Gaps = 12/369 (3%)
 Frame = +2

Query  314   VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFVVVMMaktksssgegs  493
             VKK+IE VQG + YP  Q +LIH GKVLKD +TL ENKV+E  F+VVM++K+K+S+  G 
Sbjct  3     VKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLAENKVSEEGFLVVMLSKSKTSASAGQ  62

Query  494   asstattktiapasstsastapapvpasapapvpasapvpvaapaptpaptagsgDV---  664
             +S+             S++ A    P+  PAP   +     A    T      + +V   
Sbjct  63    SSTQPAQNPPVAQPVLSSTPAAQVTPSPTPAPQAPTQAPSSALKNTTSTSDRVTDNVQTD  122

Query  665   -YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
              YGQAASNLVAGNNLE  +QQ++DMGGGTWDRETVVRALRAAYNNPERAV+YLYSGIPES
Sbjct  123   TYGQAASNLVAGNNLEQTVQQLMDMGGGTWDRETVVRALRAAYNNPERAVDYLYSGIPES  182

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQ-GLPNIPSSNAGG  1018
             AEV    G               +  A      S APN  PL++FPQ  L        G 
Sbjct  183   AEVAVPVG-------RFGSGQATETDASVPAPVSGAPNTAPLNMFPQEALSAGGGGGGGN  235

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +LEFLRN+ QFQALR MV  NPQILQPMLQELGKQNP L+RLIQ+H A+FL+LINEPV
Sbjct  236   LGSLEFLRNNPQFQALRTMVHTNPQILQPMLQELGKQNPQLLRLIQDHHAEFLQLINEPV  295

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +  EG +  Q    MP A+ VTP E+ AIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  296   DNFEGEMFEQAEPDMPHAINVTPAEQAAIERLEAMGFDRALVIEAFLACDRNEELAANYL  355

Query  1379  LDHMHEFED  1405
             L++  +F+D
Sbjct  356   LENSGDFDD  364



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 177/268 (66%), Positives = 197/268 (74%), Gaps = 19/268 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLE  IQQILDMGGG+WDR+TVVRALRAAYNNPERAVEYLYSGIPE
Sbjct  136   DVYGQAASNLVAGNNLEHVIQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPE  195

Query  839   SAEVPP-----AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPS  1003
             +AEV P                    A    AA  +    + PNA PLDLFPQGLPN+ +
Sbjct  196   TAEVAPPVARPTPSVGQAANPTAPAPAAAAAAAAASATAQAGPNAAPLDLFPQGLPNLGA  255

Query  1004  SNAGGANTL--------------EFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHL  1141
                 GA                 +FLRN+ QFQALR MVQANPQILQPMLQEL KQNP L
Sbjct  256   GAGAGAGAGLGAGAGAGAGAGALDFLRNNPQFQALRTMVQANPQILQPMLQELSKQNPQL  315

Query  1142  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  1321
             MRLIQ+HQADFLRL+NEPVEG EG+   QLA +MPQA+ VTPEEREAIERLEAMGFDRAL
Sbjct  316   MRLIQDHQADFLRLVNEPVEGAEGDFFNQLAGAMPQAINVTPEEREAIERLEAMGFDRAL  375

Query  1322  VLEVFFACNKNEELAANYLLDHMHEFED  1405
             V+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  376   VIEAFLACDKNEQLAANYLLEHAGDYED  403


 Score =   107 bits (268),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG HF+IEV+P DTV +VKK IE VQG+  YP+ Q +LI+QGKVLKD TT+E
Sbjct  1    MKVSVKTLKGNHFDIEVQPTDTVLNVKKQIEQVQGAQTYPSEQQLLIYQGKVLKDETTIE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV EN F+VVM+
Sbjct  61   ENKVTENTFLVVML  74



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   317 bits (812),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 188/249 (76%), Gaps = 16/249 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAAS+LVAG NLEG IQQILDMGGGTWDR+TVVRALRAA+NNP RA++YLYSGIPE
Sbjct  127   DSYGQAASDLVAGTNLEGTIQQILDMGGGTWDRDTVVRALRAAFNNPARAIDYLYSGIPE  186

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E PPA                 Q    P   P SA  A+     P   P  P S    
Sbjct  187   QPEAPPA----------VRIPVGGQVTNPPPQPPQSAQPASAPPSRPNANPLKPFSTG--  234

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
                L+FLR++QQFQALR+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP 
Sbjct  235   --NLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPA  292

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EGGEGN LG   A++PQA+ +TPEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYL
Sbjct  293   EGGEGNALGD--AAVPQAIAITPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYL  350

Query  1379  LDHMHEFED  1405
             LDHMHEFED
Sbjct  351   LDHMHEFED  359


 Score =   128 bits (321),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVV+M+
Sbjct  61   ENKVAENSFVVIML  74



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   315 bits (808),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 195/248 (79%), Gaps = 9/248 (4%)
 Frame = +2

Query  662   VYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPES  841
              YGQA SNL+AG+NLE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYLYSGIPE 
Sbjct  139   TYGQAESNLIAGSNLESTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYLYSGIPEQ  198

Query  842   AEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGA  1021
             A+ P              QA  P   A    VP+  PN NPL+LFP+G+PN+ +++  G 
Sbjct  199   ADAP-----AVAASTNVGQAENPSIQAPQPAVPTGGPNTNPLNLFPEGIPNLGANDNAG-  252

Query  1022  NTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  1201
               LEFLRNS QFQALR MVQANPQILQPMLQELGKQNPHLM LIQEHQADFLRLINEP  
Sbjct  253   -DLEFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMELIQEHQADFLRLINEP--  309

Query  1202  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  1381
             GGE N+  QL A++PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYLL
Sbjct  310   GGEENLESQLGAAVPQTITITPEEHEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLL  369

Query  1382  DHMHEFED  1405
             DH +EF+D
Sbjct  370   DHQNEFDD  377


 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHFEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN+VAEN+FVV+M+
Sbjct  61   ENQVAENSFVVIML  74



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/258 (67%), Positives = 199/258 (77%), Gaps = 11/258 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLEG +Q IL+MGGG WDR+TV+RALRAAYNNPERAVEYLY+G+PE
Sbjct  144   DNYGQAASNLVAGSNLEGTVQSILEMGGGAWDRDTVMRALRAAYNNPERAVEYLYTGVPE  203

Query  839   SAE---------VPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLP  991
              AE         VP A    P               +    +PSS PNANPLDLFPQ LP
Sbjct  204   QAEAPAAVQALPVPAAVQALPVPAAVQPVDPSQAPQSAQLSIPSSGPNANPLDLFPQVLP  263

Query  992   NIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  1171
             N  S+NAGG N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+
Sbjct  264   NA-SANAGGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAE  321

Query  1172  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  1351
             FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFFACNK
Sbjct  322   FLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFFACNK  381

Query  1352  NEELAANYLLDHMHEFED  1405
             +E+LAANYLLDHM+EF+D
Sbjct  382   DEQLAANYLLDHMNEFDD  399


 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV ENNF+V+M+
Sbjct  61   ENKVVENNFIVIML  74



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   311 bits (796),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 172/258 (67%), Positives = 198/258 (77%), Gaps = 11/258 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLEG +Q IL+MGGG WDR+TV+RALRAAYNNPERAVEYLY+G+PE
Sbjct  144   DNYGQAASNLVAGSNLEGTVQSILEMGGGAWDRDTVMRALRAAYNNPERAVEYLYTGVPE  203

Query  839   SAE---------VPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLP  991
              AE         VP A    P               +    +PSS PNANPLDLFPQ LP
Sbjct  204   QAEAPAAVQALPVPAAVQALPVPAAVQPVDPSQAPQSAQLSIPSSGPNANPLDLFPQVLP  263

