BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8690

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080165.1|  PREDICTED: uncharacterized protein LOC105163499    198   1e-59   Sesamum indicum [beniseed]
ref|XP_009608820.1|  PREDICTED: uncharacterized protein LOC104102724    189   6e-56   Nicotiana tomentosiformis
gb|EYU46357.1|  hypothetical protein MIMGU_mgv1a023019mg                186   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_009797037.1|  PREDICTED: uncharacterized protein LOC104243537    185   2e-54   Nicotiana sylvestris
ref|XP_006364545.1|  PREDICTED: uncharacterized protein LOC102582274    183   3e-54   Solanum tuberosum [potatoes]
ref|XP_008382655.1|  PREDICTED: uncharacterized protein LOC103445...    181   7e-53   Malus domestica [apple tree]
ref|XP_009349845.1|  PREDICTED: uncharacterized protein LOC103941...    180   2e-52   Pyrus x bretschneideri [bai li]
emb|CDP03841.1|  unnamed protein product                                179   2e-52   Coffea canephora [robusta coffee]
ref|XP_010245676.1|  PREDICTED: uncharacterized protein LOC104589...    179   5e-52   Nelumbo nucifera [Indian lotus]
ref|XP_007049850.1|  Uncharacterized protein isoform 1                  178   6e-52   
ref|XP_007200599.1|  hypothetical protein PRUPE_ppa012136mg             175   2e-50   Prunus persica
ref|XP_008372615.1|  PREDICTED: uncharacterized protein LOC103435965    174   5e-50   
ref|XP_010109684.1|  hypothetical protein L484_015169                   173   1e-49   Morus notabilis
ref|XP_009371161.1|  PREDICTED: uncharacterized protein LOC103960411    171   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_004240464.1|  PREDICTED: uncharacterized protein LOC101259250    170   7e-49   Solanum lycopersicum
gb|KJB10972.1|  hypothetical protein B456_001G234600                    168   5e-48   Gossypium raimondii
ref|XP_007140554.1|  hypothetical protein PHAVU_008G122300g             167   1e-47   Phaseolus vulgaris [French bean]
ref|XP_012085163.1|  PREDICTED: uncharacterized protein LOC105644428    167   2e-47   Jatropha curcas
ref|XP_002303086.1|  hypothetical protein POPTR_0002s25310g             166   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002521134.1|  conserved hypothetical protein                     165   1e-46   Ricinus communis
ref|XP_004290233.1|  PREDICTED: uncharacterized protein LOC101302315    161   2e-45   Fragaria vesca subsp. vesca
ref|NP_001238732.1|  uncharacterized protein LOC100527102               161   2e-45   Glycine max [soybeans]
gb|KHN07824.1|  hypothetical protein glysoja_035862                     160   4e-45   Glycine soja [wild soybean]
gb|KDO65861.1|  hypothetical protein CISIN_1g031279mg                   159   9e-45   Citrus sinensis [apfelsine]
ref|XP_006443660.1|  hypothetical protein CICLE_v10022604mg             159   1e-44   Citrus clementina [clementine]
ref|XP_010684953.1|  PREDICTED: uncharacterized protein LOC104899456    157   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010435300.1|  PREDICTED: uncharacterized protein LOC104719141    157   2e-43   Camelina sativa [gold-of-pleasure]
gb|EPS72222.1|  hypothetical protein M569_02530                         155   3e-43   Genlisea aurea
ref|XP_002264856.1|  PREDICTED: uncharacterized protein LOC100256241    156   3e-43   Vitis vinifera
ref|XP_003532307.1|  PREDICTED: uncharacterized protein LOC100794...    156   3e-43   Glycine max [soybeans]
gb|KJB10973.1|  hypothetical protein B456_001G234600                    156   4e-43   Gossypium raimondii
ref|XP_011024551.1|  PREDICTED: uncharacterized protein LOC105125688    155   4e-43   Populus euphratica
ref|XP_010450306.1|  PREDICTED: uncharacterized protein LOC104732456    154   1e-42   Camelina sativa [gold-of-pleasure]
gb|KHN25000.1|  hypothetical protein glysoja_027114                     154   1e-42   Glycine soja [wild soybean]
ref|XP_002863159.1|  predicted protein                                  154   1e-42   
ref|XP_010440666.1|  PREDICTED: uncharacterized protein LOC104723933    154   1e-42   Camelina sativa [gold-of-pleasure]
ref|NP_193058.2|  uncharacterized protein                               154   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284538.1|  hypothetical protein CARUB_v10005740mg             154   2e-42   
ref|XP_010048694.1|  PREDICTED: uncharacterized protein LOC104437453    152   7e-42   Eucalyptus grandis [rose gum]
ref|XP_006414949.1|  hypothetical protein EUTSA_v10026377mg             151   2e-41   Eutrema salsugineum [saltwater cress]
ref|XP_011620359.1|  PREDICTED: uncharacterized protein LOC18426027     150   2e-41   Amborella trichopoda
ref|XP_010532868.1|  PREDICTED: uncharacterized protein LOC104808772    150   4e-41   Tarenaya hassleriana [spider flower]
gb|KEH22830.1|  transmembrane protein, putative                         149   1e-40   Medicago truncatula
ref|XP_010940646.1|  PREDICTED: uncharacterized protein LOC105059127    148   2e-40   