Query  992   NIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  1171
             N  S+NAGG N L+ LRN+ QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+
Sbjct  264   NA-SANAGGGN-LDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAE  321

Query  1172  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  1351
             FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFFACNK
Sbjct  322   FLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFFACNK  381

Query  1352  NEELAANYLLDHMHEFED  1405
             +E LAANYLLDHM+EF+D
Sbjct  382   DELLAANYLLDHMNEFDD  399


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV ENNF+V+M+
Sbjct  61   ENKVVENNFIVIML  74



>ref|NP_974181.1| ubiquitin receptor RAD23b [Arabidopsis thaliana]
 gb|AEE36280.1| putative DNA repair protein RAD23-1 [Arabidopsis thaliana]
Length=351

 Score =   306 bits (784),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 196/391 (50%), Positives = 252/391 (64%), Gaps = 42/391 (11%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+HFEI V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD T+L 
Sbjct  1     MKLTVKTLKGSHFEIRVLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLV  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             ENKV E  F+VVM++K+KS    G AS   ++ +   +++TS++   AP    +     +
Sbjct  61    ENKVTEEGFLVVMLSKSKSGGSAGQASVQTSSVSQPVSATTSSTKPAAPSTTQSSPVPAS  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
               P      A T        D YGQAAS LV+G++LE  +QQI++MGGG+WD+ETV RAL
Sbjct  121   PIPAQEQPAAQT--------DTYGQAASTLVSGSSLEQMVQQIMEMGGGSWDKETVTRAL  172

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAV+YLYSGIP++AEV            P  +A      A P    S  PN+
Sbjct  173   RAAYNNPERAVDYLYSGIPQTAEV----------AVPVPEAQIAGSGAAPVAPASGGPNS  222

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             +PLDLFPQ    + ++ +G   TLEFLRN+ Q                    ELGKQNP 
Sbjct  223   SPLDLFPQ--ETVAAAGSGDLGTLEFLRNNDQ--------------------ELGKQNPQ  260

Query  1139  LMRLIQEHQADFLRLINEPVEG--GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFD  1312
             L+RLIQE+QA+FL+L+NEP EG  GEG++  Q    MP A+ VTP E+EAI+RLEAMGFD
Sbjct  261   LLRLIQENQAEFLQLVNEPYEGSDGEGDMFDQPEQEMPHAINVTPAEQEAIQRLEAMGFD  320

Query  1313  RALVLEVFFACNKNEELAANYLLDHMHEFED  1405
             RALV+E F AC++NEELAANYLL++  +FED
Sbjct  321   RALVIEAFLACDRNEELAANYLLENSGDFED  351



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 187/242 (77%), Gaps = 8/242 (3%)
 Frame = +2

Query  680   SNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESAEVPPA  859
             SNL+AG+ LE  IQQIL+MGGG+WDR+TV+RALRAAYNNPERAVEYLYSGIPE AE P  
Sbjct  137   SNLIAGSTLEPTIQQILEMGGGSWDRDTVIRALRAAYNNPERAVEYLYSGIPEQAEAP--  194

Query  860   EGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGANTLEFL  1039
                               QA     VP+  PN NPL+LFPQG+PN+ ++   G   LEFL
Sbjct  195   --AVAASTNVGQAENPSAQAPAQLAVPAVGPNTNPLNLFPQGIPNLGANENAG--DLEFL  250

Query  1040  RNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNI  1219
             RNSQQFQALR MVQANPQILQPMLQELGKQNP+LM LIQEHQADFLRLINEP  GGE N+
Sbjct  251   RNSQQFQALRTMVQANPQILQPMLQELGKQNPNLMELIQEHQADFLRLINEP--GGEENL  308

Query  1220  LGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  1399
              GQL A  PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH +EF
Sbjct  309   EGQLGALAPQTITITPEENEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQNEF  368

Query  1400  ED  1405
             +D
Sbjct  369   DD  370


 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN+VAEN+F+V+M+
Sbjct  61   ENQVAENSFIVIML  74



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 172/257 (67%), Positives = 199/257 (77%), Gaps = 8/257 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLV+GNNLE  IQQILDMGGGTW+R+TV+RALRAAYNNPERA++YLYSGIPE
Sbjct  151   DVYSQAASNLVSGNNLEQTIQQILDMGGGTWERDTVIRALRAAYNNPERAIDYLYSGIPE  210

Query  839   SAEVPP---AEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSN  1009
             + E PP   A  +          A             S+ PNANPL+LFPQG+P+  ++ 
Sbjct  211   NVEAPPVARAPASGQQTNPQAPPAQPAVAPPVQPSAASAGPNANPLNLFPQGVPSGGANP  270

Query  1010  AGGANT----LEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL  1177
             A GA      L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FL
Sbjct  271   AAGAGAGAGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFL  330

Query  1178  RLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKN  1354
             RL+NE  EGG G NILGQLAA+MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACNK+
Sbjct  331   RLVNESPEGGAGGNILGQLAAAMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNKD  390

Query  1355  EELAANYLLDHMHEFED  1405
             EELAANYLLDH HEF++
Sbjct  391   EELAANYLLDHGHEFDE  407


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT FEIE  PE++VA+VKK IET QG  VYPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEASPEESVAEVKKIIETTQGE-VYPADQQMLIYQGKILKDDTTLE  59

Query  419  ENKVAENNFVVVMM  460
             NKVAEN+F+V+M+
Sbjct  60   SNKVAENSFLVIML  73



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   304 bits (779),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 193/249 (78%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  123   DTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRALRAAYNNPERAVDYLYSGIPE  182

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAEV          +   + +   +  A PA   S APN++PL++FPQ    +  + AGG
Sbjct  183   SAEV-------AVPVARFSTSQTTETGAAPAAPVSGAPNSSPLNMFPQ--ETLSGAAAGG  233

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  234   DGSLDFLRNNQQFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  293

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  294   EGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  353

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  354   LENGGDFED  362


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E+ F+VVM+
Sbjct  61   ENKVSEDGFLVVML  74



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 190/249 (76%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAGNNLE   QQI+DMGGG WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  133   DVYGQAASNLVAGNNLEQITQQIMDMGGGNWDKETVTRALRAAYNNPERAVDYLYSGIPE  192

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             + EV     + P                  +   S APN++PL+LFPQ   N PS+ AGG
Sbjct  193   ATEVAVPVASFPSNQASGGANPTIDTGVAGSAPLSGAPNSSPLNLFPQETLN-PSAAAGG  251

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRNSQQFQALR+MVQANPQILQPMLQEL KQNP L+RLIQEH A+FL+LINEP+
Sbjct  252   --SLDFLRNSQQFQALRSMVQANPQILQPMLQELSKQNPQLLRLIQEHHAEFLQLINEPL  309

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYL
Sbjct  310   EGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYL  369

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  370   LENAGDFED  378


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTVMAVKKNIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   QNKVSEDGFLVVML  74



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   303 bits (775),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 194/249 (78%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             + Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  123   NTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRALRAAYNNPERAVDYLYSGIPE  182

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAEV          +   + +   +  A PA   S APN++PL++FPQ    +  + AGG
Sbjct  183   SAEV-------AVPVAHFSTSQTTETGAAPAAPVSGAPNSSPLNMFPQ--ETLSGAAAGG  233

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  234   DGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  293

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG+I  Q    MP AV VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  294   EGSEGDIFDQAEQEMPHAVNVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  353

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  354   LENGGDFED  362


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIIKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E+ F+VVM+
Sbjct  61   ENKVSEDGFLVVML  74



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 193/249 (78%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN+LE  IQQI+DMGGGTWD+ETV RAL+AAYNNPERAV+YLYSGIPE
Sbjct  62    DTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPE  121

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV          +     +   +  A  A   S  PN++PL++FPQ    +  + AGG
Sbjct  122   TAEV-------AVPVAHFPASQAAETGAAGAAPVSGVPNSSPLNMFPQE--TLSGAPAGG  172

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEHQ +FL+LINEPV
Sbjct  173   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHQTEFLQLINEPV  232

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  233   DGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYL  292

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  293   LENAGDFED  301



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 193/249 (78%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAGN+LE  IQQI+DMGGGTWD+ETV RAL+AAYNNPERAV+YLYSGIPE
Sbjct  138   DTYGQAASNLVAGNDLEQTIQQIMDMGGGTWDKETVTRALQAAYNNPERAVDYLYSGIPE  197

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV          +     +   +  A  A   S  PN++PL++FPQ    +  + A G
Sbjct  198   TAEV-------AVPVAHFPASQAAETGAAGAAPVSGVPNSSPLNMFPQE--TLSGAPASG  248

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINEPV
Sbjct  249   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPV  308

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG++  Q    MP A+ VTP E+EAI+RLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  309   DGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEAMGFDRALVIEAFLACDRNEELAANYL  368

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  369   LENAGDFED  377


 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_009615678.1| PREDICTED: ubiquitin receptor RAD23b [Nicotiana tomentosiformis]
Length=367

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/251 (61%), Positives = 181/251 (72%), Gaps = 13/251 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAGNNLE  IQQI+DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  128   DDYSQAASNLVAGNNLEQTIQQIMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPE  187

Query  839   SAEV--PPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNA  1012
             +AEV  P A G              P      +            +LFPQ   N+  +N 
Sbjct  188   TAEVAAPVAHGGVNSAAGTTAAPTAPSSGGPNSAPL---------NLFPQ--ENVAGANG  236

Query  1013  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  1192
              G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINE
Sbjct  237   AGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINE  296

Query  1193  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             PV+G +G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  297   PVDGSDGDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAAN  356

Query  1373  YLLDHMHEFED  1405
             YLL+H  ++ED
Sbjct  357   YLLEHAGDYED  367


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIMAVKKHIEDVQGKDNYPCGQQLLIHNGKVLKDESTLV  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E+ F+VVM+
Sbjct  61   ENKVSEDGFLVVML  74



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   301 bits (772),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 190/249 (76%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLE  IQQI+DMGGG WDRETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  182   DTYGQAASNLVAGSNLEQTIQQIMDMGGGNWDRETVTRALRAAYNNPERAVDYLYSGIPE  241

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV         V      A+Q  +        S APN+ PL++FPQ      +   G 
Sbjct  242   AAEV--------AVPVARFPASQATETGATTAPASGAPNSAPLNMFPQETLAG-AGAGGA  292

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQ LR+MVQANPQILQPMLQELGKQNP L+RLIQEHQA+FL+LINEP+
Sbjct  293   LGSLDFLRNNQQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHQAEFLQLINEPL  352

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG+I  Q    MP A+ VTPEE+EAIERLEAMGFDRALV+E + AC++NEELAANYL
Sbjct  353   EGSEGDIFDQPEQDMPHAINVTPEEQEAIERLEAMGFDRALVIEAYLACDRNEELAANYL  412

Query  1379  LDHMHEFED  1405
             L+H  +FED
Sbjct  413   LEHAGDFED  421


 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGRHFEIRVQPADTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E+ F+VVM+
Sbjct  61   ENKVSEDGFLVVML  74



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   299 bits (765),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 192/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAG+NLE  IQQ++DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  134   DTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPE  193

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEV          +     +   +  A P    S APN++PL++FPQ    +  + AGG
Sbjct  194   LAEV-------AVPVPHFPSSQTTESGAAPVAPVSGAPNSSPLNMFPQE--TLSGAAAGG  244

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  245   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  304

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  305   QGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  364

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  365   LENSGDFED  373


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   299 bits (766),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 161/249 (65%), Positives = 188/249 (76%), Gaps = 3/249 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             +VYGQAASNLVAGNNLE  IQQI+DMGGG WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  142   NVYGQAASNLVAGNNLEQTIQQIMDMGGGIWDKETVTRALRAAYNNPERAVDYLYSGIPE  201

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             S EV     + P +  P                 S  PN++PL+LFPQ   N   S A G
Sbjct  202   STEVAVPVAHFPSIQAPDRPNPTNDTGVAGTAPVSGLPNSSPLNLFPQETLN---SGAVG  258

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQANPQILQPMLQEL KQNP L+RLIQEH A+FL+LINEP+
Sbjct  259   DGSLDFLRNNQQFQALRSMVQANPQILQPMLQELSKQNPQLLRLIQEHHAEFLQLINEPL  318

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYL
Sbjct  319   EGSEGDLFDQPEQDMPHAISVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYL  378

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  379   LENAGDFED  387


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 202/261 (77%), Gaps = 15/261 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLV+GNNLE  IQQILDMGGGTW+R TVVRALRAAYNNPERA++YLYSGIPE
Sbjct  142   DVYSQAASNLVSGNNLEQTIQQILDMGGGTWERGTVVRALRAAYNNPERAIDYLYSGIPE  201

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanpl----DLFPQGLPN----  994
             + E PP  G P    Q   QA  P Q A   PV SSA +A P     +LFPQG+P+    
Sbjct  202   NVEAPPVAGAPAAGQQTNQQAPSPAQPAAAPPVQSSAASARPNANPLNLFPQGVPSGGAN  261

Query  995   ---IPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ  1165
                +P   A G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+Q
Sbjct  262   PGVVP---AAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQ  318

Query  1166  ADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFA  1342
             A+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE MGF+R LVLEVFFA
Sbjct  319   AEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGMGFNRELVLEVFFA  378

Query  1343  CNKNEELAANYLLDHMHEFED  1405
             CNK+EELAANYLLDH HEF++
Sbjct  379   CNKDEELAANYLLDHGHEFDE  399


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VA+VK+ IET QG + YPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVAEVKRIIETTQGQSTYPADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
             N VAEN+F+V+M+
Sbjct  61   SNGVAENSFLVIML  74



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 191/250 (76%), Gaps = 8/250 (3%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             + YGQAASNLVAG NLE  IQ IL+MGGGTWDR+TV+RALRAA+NNPERAVEYLYSGIPE
Sbjct  149   ETYGQAASNLVAGGNLEATIQSILEMGGGTWDRDTVLRALRAAFNNPERAVEYLYSGIPE  208

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               E+      P P              A    V SS PNA+PLDLFPQ LPN  S+NA G
Sbjct  209   PMEI------PAPPPSAQPADPVQALQATQPAVASSGPNASPLDLFPQALPNA-SANAAG  261

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
                L+ LRN+ QF++L ++VQANPQILQP+LQELGKQNP +++LIQ++QA+FLRLINEP 
Sbjct  262   EGNLDVLRNNAQFRSLLSLVQANPQILQPLLQELGKQNPQILQLIQDNQAEFLRLINEPA  321

Query  1199  EGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  1375
             EG E  N+L Q A  +PQ + VTPEE EAI RLE MGFDRALVLEV+FACNK+E LAANY
Sbjct  322   EGDEDENLLDQFAEGVPQTIAVTPEENEAILRLEGMGFDRALVLEVYFACNKDETLAANY  381

Query  1376  LLDHMHEFED  1405
             LLDHM+EF+D
Sbjct  382   LLDHMNEFDD  391


 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F+IEV P D V+DVKK IE+ QG NVYPA Q MLIHQG VLKD TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVNPADKVSDVKKLIESSQGQNVYPADQQMLIHQGTVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            E+KV ENNF+V+M+
Sbjct  61   ESKVLENNFLVIML  74



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 193/255 (76%), Gaps = 17/255 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLE  +QQI+DMGGGTWD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  115   DTYGQAASNLVAGSNLEQTLQQIMDMGGGTWDKETVTRALRAAYNNPERAVDYLYSGIPE  174