gb|KFK39768.1|  hypothetical protein AALP_AA3G285200                    148   3e-40   Arabis alpina [alpine rockcress]
emb|CAN75300.1|  hypothetical protein VITISV_008677                     149   3e-40   Vitis vinifera
emb|CAB41932.1|  hypothetical protein                                   148   3e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71052.1|  BnaCnng71100D                                          148   4e-40   Brassica napus [oilseed rape]
ref|XP_004152015.1|  PREDICTED: uncharacterized protein LOC101207...    146   2e-39   Cucumis sativus [cucumbers]
emb|CDY64817.1|  BnaA08g31610D                                          146   3e-39   Brassica napus [oilseed rape]
ref|XP_009386598.1|  PREDICTED: uncharacterized protein LOC103973687    145   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009110710.1|  PREDICTED: uncharacterized protein LOC103836221    145   4e-39   
ref|XP_008447333.1|  PREDICTED: uncharacterized protein LOC103489804    144   1e-38   Cucumis melo [Oriental melon]
ref|XP_008789533.1|  PREDICTED: uncharacterized protein LOC103706994    144   1e-38   
ref|XP_003563208.1|  PREDICTED: uncharacterized protein LOC100828168    143   1e-38   Brachypodium distachyon [annual false brome]
gb|EEC78795.1|  hypothetical protein OsI_19050                          143   2e-38   Oryza sativa Indica Group [Indian rice]
gb|KCW81061.1|  hypothetical protein EUGRSUZ_C02436                     144   2e-38   Eucalyptus grandis [rose gum]
ref|NP_001066563.1|  Os12g0276100                                       143   2e-38   
gb|EMT26256.1|  hypothetical protein F775_08778                         141   9e-38   
dbj|BAJ84991.1|  predicted protein                                      136   6e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004515614.1|  PREDICTED: uncharacterized protein LOC101498161    136   1e-35   Cicer arietinum [garbanzo]
ref|XP_008236525.1|  PREDICTED: uncharacterized protein LOC103335292    136   1e-35   Prunus mume [ume]
gb|EEE51982.1|  hypothetical protein OsJ_33660                          133   3e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004959593.1|  PREDICTED: uncharacterized protein LOC101753469    123   1e-30   
tpg|DAA62158.1|  TPA: hypothetical protein ZEAMMB73_942245              122   2e-30   
ref|XP_002462636.1|  hypothetical protein SORBIDRAFT_02g029370          121   4e-30   Sorghum bicolor [broomcorn]
ref|NP_001144333.1|  uncharacterized protein LOC100277230               120   1e-29   
ref|XP_006664487.1|  PREDICTED: uncharacterized protein LOC102706620    120   3e-29   
tpg|DAA40493.1|  TPA: hypothetical protein ZEAMMB73_975194              118   1e-28   
ref|XP_007199009.1|  hypothetical protein PRUPE_ppa017514mg             112   3e-27   
ref|XP_010245677.1|  PREDICTED: uncharacterized protein LOC104589...    110   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010245678.1|  PREDICTED: uncharacterized protein LOC104589...    109   6e-26   Nelumbo nucifera [Indian lotus]
gb|KJB10975.1|  hypothetical protein B456_001G234600                    108   1e-25   Gossypium raimondii
ref|XP_006386895.1|  hypothetical protein POPTR_0002s25310g             108   2e-25   
ref|XP_007200193.1|  hypothetical protein PRUPE_ppa016150mg             107   7e-25   
gb|KGN58332.1|  hypothetical protein Csa_3G624000                       106   7e-25   Cucumis sativus [cucumbers]
gb|EMS54023.1|  hypothetical protein TRIUR3_31680                       101   3e-22   Triticum urartu
gb|ERM98039.1|  hypothetical protein AMTR_s00120p00080910             92.0    4e-20   Amborella trichopoda
ref|XP_010480620.1|  PREDICTED: uncharacterized protein LOC104759382  92.4    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_011651636.1|  PREDICTED: uncharacterized protein LOC101207...  81.6    1e-15   Cucumis sativus [cucumbers]
ref|XP_008651235.1|  PREDICTED: uncharacterized protein LOC100277...  80.9    2e-15   Zea mays [maize]
gb|ACN27076.1|  unknown                                               80.5    3e-15   Zea mays [maize]
ref|XP_001777100.1|  predicted protein                                73.6    2e-12   
gb|KJB10974.1|  hypothetical protein B456_001G234600                  70.9    6e-12   Gossypium raimondii
ref|XP_001782808.1|  predicted protein                                67.4    8e-10   
ref|XP_008382656.1|  PREDICTED: uncharacterized protein LOC103445...  62.4    5e-09   Malus domestica [apple tree]
ref|XP_009349846.1|  PREDICTED: uncharacterized protein LOC103941...  61.6    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_002950405.1|  hypothetical protein VOLCADRAFT_104657           61.2    2e-08   Volvox carteri f. nagariensis
dbj|BAH57253.1|  AT4G13220                                            55.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001691952.1|  SNF2 superfamily protein                         58.9    1e-06   Chlamydomonas reinhardtii
ref|XP_010527292.1|  PREDICTED: uncharacterized protein LOC104804650  52.8    1e-05   Tarenaya hassleriana [spider flower]