Query  839   SAEVP------PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIP  1000
             +AEV       PA+           QA +   A         APN++PL++FP+ +    
Sbjct  175   TAEVAVPVARFPAD-----------QATETGAAPAAPAPAFGAPNSSPLNMFPETISGGG  223

Query  1001  SSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLR  1180
                 GG  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+
Sbjct  224   GGAGGGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQ  283

Query  1181  LINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  1360
             LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+
Sbjct  284   LINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQ  343

Query  1361  LAANYLLDHMHEFED  1405
             LAANYLL++  +FED
Sbjct  344   LAANYLLENAGDFED  358


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI+V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIKVHPTDTIMGVKKNIEDAQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV E+ F+VVM+
Sbjct  61   DNKVTEDGFLVVML  74



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   297 bits (760),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 193/255 (76%), Gaps = 17/255 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLE  +QQI+DMGGGTWD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  129   DTYGQAASNLVAGSNLEQTLQQIMDMGGGTWDKETVTRALRAAYNNPERAVDYLYSGIPE  188

Query  839   SAEVP------PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIP  1000
             +AEV       PA+           QA +   A         APN++PL++FP+ +    
Sbjct  189   TAEVAVPVARFPAD-----------QATETGAAPAAPAPAFGAPNSSPLNMFPETISGGG  237

Query  1001  SSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLR  1180
                 GG  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+
Sbjct  238   GGAGGGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQ  297

Query  1181  LINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  1360
             LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+
Sbjct  298   LINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQ  357

Query  1361  LAANYLLDHMHEFED  1405
             LAANYLL++  +FED
Sbjct  358   LAANYLLENAGDFED  372


 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI+V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIKVHPTDTIMGVKKNIEDAQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV E+ F+VVM+
Sbjct  61   DNKVTEDGFLVVML  74



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 177/210 (84%), Gaps = 3/210 (1%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVYGQAASNLVAG+NLE  +QQILDMGGG+WDRETV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  157   DVYGQAASNLVAGSNLEATVQQILDMGGGSWDRETVIRALRAAYNNPERAVEYLYSGIPE  216

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
                VPP         Q  N  AQ Q     AP P+S PNANPLDLFPQGLPN+  SNAG 
Sbjct  217   QTAVPPV-ARASAGGQAGNPPAQTQAQQPAAPAPTSGPNANPLDLFPQGLPNM-GSNAG-  273

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
             A TL+FLRNSQQFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPV
Sbjct  274   AGTLDFLRNSQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPV  333

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIE  1288
             EGGEGN+LGQLA++MPQAV VTPEEREAIE
Sbjct  334   EGGEGNVLGQLASAMPQAVTVTPEEREAIE  363


 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKVAEN+FVVVM+
Sbjct  61   ENKVAENSFVVVML  74



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   294 bits (753),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 192/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAG+NLE  IQQ++DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  66    DTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPE  125

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEV          +     +   +  A P    S APN++PL++FPQ    +  + AGG
Sbjct  126   LAEV-------AVPVPHFPSSQTTESGAAPVAPVSGAPNSSPLNMFPQE--TLSGAAAGG  176

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  177   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  236

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  237   QGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  296

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  297   LENSGDFED  305



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   296 bits (758),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 192/255 (75%), Gaps = 17/255 (7%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLE  IQQI+DMGGGTWD+E V RALRAAYNNPERAV+YLYSGIPE
Sbjct  129   DTYGQAASNLVAGSNLEQTIQQIMDMGGGTWDKEIVTRALRAAYNNPERAVDYLYSGIPE  188

Query  839   SAEVP------PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIP  1000
             +AEV       PA+           QA +   A         APN++PL++FP+ +    
Sbjct  189   TAEVAVPVARFPAD-----------QATETGAAPAAPAPAFGAPNSSPLNMFPETISGGG  237

Query  1001  SSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLR  1180
                 GG  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+
Sbjct  238   GGAGGGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQ  297

Query  1181  LINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  1360
             LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+
Sbjct  298   LINEPLDGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQ  357

Query  1361  LAANYLLDHMHEFED  1405
             LAANYLL++  +FED
Sbjct  358   LAANYLLENAGDFED  372


 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI+V P DT+  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIKVHPTDTIMGVKKNIEDAQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            ++KV E+ F+VVM+
Sbjct  61   DSKVTEDGFLVVML  74



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 192/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAAS+LVAGNNLE +IQQ++DMGGGTW+RE VVRALRAAYNNPERAV+YLYSGIPE
Sbjct  149   DAYSQAASHLVAGNNLEESIQQLMDMGGGTWEREMVVRALRAAYNNPERAVDYLYSGIPE  208

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE+         V      +   +  A      S APN +PL+LFPQ   +  ++  GG
Sbjct  209   SAEI--------AVPGVHPASQANEAGAAAPVPTSGAPNTSPLNLFPQEALSS-AAGGGG  259

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  260   LGTLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  319

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  320   DGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  379

Query  1379  LDHMHEFED  1405
             L+H  +FED
Sbjct  380   LEHAGDFED  388


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEI+V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGTNFEIKVQPTDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 192/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAAS+LVAGNNLE +IQQ++DMGGGTW+RE VVRALRAAYNNPERAV+YLYSGIPE
Sbjct  148   DAYSQAASHLVAGNNLEESIQQLMDMGGGTWEREMVVRALRAAYNNPERAVDYLYSGIPE  207

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE+         V      +   +  A      S APN +PL+LFPQ   +  ++  GG
Sbjct  208   SAEI--------AVPGVHPASQANEAGAAAPVPTSGAPNTSPLNLFPQEALSS-AAGGGG  258

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  259   LGTLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  318

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  319   DGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  378

Query  1379  LDHMHEFED  1405
             L+H  +FED
Sbjct  379   LEHAGDFED  387


 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEI+V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGTNFEIKVQPTDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 191/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAG+NLE  IQQ++DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  134   DTYSQAASNLVAGSNLEQTIQQLMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPE  193

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
              AEV          +     +   +  A P    S APN++PL++FPQ    +  + AGG
Sbjct  194   LAEV-------AVPVPHFPSSQTTESGAAPVAPVSGAPNSSPLNMFPQE--TLSGAAAGG  244

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPML ELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  245   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLLELGKQNPQLLRLIQEHHAEFLQLINEPL  304

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  305   QGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  364

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  365   LENSGDFED  373


 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 192/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAAS+LVAGNNLE +IQQ++DMGGGTW+RE VVRALRAAYNNPERAV+YLYSGIPE
Sbjct  134   DAYSQAASHLVAGNNLEESIQQLMDMGGGTWEREMVVRALRAAYNNPERAVDYLYSGIPE  193

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE+         V      +   +  A      S APN +PL+LFPQ   +  ++  GG
Sbjct  194   SAEI--------AVPGVHPASQANEAGAAAPVPTSGAPNTSPLNLFPQEALSS-AAGGGG  244

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  245   LGTLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  304

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  305   DGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  364

Query  1379  LDHMHEFED  1405
             L+H  +FED
Sbjct  365   LEHAGDFED  373


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEI+V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGTNFEIKVQPTDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 192/249 (77%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAAS+LVAGNNLE +IQQ++DMGGGTW+RE VVRALRAAYNNPERAV+YLYSGIPE
Sbjct  135   DAYSQAASHLVAGNNLEESIQQLMDMGGGTWEREMVVRALRAAYNNPERAVDYLYSGIPE  194

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAE+         V      +   +  A      S APN +PL+LFPQ   +  ++  GG
Sbjct  195   SAEI--------AVPGVHPASQANEAGAAAPVPTSGAPNTSPLNLFPQEALSS-AAGGGG  245

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               TL+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  246   LGTLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  305

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  306   DGSEGDIFDQPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  365

Query  1379  LDHMHEFED  1405
             L+H  +FED
Sbjct  366   LEHAGDFED  374


 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEI+V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGTNFEIKVQPTDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 166/257 (65%), Positives = 193/257 (75%), Gaps = 11/257 (4%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             Y QAASNLV+GNNLE  IQQILDMGGGTW+R+TVVRALRAAYNNPERA++YLYSGIPE+ 
Sbjct  147   YSQAASNLVSGNNLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAIDYLYSGIPENV  206

Query  845   EVPPAE----GnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNA  1012
             E  P             Q  + A             S+ PNANPL+LFPQG+P+   SN 
Sbjct  207   EAQPVARAPAAGQQTNQQAASPAQPAVALPVQPSPASAGPNANPLNLFPQGVPSG-GSNP  265

Query  1013  G-----GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL  1177
             G     G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FL
Sbjct  266   GVVPGAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFL  325

Query  1178  RLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKN  1354
             RL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+
Sbjct  326   RLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKD  385

Query  1355  EELAANYLLDHMHEFED  1405
             EEL ANYLLDH HEF++
Sbjct  386   EELTANYLLDHGHEFDE  402


 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VADVK+ IET QG + Y A Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVADVKRIIETTQGQSTYRADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
             N VAEN+F+V+M+
Sbjct  61   SNGVAENSFLVIML  74



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   296 bits (757),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 174/261 (67%), Positives = 200/261 (77%), Gaps = 15/261 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLV+GNNLE  IQQILDMGGGTW+R TVVRALRAAYNNPERA++YLYSGIPE
Sbjct  142   DVYSQAASNLVSGNNLEQTIQQILDMGGGTWERGTVVRALRAAYNNPERAIDYLYSGIPE  201

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanpl----DLFPQGLPN----  994
             + E PP    P    Q   QA  P Q A   PV SSA +A P     +LFPQG+P+    
Sbjct  202   NVEAPPVARAPAAGQQTNQQAPSPAQPAAAPPVQSSAASARPNANPLNLFPQGVPSGGAN  261

Query  995   ---IPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ  1165
                +P   A G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+Q
Sbjct  262   PGVVP---AAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQ  318

Query  1166  ADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFA  1342
             A+F+RL+NE  EGG G NILGQLAA+MPQ+V VTPEEREAI+RLE MGF+  LVLEVFFA
Sbjct  319   AEFVRLVNETPEGGPGGNILGQLAAAMPQSVTVTPEEREAIQRLEGMGFNHELVLEVFFA  378

Query  1343  CNKNEELAANYLLDHMHEFED  1405
             CNK+EELAANYLLDH HEF++
Sbjct  379   CNKDEELAANYLLDHGHEFDE  399


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VA+VK+ IET QG + YPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVAEVKRIIETTQGQSTYPADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
             N VAEN+F+V+M+
Sbjct  61   SNGVAENSFLVIML  74



>ref|XP_009759117.1| PREDICTED: ubiquitin receptor RAD23b isoform X1 [Nicotiana sylvestris]
Length=367

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/251 (61%), Positives = 180/251 (72%), Gaps = 13/251 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAGNNLE  IQQI+DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  128   DDYSQAASNLVAGNNLEQTIQQIMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPE  187

Query  839   SAEV--PPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNA  1012
             +AEV  P A G              P      +            +LFPQ   N+  +  
Sbjct  188   TAEVAVPVAHGGVNSAAGTTAVPTAPSSGGPNSAPL---------NLFPQE--NVAGAGG  236

Query  1013  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  1192
              G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINE
Sbjct  237   AGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINE  296

Query  1193  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             PV+G +G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  297   PVDGSDGDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAAN  356

Query  1373  YLLDHMHEFED  1405
             YLL+H  ++ED
Sbjct  357   YLLEHAGDYED  367


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            M + VKTLKG+HFEI V+P DT+  VKK IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MNLTVKTLKGSHFEIRVQPSDTIMAVKKHIEDVQGKDNYPCGQQLLIHNGKVLKDESTLV  60

Query  419  ENKVAENNFVVVMM  460
            EN V+E+ F+VVM+
Sbjct  61   ENNVSEDGFLVVML  74



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 184/249 (74%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAGNNLE  IQQ++DMGGG WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  134   DTYSQAASNLVAGNNLEQTIQQLMDMGGGNWDKETVTRALRAAYNNPERAVDYLYSGIPE  193

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             SAEV    G  P        AA     +               ++FPQ    +  + AGG
Sbjct  194   SAEVAVPVGRFPTSQTTETGAAPAAPVSGAPNSSPL-------NMFPQ--ETLSGAGAGG  244

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  245   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  304

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG+I  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  305   EGSEGDIFDQAEQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  364

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  365   LENAGDFED  373


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE  QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPNDTVMAVKKNIEDAQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV+E+ F+VVM+
Sbjct  61   DNKVSEDGFLVVML  74



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   295 bits (756),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 200/263 (76%), Gaps = 15/263 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLV+G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YLYSGIPE
Sbjct  150   DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSGIPE  209

Query  839   SAEVP------PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIP  1000
             + E P      PA        Q P+QA             +S PNANPL+LFPQG+P+  
Sbjct  210   NVEPPQPVARAPA-AVQQGNPQVPSQAQAAPPPPVQPAGGASGPNANPLNLFPQGIPSAG  268

Query  1001  SS------NAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEH  1162
             S+         GA  L+ LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+
Sbjct  269   SNPGAAAGAGAGAGALDALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQEN  328

Query  1163  QADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVF  1336
             QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVF
Sbjct  329   QAEFLRLVNESPDSGTAGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVF  388

Query  1337  FACNKNEELAANYLLDHMHEFED  1405
             FACNK+EELAANYLLDH HEFED
Sbjct  389   FACNKDEELAANYLLDHGHEFED  411


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74



>ref|XP_009759118.1| PREDICTED: ubiquitin receptor RAD23b isoform X2 [Nicotiana sylvestris]
Length=366

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/251 (61%), Positives = 180/251 (72%), Gaps = 13/251 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D Y QAASNLVAGNNLE  IQQI+DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE
Sbjct  127   DDYSQAASNLVAGNNLEQTIQQIMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPE  186

Query  839   SAEV--PPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNA  1012
             +AEV  P A G              P      +            +LFPQ   N+  +  
Sbjct  187   TAEVAVPVAHGGVNSAAGTTAVPTAPSSGGPNSAPL---------NLFPQE--NVAGAGG  235

Query  1013  GGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  1192
              G  +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINE
Sbjct  236   AGLGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHHQEFLQLINE  295

Query  1193  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             PV+G +G+I  Q    +P  V VTPEE+  IERLEAMGFDRALV+E F AC++NEELAAN
Sbjct  296   PVDGSDGDIFDQAEQEIPHTVSVTPEEQAVIERLEAMGFDRALVIEAFLACDRNEELAAN  355

Query  1373  YLLDHMHEFED  1405
             YLL+H  ++ED
Sbjct  356   YLLEHAGDYED  366


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            M + VKTLKG+HFEI V+P DT+  VKK IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MNLTVKTLKGSHFEIRVQPSDTIMAVKKHIEDVQGKDNYPCGQQLLIHNGKVLKDESTLV  60

Query  419  ENKVAENNFVVVMM  460
            EN V+E+ F+VVM+
Sbjct  61   ENNVSEDGFLVVML  74



>ref|XP_006341431.1| PREDICTED: ubiquitin receptor RAD23b-like [Solanum tuberosum]
Length=367

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 185/249 (74%), Gaps = 12/249 (5%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             Y QAASNLVAGN+LE  IQQ++DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE+A
Sbjct  129   YSQAASNLVAGNSLEQTIQQLMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPETA  188