>ref|XP_011080165.1| PREDICTED: uncharacterized protein LOC105163499 [Sesamum indicum]
Length=176

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 132/170 (78%), Gaps = 5/170 (3%)
 Frame = +3

Query  69   LCSTSPSCLHPKSHQRNRAL---PSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPS  239
            L + SPS L+     RN+A    PSQFLSS S  K K QT +S+++ ++  +R   A P 
Sbjct  9    LNALSPS-LYSSRCCRNQAFSPDPSQFLSSMSFSKFKNQTLYSSLQIKRFKNRNVGASP-  66

Query  240  FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
             ++A QSNFL+VIQTVW+V KDGI+AGTNLVPD+IPRP+ARISVT+ AV  +LFLLKSFL
Sbjct  67   VVFAAQSNFLRVIQTVWKVSKDGIEAGTNLVPDAIPRPIARISVTIAAVMVSLFLLKSFL  126

Query  420  STAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            STAFFALA MG+ YF FIALNKDE P+ DG TTSV++SLEEARRIM+KYK
Sbjct  127  STAFFALAVMGLSYFTFIALNKDEGPKGDGGTTSVEDSLEEARRIMEKYK  176



>ref|XP_009608820.1| PREDICTED: uncharacterized protein LOC104102724 [Nicotiana tomentosiformis]
Length=182

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 135/177 (76%), Gaps = 7/177 (4%)
 Frame = +3

Query  57   FHRILCST--SPSCLHPKSHQRNRAL-PSQFlssnsllklkkQTAFSTVRFRKLN-SRRF  224
            FH  L  +  SP C +  +     AL PS F +SNSLLKLKKQTA ST +F+ L  + +F
Sbjct  7    FHSTLFVSLKSPKCFYRSNQITLSALNPSPFFASNSLLKLKKQTALSTKQFKNLRRNNKF  66

Query  225  QAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFL  404
            QA P  I+AVQSNFLKV+QT WRVGKDGI+AGT++VPD+IPRP+ARISVTVVA   ALF 
Sbjct  67   QATP-LIFAVQSNFLKVLQTAWRVGKDGIEAGTSMVPDAIPRPIARISVTVVAGALALFA  125

Query  405  LKSFLSTAFFALATMGVIYFAFIALNKDESPR--VDGKTTSVDESLEEARRIMDKYK  569
            LKSFLSTAFFALA MGVIYF FIALNKD+ P+      TTSVD+SL EARRIM+KYK
Sbjct  126  LKSFLSTAFFALAMMGVIYFGFIALNKDDGPKGGGGTGTTSVDDSLGEARRIMEKYK  182



>gb|EYU46357.1| hypothetical protein MIMGU_mgv1a023019mg, partial [Erythranthe 
guttata]
Length=162

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 108/130 (83%), Gaps = 2/130 (2%)
 Frame = +3

Query  183  FSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLAR  362
            +S ++ ++LN+    A P  +YA Q NFLKV QTVW+VGKDG++AGTNLVP++IPRP+AR
Sbjct  34   YSPIQIKRLNNPNLHA-PPIVYAAQGNFLKVAQTVWKVGKDGVEAGTNLVPETIPRPIAR  92

Query  363  ISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGK-TTSVDESLE  539
            ISVT+VAV+ ALF LKSFLST FFALA MG+ YF FIALNKDE P+V G  TTSV++SLE
Sbjct  93   ISVTIVAVSVALFALKSFLSTVFFALAVMGLSYFTFIALNKDEGPKVGGGTTTSVEDSLE  152

Query  540  EARRIMDKYK  569
            EAR+IMDKYK
Sbjct  153  EARKIMDKYK  162



>ref|XP_009797037.1| PREDICTED: uncharacterized protein LOC104243537 [Nicotiana sylvestris]
Length=182

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 7/177 (4%)
 Frame = +3

Query  57   FHRILCST--SPSCLHPKSHQRNRAL-PSQFlssnsllklkkQTAFSTVRFRKLNSR-RF  224
            FH  L  +  SP C + ++     AL PS F ++NSLLKLKKQTA ST +F+ L S  +F
Sbjct  7    FHSTLFVSVQSPKCFYSRNQITLSALNPSPFFATNSLLKLKKQTALSTKQFKNLRSHNKF  66

Query  225  QAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFL  404
            QA P  I+A Q NFLKV+QT WRVGKDGI+AGT++VPD+IPRP+ARI+VT+V+   ALF 
Sbjct  67   QATP-LIFAAQFNFLKVLQTAWRVGKDGIEAGTSMVPDAIPRPIARIAVTIVSGGLALFA  125

Query  405  LKSFLSTAFFALATMGVIYFAFIALNKDESPR--VDGKTTSVDESLEEARRIMDKYK  569
            LKSFLSTAFF LA MGVIYF FIALNKD+ P+      TTSVD+SLEEARRIM+KYK
Sbjct  126  LKSFLSTAFFVLAMMGVIYFGFIALNKDDGPKGGGGTGTTSVDDSLEEARRIMEKYK  182



>ref|XP_006364545.1| PREDICTED: uncharacterized protein LOC102582274 [Solanum tuberosum]
Length=158

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +3

Query  207  LNSRRFQAQPS-FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVA  383
            L++R+F++Q +  I+A QSNF KV+QT WRVGKDG++AGTN+VPD+IPRP+ARI VTVV 
Sbjct  37   LSARQFKSQATPLIFAAQSNFFKVLQTAWRVGKDGVEAGTNMVPDAIPRPIARICVTVVG  96

Query  384  VTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDK  563
              FALF LKSFLST FFALA MGVIYF FIALNKD+ P+  G T S D+SLEEARRIM+K
Sbjct  97   AAFALFALKSFLSTVFFALAMMGVIYFGFIALNKDDGPKGSGGTASADDSLEEARRIMEK  156

Query  564  YK  569
            YK
Sbjct  157  YK  158



>ref|XP_008382655.1| PREDICTED: uncharacterized protein LOC103445426 isoform X1 [Malus 
domestica]
Length=182

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRP  353
            QT  S +R ++  ++  ++    ++A QSNF KV+QT W+VG+DG++AGTNLVP+S+PRP
Sbjct  45   QTLLSAIRIKRQRTQNHRSVVPVVFASQSNFFKVLQTAWKVGRDGVEAGTNLVPNSVPRP  104

Query  354  LARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS----  521
            +AR+SVT+VA+T +LF+LKSFLSTAFFALATMG++YF FIALNKDE PR  G TTS    
Sbjct  105  VARVSVTIVALTLSLFVLKSFLSTAFFALATMGLVYFIFIALNKDEGPRGGGGTTSTPKE  164

Query  522  --VDESLEEARRIMDKYK  569
              +D+SLEEARRIM+KYK
Sbjct  165  DGIDDSLEEARRIMEKYK  182



>ref|XP_009349845.1| PREDICTED: uncharacterized protein LOC103941378 isoform X1 [Pyrus 
x bretschneideri]
Length=182

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRP  353
            QT  S +R ++  S+  ++    ++A QSNF KV+QT W+VG+DG++AGTNLVP+S+PRP
Sbjct  45   QTLPSAIRIKRRRSQNHRSVVPVVFASQSNFFKVLQTAWKVGRDGVEAGTNLVPNSVPRP  104

Query  354  LARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS----  521
            +AR+SVT+VA+T +LF+LKSFLSTAFFALATMG++YF FIALNKDE PR  G TTS    
Sbjct  105  VARVSVTIVALTLSLFVLKSFLSTAFFALATMGLVYFIFIALNKDEGPRGGGGTTSTPKE  164

Query  522  --VDESLEEARRIMDKYK  569
              +D+SLEEARRIM+KYK
Sbjct  165  DGIDDSLEEARRIMEKYK  182



>emb|CDP03841.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 130/166 (78%), Gaps = 5/166 (3%)
 Frame = +3

Query  75   STSPSCLHPKSHQRNRALPSQFlssnsllklkkQTAFSTVRFRKLNSRRF-QAQPSFIYA  251
            S S  C+  ++   N+   S+FLSSNS+L+ K+Q   STV+F+KL S R  Q  P+ + A
Sbjct  19   SPSSCCIKTQALALNQ---SRFLSSNSVLRFKRQILVSTVQFKKLTSPRPPQVVPTVLSA  75

Query  252  VQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAF  431
             QSNFLKV++TVW+VG DGI+AGTNLVP +IPRPLARI+VTVVA++ +L +L SFLSTAF
Sbjct  76   -QSNFLKVVRTVWKVGMDGIEAGTNLVPGAIPRPLARIAVTVVALSISLIVLTSFLSTAF  134