Query  845   EV--PPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             EV  P A G        P  A  P  +  P   P         +LFPQ   N+  + + G
Sbjct  189   EVAVPVARGGVNSAAAAPTAAPTPPSSGAPNSAPL--------NLFPQ--ENVAGAGSAG  238

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV
Sbjct  239   LGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEPV  298

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G +G++  Q    +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  299   DGSDGDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANYL  358

Query  1379  LDHMHEFED  1405
             L+H  ++ED
Sbjct  359   LEHAGDYED  367


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLL  60

Query  419  ENKVAENNFVVVMM  460
            EN V+E+ F+VVM+
Sbjct  61   ENNVSEDGFLVVML  74



>tpg|DAA61375.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=339

 Score =   293 bits (749),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 231/351 (66%), Gaps = 16/351 (5%)
 Frame = +2

Query  239   MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
             MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1     MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419   ENKVAENNFVVVMMaktksssgegsasstattktiapasstsastapapvpasapapvpa  598
             EN+V ENNF+V+M+ + K SS    A  TA           +     A   A AP    +
Sbjct  61    ENQVVENNFLVIMLRQNKGSSSAAPAKVTANQAPSTQTVPATPPQTSAAPDAPAPIVPVS  120

Query  599   sapvpvaapaptpaptagsgDVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRAL  778
             +      A A      +   D YGQA SNLVAG+NLEG I+ IL+MGGGTWDR+TV+RAL
Sbjct  121   APAATATASAAPAVAVSTEADSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRAL  180

Query  779   RAAYNNPERAVEYLYSGIPESAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapna  958
             RAAYNNPERAVEYLYSGIPE  EVP            P  ++QP    Q      + PNA
Sbjct  181   RAAYNNPERAVEYLYSGIPEQMEVP-----------APPPSSQPVDPVQAVQPAQAGPNA  229

Query  959   nplDLFPQGLPNIPSSNAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPH  1138
             NPLDLFPQ LPN  S+NA   N L+ LRN+ QFQ L  +VQANPQILQP+LQEL KQNP 
Sbjct  230   NPLDLFPQSLPND-SANANTGN-LDVLRNNSQFQNLLGLVQANPQILQPLLQELRKQNPR  287

Query  1139  LMRLIQEHQADFLRLINEPVEGGEGN--ILGQLAASMPQAVQVTPEEREAI  1285
             +M+LIQE+QA+F+RLI+EP+EG E N  +L Q+A +  + + VTPEE EAI
Sbjct  288   VMQLIQENQAEFMRLISEPLEGDEENEMMLDQMADAT-ETIAVTPEENEAI  337



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 200/263 (76%), Gaps = 15/263 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             DVY QAASNLV+G+NLE  IQQILDMGGGTW+R+ VVRALRAAYNNPERA++YLYSGIPE
Sbjct  150   DVYSQAASNLVSGSNLEQTIQQILDMGGGTWERDMVVRALRAAYNNPERAIDYLYSGIPE  209

Query  839   SAEVP------PAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIP  1000
             + E P      PA        Q P+QA             +S PNANPL+LFPQG+P+  
Sbjct  210   NVEPPQPVARAPA-AVQQGNPQVPSQAQAAPPPPVQPAGGASGPNANPLNLFPQGIPSAG  268

Query  1001  SS------NAGGANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEH  1162
             S+         GA  L+ LR   QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+
Sbjct  269   SNPGAAAGAGAGAGALDALRQLPQFQALLALVQANPQILQPMLQELGKQNPQILRLIQEN  328

Query  1163  QADFLRLINEPVEGGE--GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVF  1336
             QA+FLRL+NE  + G   GNILGQLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVF
Sbjct  329   QAEFLRLVNESPDSGAAGGNILGQLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVF  388

Query  1337  FACNKNEELAANYLLDHMHEFED  1405
             FACNK+EELAANYLLDH HEFED
Sbjct  389   FACNKDEELAANYLLDHGHEFED  411


 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
             NKVAEN+F+V+M+
Sbjct  61   GNKVAENSFLVIML  74



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 187/249 (75%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG NL+  IQQI+DMGGG WDRETV RALRAAYNNPERAV+YLYS IPE
Sbjct  132   DTYGQAASNLVAGTNLDETIQQIMDMGGGNWDRETVTRALRAAYNNPERAVDYLYSSIPE  191

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV          +     +   +     AP  S APN+ PL++FPQ    +  + AG 
Sbjct  192   TAEV-------AVPVAHFPGSQATETGITNAPPVSGAPNSAPLNMFPQEA--LSGAGAGA  242

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+ QFQ LR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+
Sbjct  243   LGSLDFLRNNHQFQTLRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPL  302

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG++  Q    MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  303   EGSEGDMFDQPDQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  362

Query  1379  LDHMHEFED  1405
             L++  +FED
Sbjct  363   LENAGDFED  371


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDTVMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLV  60

Query  419  ENKVAENNFVVVMM  460
            +NKV E+ F+VVM+
Sbjct  61   DNKVTEDGFLVVML  74



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 193/257 (75%), Gaps = 11/257 (4%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             Y QAASNLV+GN+LE  IQQILDMGGGTW+R+TVVRALRAAYNNPERA++YLYSGIPE+ 
Sbjct  147   YSQAASNLVSGNSLEQTIQQILDMGGGTWERDTVVRALRAAYNNPERAIDYLYSGIPENV  206

Query  845   EVPPAE----GnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNA  1012
             E  P             Q  + A             S+ PNANPL+LFPQG+P+   SN 
Sbjct  207   EAQPVARAPAAGQQTNQQAASPAQPAVALPVQPSPASAGPNANPLNLFPQGVPS-GGSNP  265

Query  1013  G-----GANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL  1177
             G     G+  L+ LR   QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FL
Sbjct  266   GVIPGAGSGALDALRQLPQFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFL  325

Query  1178  RLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKN  1354
             RL+NE  EGG G NILGQLAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+
Sbjct  326   RLVNESPEGGPGGNILGQLAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKD  385

Query  1355  EELAANYLLDHMHEFED  1405
             EEL ANYLLDH HEF++
Sbjct  386   EELTANYLLDHGHEFDE  402


 Score =   102 bits (254),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VADVK+ IET QG + Y A Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVADVKRIIETTQGQSTYRADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
             N VAEN+F+V+M+
Sbjct  61   SNGVAENSFLVIML  74



>ref|XP_004235877.1| PREDICTED: ubiquitin receptor RAD23b [Solanum lycopersicum]
Length=366

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 181/249 (73%), Gaps = 13/249 (5%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             Y QAASNLVAGNNLE  IQQ++DMGGG+WD+ETV RALRAAYNNPERAV+YLYSGIPE+A
Sbjct  129   YSQAASNLVAGNNLEQTIQQLMDMGGGSWDKETVTRALRAAYNNPERAVDYLYSGIPETA  188

Query  845   EV--PPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             EV  P A G       P      P   A  +            +LFPQ   N+      G
Sbjct  189   EVSVPVARGGVNSAAVPTAAPIAPSSGAPNSAPL---------NLFPQE--NVAGGGGAG  237

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV
Sbjct  238   LGSLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEPV  297

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G +G++  Q    +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  298   DGSDGDMFDQAEQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANYL  357

Query  1379  LDHMHEFED  1405
             L+H  ++ED
Sbjct  358   LEHAGDYED  366


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDESTLL  60

Query  419  ENKVAENNFVVVMM  460
            EN V+E+ F+VVM+
Sbjct  61   ENNVSEDGFLVVML  74



>ref|XP_006845449.1| PREDICTED: ubiquitin receptor RAD23b [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   292 bits (747),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 186/249 (75%), Gaps = 6/249 (2%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             +VYGQAAS LVAGNNLE  IQQILDMGG +WDR+TV RALRAAYNNPERAVEYLYSGIP 
Sbjct  128   NVYGQAASTLVAGNNLEQMIQQILDMGGDSWDRDTVTRALRAAYNNPERAVEYLYSGIPA  187