Query  432  FALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
              LA MG+IYF FIALNKDE P+ DG TTSV++SLEEAR+IM+KYK
Sbjct  135  TVLAMMGLIYFTFIALNKDEGPKGDGGTTSVEDSLEEARKIMEKYK  180



>ref|XP_010245676.1| PREDICTED: uncharacterized protein LOC104589156 isoform X1 [Nelumbo 
nucifera]
Length=181

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 123/179 (69%), Gaps = 13/179 (7%)
 Frame = +3

Query  72   CSTSPSCLHP--------KSHQRNRAL-----PSQFlssnsllklkkQTAFSTVRFRKLN  212
            CS++ +CLH         +S +R  +      PS+F+S  S    K +  F     + L 
Sbjct  3    CSSASTCLHSLSLHSSPFRSTKRRTSASFLLGPSRFVSPKSPTLRKSRRDFVLPNNKNLR  62

Query  213  SRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTF  392
              R  + P  + A QS+FL+VIQTVW+VGKDGI+AGTNLVPDSIPRP+ARI V VVA++ 
Sbjct  63   RYRPNSVPLVVVAAQSDFLRVIQTVWKVGKDGIEAGTNLVPDSIPRPIARIGVAVVALSV  122

Query  393  ALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            + F+LKS LSTAFF LATMG+IYF +IALNKDE PR  G T+S D++LEEARRIM+KYK
Sbjct  123  SFFVLKSVLSTAFFVLATMGLIYFVYIALNKDEGPRGGGGTSSTDDTLEEARRIMEKYK  181



>ref|XP_007049850.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007049851.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94007.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94008.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=172

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 128/169 (76%), Gaps = 10/169 (6%)
 Frame = +3

Query  72   CSTSPSCLHPKSHQRNR--ALP-SQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSF  242
            CS SP    PK +  N+  AL  SQFLSS S L LK++T  S+++F K  S +       
Sbjct  11   CSLSPHS--PKCYYMNQTPALTHSQFLSSTSFLGLKRKTLSSSIKFNKPLSPK-----PL  63

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            +YA+QSNF KV+QT W+VGKDGI+AGTNLVPD++PRP+AR+SVT+VA+T  LF+LKSFLS
Sbjct  64   VYALQSNFFKVLQTAWKVGKDGIEAGTNLVPDAVPRPIARVSVTIVALTVTLFVLKSFLS  123

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            TAFFALATMG++YF FIALNKD  PR    T S+++ +EEAR+IM+KYK
Sbjct  124  TAFFALATMGLVYFIFIALNKDRGPRGGSGTESMEDPVEEARKIMEKYK  172



>ref|XP_007200599.1| hypothetical protein PRUPE_ppa012136mg [Prunus persica]
 ref|XP_008235525.1| PREDICTED: uncharacterized protein LOC103334350 [Prunus mume]
 gb|EMJ01798.1| hypothetical protein PRUPE_ppa012136mg [Prunus persica]
Length=182

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 132/175 (75%), Gaps = 13/175 (7%)
 Frame = +3

Query  81   SPSCLHPKSHQ--RNRALP---SQFlssnsllklkkQTAFSTVRFRKLN-SRRFQAQPSF  242
            S  C+ P S +  +N+ L    SQF SSNS L+LKKQ+  S ++  K   +RR+++ P  
Sbjct  9    SLCCIIPHSPRCYKNQTLAFSHSQFFSSNSFLRLKKQSLVSALQINKRQRTRRYRSVP-V  67

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            ++A QSNFLKV+QTVW+VG+DGI+AGTNLVPDS+PR +AR+SVTVVA+  +LF+LKS LS
Sbjct  68   VFAAQSNFLKVVQTVWKVGRDGIEAGTNLVPDSVPRSIARVSVTVVALALSLFVLKSLLS  127

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDGKTTS------VDESLEEARRIMDKYK  569
            T FF LATMG++YF FIALNKDE P+  G TTS      +++SLEEARRIM+KYK
Sbjct  128  TVFFVLATMGLVYFTFIALNKDEGPKGGGGTTSTPKEEGMEDSLEEARRIMEKYK  182



>ref|XP_008372615.1| PREDICTED: uncharacterized protein LOC103435965 [Malus domestica]
Length=182

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 129/176 (73%), Gaps = 15/176 (9%)
 Frame = +3

Query  69   LCSTSPSCLHPKSHQRNRALP---SQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPS  239
            + + SP+C       +N++L    SQF SSNS L+LKKQ+  S  R ++  ++  +    
Sbjct  13   ITAQSPNCY------KNQSLAFTHSQFFSSNSSLRLKKQSLLSAXRIKRQRTQNHRFVVX  66

Query  240  FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
             ++A QSN  K +QT W+VG+DG++AGTNLVP+S+PRP+AR+SVT+VA+T +LF+LKSFL
Sbjct  67   VVFASQSNXFKALQTAWKVGRDGVEAGTNLVPNSVPRPVARVSVTIVALTLSLFVLKSFL  126

Query  420  STAFFALATMGVIYFAFIALNKDESPRVDGKTTS------VDESLEEARRIMDKYK  569
            STAFF LATMG++YF FIALNKDE PR  G TTS      +D+SLEEARRIM+KYK
Sbjct  127  STAFFVLATMGLVYFIFIALNKDEGPRWSGGTTSTPKEDRMDDSLEEARRIMEKYK  182



>ref|XP_010109684.1| hypothetical protein L484_015169 [Morus notabilis]
 gb|EXC24154.1| hypothetical protein L484_015169 [Morus notabilis]
Length=182

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 108/139 (78%), Gaps = 8/139 (6%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRP  353
            Q+  S +RFRKL +++  + P  ++A Q+NFLKVIQT W+V +DGI+AGTNLVP SIPRP
Sbjct  45   QSLNSQLRFRKLTTQKSASFP-VVFAAQTNFLKVIQTAWKVARDGIEAGTNLVPGSIPRP  103

Query  354  LARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKT------  515
            +ARISVTV A+  +LF+LKSFLSTAFF LATMG++YF FIAL KDE PR  G T      
Sbjct  104  IARISVTVAALAVSLFVLKSFLSTAFFVLATMGLVYFTFIALYKDEGPRGGGDTKFTKDT  163

Query  516  -TSVDESLEEARRIMDKYK  569
             TS +++LEEARRIM+KYK
Sbjct  164  PTSTEDALEEARRIMEKYK  182



>ref|XP_009371161.1| PREDICTED: uncharacterized protein LOC103960411 [Pyrus x bretschneideri]
Length=182

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 130/182 (71%), Gaps = 17/182 (9%)
 Frame = +3

Query  57   FHRILCST--SPSCLHPKSHQRNRALP---SQFlssnsllklkkQTAFSTVRFRKLNSRR  221
               + C T  SP+C       +N++L    SQF SSNS L+LKKQ+  S +R ++  ++ 
Sbjct  7    LQSLCCITVQSPNCY------KNQSLAFTHSQFFSSNSSLRLKKQSLLSAIRIKRQRTQN  60

Query  222  FQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALF  401
             +      +A QSNF K +QT W+VG+DG++AGTNL+P+S+PRP+AR+SVT+VA+T +LF
Sbjct  61   HRFVVPVAFASQSNFFKALQTAWKVGRDGVEAGTNLMPNSVPRPVARVSVTMVALTLSLF  120

Query  402  LLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS------VDESLEEARRIMDK  563
            +LKSFLSTAFF LATMG++YF FIALN DE PR  G TTS      +D+SLEEARRI+DK
Sbjct  121  VLKSFLSTAFFVLATMGLVYFIFIALNNDEGPRRSGGTTSTPKEDGMDDSLEEARRIVDK  180

Query  564  YK  569
            YK
Sbjct  181  YK  182



>ref|XP_004240464.1| PREDICTED: uncharacterized protein LOC101259250 [Solanum lycopersicum]
Length=159

 Score =   170 bits (430),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 124/157 (79%), Gaps = 10/157 (6%)
 Frame = +3

Query  99   PKSHQRNRALPSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVI  278
            PK ++ N++    FLSSNSLLKLKKQT+ ST   RKL + R  A P  I+A QSNFLKV+
Sbjct  13   PKCYRINQS----FLSSNSLLKLKKQTSLST---RKLKNVR--ATP-LIFAAQSNFLKVL  62

Query  279  QTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMGVI  458
            QT WRVGKDG++AGTN+VPD+IPRP+ARI VTVV   FALF LKSFLST FFALA MGVI
Sbjct  63   QTAWRVGKDGVEAGTNMVPDAIPRPIARICVTVVGAAFALFALKSFLSTVFFALAMMGVI  122

Query  459  YFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            YF FIALNKD+ P+  G   SVD+SLEEARRIM+KYK
Sbjct  123  YFGFIALNKDDGPKGGGGNASVDDSLEEARRIMEKYK  159



>gb|KJB10972.1| hypothetical protein B456_001G234600 [Gossypium raimondii]
Length=172

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 125/164 (76%), Gaps = 9/164 (5%)
 Frame = +3

Query  81   SPSCLHPKSHQRNRALP-SQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAVQ  257
            SP C H   + +  ALP S FLS  S L+LK++T FS ++F K  + R       +YA+Q
Sbjct  17   SPKCYH---NNQTLALPHSNFLSPTSFLRLKRKTLFSNIQFNKPLAPR-----PLVYALQ  68