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +A        P          A  +         S+ PNA+PL++FPQG P   S    G
Sbjct  188   AA----EVAVPVVPTSAQAADATTEADVAGVAPNSAGPNASPLNMFPQGSPT--SGAIAG  241

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN++QFQ LR MVQANPQILQPMLQEL KQNP L+RLIQEHQA+FL+LINEP 
Sbjct  242   GGSLDFLRNNEQFQTLRHMVQANPQILQPMLQELSKQNPQLLRLIQEHQAEFLQLINEPA  301

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             EG EG++ GQ    MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC++NEELA NYL
Sbjct  302   EGAEGDLFGQAEQDMPQSITVTPEEREAIERLEAMGFDRALVIEAFLACDRNEELAINYL  361

Query  1379  LDHMHEFED  1405
             L++  ++ED
Sbjct  362   LENPGDYED  370


 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG HFEI V+  DTV  VKK IE +QG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGNHFEIRVQANDTVMAVKKHIEELQGKDNYPCGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E+ F+VVM+
Sbjct  61   ENKVSEDGFLVVML  74



>gb|ACF79443.1| unknown [Zea mays]
 tpg|DAA40040.1| TPA: hypothetical protein ZEAMMB73_722140 [Zea mays]
Length=365

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 189/251 (75%), Gaps = 12/251 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLEG IQ IL+MGGG WDR+TV+RALR AYNNPERAVEYLYSGIPE
Sbjct  116   DSYGQAASNLVAGSNLEGTIQSILEMGGGIWDRDTVLRALRVAYNNPERAVEYLYSGIPE  175

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               +VP                   Q A        S PNANPLDLFPQ LPN  S+NAG 
Sbjct  176   QMDVP-------TSPPSIQPVNPVQAAQAAQTAAPSGPNANPLDLFPQSLPNA-SANAGT  227

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+ LRN+ QFQ L  +VQANPQILQP+LQELGKQNP +M+LIQE+QA+F+R+INEP+
Sbjct  228   GN-LDVLRNNVQFQNLLGLVQANPQILQPLLQELGKQNPQVMQLIQENQAEFMRMINEPL  286

Query  1199  EGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRALVLEVFFACNKNE+L AN
Sbjct  287   EGDEENEMMLDQMADAA-ETIAVTPEENEAILRLEGMGFDRALVLEVFFACNKNEQLTAN  345

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEF++
Sbjct  346   YLLDHMHEFDN  356


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGK  391
            MK+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGK
Sbjct  1    MKVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGK  51



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   290 bits (742),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 187/249 (75%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D + QAASNLVAG+NLE  IQQI++MGGG WD+ETV RALRAAYNNPERA++YLYSGIPE
Sbjct  127   DNFSQAASNLVAGDNLEQTIQQIMEMGGGNWDKETVTRALRAAYNNPERAIDYLYSGIPE  186

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV          +      +       PA   S APN+ PL+LFPQ   N+  +    
Sbjct  187   TAEV-------AVPVASSGVNSAIGTTTVPAAPVSGAPNSAPLNLFPQE--NVAGAGGAA  237

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV
Sbjct  238   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPV  297

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G +G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  298   DGSDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  357

Query  1379  LDHMHEFED  1405
             L+H  ++ED
Sbjct  358   LEHAGDYED  366


 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIIAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDESTLL  60

Query  419  ENKVAENNFVVVMM  460
            EN V+E+ F+VVM+
Sbjct  61   ENNVSEDGFLVVML  74



>ref|NP_001149553.1| LOC100283179 [Zea mays]
 gb|ACF84553.1| unknown [Zea mays]
 gb|ACG35819.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA40041.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=390

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 190/251 (76%), Gaps = 12/251 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLEG IQ IL+MGGG WDR+TV+RALR AYNNPERAVEYLYSGIPE
Sbjct  141   DSYGQAASNLVAGSNLEGTIQSILEMGGGIWDRDTVLRALRVAYNNPERAVEYLYSGIPE  200

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               +VP +                 Q A        S PNANPLDLFPQ LPN  S+NAG 
Sbjct  201   QMDVPTSP-------PSIQPVNPVQAAQAAQTAAPSGPNANPLDLFPQSLPNA-SANAGT  252

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+ LRN+ QFQ L  +VQANPQILQP+LQELGKQNP +M+LIQE+QA+F+R+INEP+
Sbjct  253   GN-LDVLRNNVQFQNLLGLVQANPQILQPLLQELGKQNPQVMQLIQENQAEFMRMINEPL  311

Query  1199  EGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRALVLEVFFACNKNE+L AN
Sbjct  312   EGDEENEMMLDQMADAA-ETIAVTPEENEAILRLEGMGFDRALVLEVFFACNKNEQLTAN  370

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEF++
Sbjct  371   YLLDHMHEFDN  381


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGKVLSDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN+V ENNF+V+M+
Sbjct  61   ENQVTENNFLVIML  74



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 187/249 (75%), Gaps = 9/249 (4%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D + QAASNLVAG+NLE  IQQI++MGGG WD+ETV RALRAAYNNPERA++YLYSGIPE
Sbjct  128   DNFSQAASNLVAGDNLEQTIQQIMEMGGGNWDKETVTRALRAAYNNPERAIDYLYSGIPE  187

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV          +      +       PA   S APN+ PL+LFPQ   N+  +    
Sbjct  188   TAEV-------AVPVASSGVNSAIGTTTVPAAPVSGAPNSAPLNLFPQE--NVAGAGGAA  238

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN+QQFQALR+MVQ+NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV
Sbjct  239   LGSLDFLRNNQQFQALRSMVQSNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPV  298

Query  1199  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  1378
             +G +G+I  Q    MP  V VTP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYL
Sbjct  299   DGSDGDIFDQPEQDMPHTVSVTPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYL  358

Query  1379  LDHMHEFED  1405
             L+H  ++ED
Sbjct  359   LEHAGDYED  367


 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIIAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDESTLL  60

Query  419  ENKVAENNFVVVMM  460
            EN V+E+ F+VVM+
Sbjct  61   ENNVSEDGFLVVML  74



>ref|XP_007215553.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica]
 gb|EMJ16752.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica]
Length=374

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 180/252 (71%), Gaps = 12/252 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAAS L+AG NLE  IQQI+DMGGG WDRETV RALRAAYNNPERAV+YLYS IPE
Sbjct  132   DTYGQAASTLLAGTNLEQTIQQIMDMGGGNWDRETVTRALRAAYNNPERAVDYLYSSIPE  191

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV    G+ P        AA     +               ++FPQ    +  + AG 
Sbjct  192   TAEVAVPVGHFPASQATETGAANAAPVSGAPNSAPL-------NMFPQ--ETLSGAGAGA  242

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L FLRN++QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH  +FL+LINEP+
Sbjct  243   LGSLAFLRNNRQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINEPL  302

Query  1199  EGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  1369
             EG EG+I  Q       MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAA
Sbjct  303   EGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAA  362

Query  1370  NYLLDHMHEFED  1405
             NYLL++  +FED
Sbjct  363   NYLLENAGDFED  374


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV E+ F+VVM+
Sbjct  61   DNKVTEDGFLVVML  74



>emb|CDO98260.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 185/247 (75%), Gaps = 9/247 (4%)
 Frame = +2

Query  665   YGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPESA  844
             YG+AASNLVAG NLE  IQQI+DMGGGTWD+ETV RALRAAYNNPERAV+YLYSGIPE A
Sbjct  133   YGEAASNLVAGTNLEQTIQQIMDMGGGTWDKETVTRALRAAYNNPERAVDYLYSGIPEMA  192

Query  845   EVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGGAN  1024
             EV          + P    +  Q         S APN++PL+LFPQ   N+      G  
Sbjct  193   EV-------AVPVAPTGTNSATQTGLDSDVAVSGAPNSSPLNLFPQ--ENLSGDAGAGLG  243

Query  1025  TLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  1204
             +L+FLRN+QQFQALR+MVQANPQILQPMLQELGKQNP L+RLI+EH  +FL+LI+EP++G
Sbjct  244   SLDFLRNNQQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIEEHHQEFLQLISEPMDG  303

Query  1205  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  1384
              EG++  Q    MP AV VTP E+E IERLEAMGFDRALV+E F AC++NEELA NYLL+
Sbjct  304   SEGDLFDQAEQDMPHAVSVTPAEQEIIERLEAMGFDRALVIEAFLACDRNEELAINYLLE  363

Query  1385  HMHEFED  1405
             +  ++ED
Sbjct  364   NAGDYED  370


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE ++G + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIMAVKKNIEDMKGKDSYPCGQQLLIHNGKVLKDESTLA  60

Query  419  ENKVAENNFVVVMM  460
            ENKV+E+ F+VVM+
Sbjct  61   ENKVSEDGFLVVML  74



>ref|XP_008668010.1| PREDICTED: LOC100283179 isoform X1 [Zea mays]
Length=423

 Score =   291 bits (744),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 189/251 (75%), Gaps = 12/251 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAASNLVAG+NLEG IQ IL+MGGG WDR+TV+RALR AYNNPERAVEYLYSGIPE
Sbjct  174   DSYGQAASNLVAGSNLEGTIQSILEMGGGIWDRDTVLRALRVAYNNPERAVEYLYSGIPE  233

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               +VP                   Q A        S PNANPLDLFPQ LPN  S+NAG 
Sbjct  234   QMDVP-------TSPPSIQPVNPVQAAQAAQTAAPSGPNANPLDLFPQSLPNA-SANAGT  285

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+ LRN+ QFQ L  +VQANPQILQP+LQELGKQNP +M+LIQE+QA+F+R+INEP+
Sbjct  286   GN-LDVLRNNVQFQNLLGLVQANPQILQPLLQELGKQNPQVMQLIQENQAEFMRMINEPL  344

Query  1199  EGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRALVLEVFFACNKNE+L AN
Sbjct  345   EGDEENEMMLDQMADAA-ETIAVTPEENEAILRLEGMGFDRALVLEVFFACNKNEQLTAN  403

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEF++
Sbjct  404   YLLDHMHEFDN  414


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 60/110 (55%), Gaps = 7/110 (6%)
 Frame = +2

Query  77   CAWHFF--STQLRIARSNRL*VHSCN---PCLYSRVSSSPFDRNGDPSFRK*RKI*RENM  241
            C  H    +  +R+  S RL          CL S  S+ P     +P  R+ R+  R  M
Sbjct  2    CTAHIILANVLIRLQLSRRLRHQKTELAPSCLPS--SAGPLLSASNPPVRRRRRRRRAEM  59

Query  242  KIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGK  391
            K+ VKTLKG+ F+IEV+P D VA VKK IE +Q    YPA Q +LIHQGK
Sbjct  60   KVSVKTLKGSSFQIEVEPTDKVAAVKKVIENMQEQASYPADQQVLIHQGK  109



>ref|XP_008228865.1| PREDICTED: ubiquitin receptor RAD23b-like [Prunus mume]
Length=374

 Score =   289 bits (739),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 179/252 (71%), Gaps = 12/252 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAAS L+AG NLE  IQQI+DMGGG WDRETV RALRAAYNNPERAV+YLYS IPE
Sbjct  132   DTYGQAASTLLAGTNLEQTIQQIMDMGGGNWDRETVTRALRAAYNNPERAVDYLYSSIPE  191

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             +AEV    G+ P         A     +               ++FPQ    +  + AG 
Sbjct  192   TAEVAVPVGHFPASQATETGPANAAPVSGAPNSAPL-------NMFPQ--ETLSGAGAGA  242

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L FLRN++QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH  +FL+LINEP+
Sbjct  243   LGSLAFLRNNRQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINEPL  302

Query  1199  EGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  1369
             EG EG+I  Q       MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAA
Sbjct  303   EGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAA  362

Query  1370  NYLLDHMHEFED  1405
             NYLL++  +FED
Sbjct  363   NYLLENAGDFED  374


 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV E+ F+VVM+
Sbjct  61   DNKVTEDGFLVVML  74



>tpg|DAA61379.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=382

 Score =   289 bits (739),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 193/251 (77%), Gaps = 16/251 (6%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQA SNLVAG+NLEG I+ IL+MGGGTWDR+TV+RALRAAYNNPERAVEYLYSGIPE
Sbjct  137   DSYGQATSNLVAGSNLEGTIKSILEMGGGTWDRDTVLRALRAAYNNPERAVEYLYSGIPE  196

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
               EVP            P  ++QP    Q      + PNANPLDLFPQ LPN  S+NA  
Sbjct  197   QMEVP-----------APPPSSQPVDPVQAVQPAQAGPNANPLDLFPQSLPN-DSANANT  244

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
              N L+ LRN+ QFQ L  +VQANPQILQP+LQEL KQNP +M+LIQE+QA+F+RLI+EP+
Sbjct  245   GN-LDVLRNNSQFQNLLGLVQANPQILQPLLQELRKQNPRVMQLIQENQAEFMRLISEPL  303

Query  1199  EGGEGN--ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  1372
             EG E N  +L Q+A +  + + VTPEE EAI RLE MGFDRALVLEVFFACNKNE+LAAN
Sbjct  304   EGDEENEMMLDQMADAT-ETIAVTPEENEAILRLEGMGFDRALVLEVFFACNKNEQLAAN  362

Query  1373  YLLDHMHEFED  1405
             YLLDHMHEF++
Sbjct  363   YLLDHMHEFDN  373


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFVVVMM  460
            EN+V ENNF+V+M+
Sbjct  61   ENQVVENNFLVIML  74



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   289 bits (739),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 181/252 (72%), Gaps = 12/252 (5%)
 Frame = +2

Query  659   DVYGQAASNLVAGNNLEGAIQQILDMGGGTWDRETVVRALRAAYNNPERAVEYLYSGIPE  838
             D YGQAAS LVAG NLE  IQQI+DMGGG WDRETV RALRAAYNNPERAV+YLYS IPE
Sbjct  132   DTYGQAASTLVAGTNLEQTIQQIMDMGGGNWDRETVTRALRAAYNNPERAVDYLYSSIPE  191

Query  839   SAEVPPAEGnpppvlqppnqaaqpqqaaqpapvpssapnanplDLFPQGLPNIPSSNAGG  1018
             + EV    GN P       +AA     +               ++FPQ    +  + AG 
Sbjct  192   TTEVAVPVGNFPASQATETEAANAAPVSGAPNSAPL-------NMFPQ--ETLSGAGAGA  242

Query  1019  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  1198
               +L+FLRN++QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH  +FL+LINEP+
Sbjct  243   LGSLDFLRNNRQFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHTEFLQLINEPL  302

Query  1199  EGGEGNILGQLAA---SMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA  1369
             EG EG+I  Q       MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAA
Sbjct  303   EGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAA  362

Query  1370  NYLLDHMHEFED  1405
             NYLL++  ++ED
Sbjct  363   NYLLENAGDYED  374


 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P D V  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPTDAVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFVVVMM  460
            +NKV E+ F+VVM+
Sbjct  61   DNKVTEDGFLVVML  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5600673013160