Query  258  SNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFA  437
            SNF KVIQTVW+VGKDG++AGTNLVPDS+PRP+ARISV+VV +   LF+LKSFLSTAFFA
Sbjct  69   SNFFKVIQTVWKVGKDGVEAGTNLVPDSVPRPIARISVSVVVLFVTLFVLKSFLSTAFFA  128

Query  438  LATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            LATMG++YF FIALNKD+ PR    + S+++ +EEAR+IM+KYK
Sbjct  129  LATMGLVYFVFIALNKDQGPRGGSGSESMEDPVEEARKIMEKYK  172



>ref|XP_007140554.1| hypothetical protein PHAVU_008G122300g [Phaseolus vulgaris]
 gb|ESW12548.1| hypothetical protein PHAVU_008G122300g [Phaseolus vulgaris]
Length=177

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 105/122 (86%), Gaps = 3/122 (2%)
 Frame = +3

Query  213  SRRFQAQPSFI-YAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVT  389
            SR  + +P+F+ +A QSNFLKV+Q  WRVG+DGI+AGTNLVP+S+PRP+ARISVT+VA++
Sbjct  56   SRTQKPRPTFVVFAAQSNFLKVLQNAWRVGRDGIEAGTNLVPNSVPRPIARISVTIVALS  115

Query  390  FALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS--VDESLEEARRIMDK  563
              LF+LK+FLSTAFF LAT+G+ YFA++A NKD+ PR +G+TTS  +D+ +EEAR+IMDK
Sbjct  116  VTLFVLKAFLSTAFFILATIGLSYFAYLAFNKDQGPRGNGETTSTPMDDPVEEARKIMDK  175

Query  564  YK  569
            YK
Sbjct  176  YK  177



>ref|XP_012085163.1| PREDICTED: uncharacterized protein LOC105644428 [Jatropha curcas]
 gb|KDP26422.1| hypothetical protein JCGZ_17580 [Jatropha curcas]
Length=175

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = +3

Query  69   LCSTSPSCLHPKSHQ-RNRALPSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFI  245
            LCS  P    PK  + +   L SQFL SNS L+LK Q     ++  +   R  ++ P  +
Sbjct  10   LCSI-PLSYSPKRCKFQTLTLNSQFLFSNSFLRLKNQPLLPKLQILRSKPRNPRSLP-VV  67

Query  246  YAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLST  425
            +A Q NF+KV+QTV +VGKDGI+AGTNLVPDS+PRP+ARISVT+ A+T +LF+LKSFLST
Sbjct  68   FAAQFNFVKVVQTVLKVGKDGIEAGTNLVPDSVPRPIARISVTIAALTISLFVLKSFLST  127

Query  426  AFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            A FALATMG +YF FIALNKD+ PR  G   S D+ LEEARRIM+KYK
Sbjct  128  ALFALATMGFVYFIFIALNKDQGPRDGGGGNSSDDPLEEARRIMEKYK  175



>ref|XP_002303086.1| hypothetical protein POPTR_0002s25310g [Populus trichocarpa]
 gb|ABK96529.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE82359.1| hypothetical protein POPTR_0002s25310g [Populus trichocarpa]
Length=172

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +3

Query  225  QAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFL  404
            ++ P  ++A QSNFLKV+QTVW+VGKDGI+ GTNLVP+S+PRP+AR++VT V +  +LFL
Sbjct  59   RSAPVVVFAAQSNFLKVVQTVWKVGKDGIETGTNLVPNSVPRPIARVAVTFVVLAVSLFL  118

Query  405  LKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            LKSFLST FFALATMG++YF FIALNKD+ P+  G TT +++  EEARRIM+KYK
Sbjct  119  LKSFLSTVFFALATMGLVYFTFIALNKDQGPKGGGGTT-LEDPEEEARRIMEKYK  172



>ref|XP_002521134.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41285.1| conserved hypothetical protein [Ricinus communis]
Length=177

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 6/122 (5%)
 Frame = +3

Query  210  NSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVT  389
            NSR F      I+AVQSNFLKV+QT W+VGKDGIDAGT LVPDS+PRP+ARISVT+VA++
Sbjct  60   NSRSFPV----IFAVQSNFLKVVQTAWKVGKDGIDAGTRLVPDSVPRPIARISVTIVALS  115

Query  390  FALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPR--VDGKTTSVDESLEEARRIMDK  563
             +LF+LKS LSTAFFALATMG +YF FIALNKD+ P+    G TTS ++ LEEARRIM+K
Sbjct  116  VSLFVLKSVLSTAFFALATMGFVYFVFIALNKDQRPKGGGTGSTTSSEDPLEEARRIMEK  175

Query  564  YK  569
            YK
Sbjct  176  YK  177



>ref|XP_004290233.1| PREDICTED: uncharacterized protein LOC101302315 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 10/134 (7%)
 Frame = +3

Query  186  STVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARI  365
            ST+R +   +R        ++A QSN  K +QT W VGKDGI+AGT+LVP SIPRP+ARI
Sbjct  45   STLRIKSPTTR----TSGVVFAAQSNIFKALQTAWNVGKDGIEAGTSLVPASIPRPIARI  100

Query  366  SVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTT------SVD  527
            SVT+VA++ +LF+LKSF+ST FF LATMG+ YF FIALNKDE P+  G TT       VD
Sbjct  101  SVTIVALSVSLFVLKSFVSTVFFVLATMGLAYFVFIALNKDEGPKGTGGTTKTPKENGVD  160

Query  528  ESLEEARRIMDKYK  569
            +SLEEARRIM+KYK
Sbjct  161  DSLEEARRIMEKYK  174



>ref|NP_001238732.1| uncharacterized protein LOC100527102 [Glycine max]
 gb|ACU16146.1| unknown [Glycine max]
Length=172

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 14/174 (8%)
 Frame = +3

Query  57   FHRILCSTSPSCLHPKSHQRNRALPSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQP  236
            F  + C  S +C H   HQ        F S NSLL+LKKQT  + + F+  +SR  + + 
Sbjct  10   FCSVACCIS-NCGHNTHHQ--------FHSPNSLLRLKKQTFLTNIYFK--SSRTQKPRS  58

Query  237  SFIY-AVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKS  413
            SF+  A QSNF+KV+Q  W+VG+DGI+AGTNLVP+S+PRP+ARISVT+VA++  LF+LK+
Sbjct  59   SFVVSAAQSNFVKVLQNAWKVGRDGIEAGTNLVPNSVPRPIARISVTIVALSVTLFVLKA  118

Query  414  FLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS--VDESLEEARRIMDKYK  569
            FLSTAFF LAT+G+ YFA++A NKD+ P  +G TTS  +D+ +EEAR+IM+KYK
Sbjct  119  FLSTAFFILATIGLAYFAYLAFNKDQGPSGNGGTTSTPMDDPVEEARKIMEKYK  172



>gb|KHN07824.1| hypothetical protein glysoja_035862 [Glycine soja]
Length=177

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 129/172 (75%), Gaps = 9/172 (5%)
 Frame = +3

Query  69   LCSTSPSCLHPKSHQRNRALPS--QFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSF  242
             CS +  C+    H R   +P+  QF S NSLL+LKKQT  + + F+  +SR  + + SF
Sbjct  10   FCSVA-CCISNCGHNRT-LVPTHHQFHSPNSLLRLKKQTFLTNIYFK--SSRTQKPRSSF  65

Query  243  IY-AVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
            +  A QSNF+KV+Q  W+VG+DGI+AGTNLVP+S+PRP+ARISVT+VA++  LF+LK+FL
Sbjct  66   VVSAAQSNFVKVLQNAWKVGRDGIEAGTNLVPNSVPRPIARISVTIVALSVTLFVLKAFL  125

Query  420  STAFFALATMGVIYFAFIALNKDESPRVDGKTTS--VDESLEEARRIMDKYK  569
            STAFF LAT+G+ YFA++A NKD+ P  +G TTS  +D+ +EEAR+IM+KYK
Sbjct  126  STAFFILATIGLAYFAYLAFNKDQGPSGNGGTTSTPMDDPVEEARKIMEKYK  177



>gb|KDO65861.1| hypothetical protein CISIN_1g031279mg [Citrus sinensis]
Length=162

 Score =   159 bits (403),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRP  353
            Q+  S  + R L  R+ ++  + +YA QSNFLK +QTVW+V KDGI+ GTN+VP+++PRP
Sbjct  31   QSLLSDTQTRDLKIRKPRSF-TVVYAAQSNFLKAVQTVWKVAKDGIEVGTNMVPETVPRP  89

Query  354  LARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDES  533
            +ARIS+TVVA++ AL++LKSFLSTAFF LATMG+ YF +IALNKD+ P+    +T  +E 
Sbjct  90   VARISITVVALSVALYVLKSFLSTAFFVLATMGLAYFIYIALNKDDRPKGGADSTPTEED  149

Query  534  -LEEARRIMDKYK  569
             +EEARRIM+KYK
Sbjct  150  PVEEARRIMEKYK  162



>ref|XP_006443660.1| hypothetical protein CICLE_v10022604mg [Citrus clementina]
 ref|XP_006480186.1| PREDICTED: uncharacterized protein LOC102623558 [Citrus sinensis]
 gb|ESR56900.1| hypothetical protein CICLE_v10022604mg [Citrus clementina]
Length=162

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRP  353
            Q+  S  + R L  R+ ++  + +YA QSNFLK +QTVW+V KDGI+ GTN+VP+++PRP
Sbjct  31   QSLLSYTQTRDLKIRKPRSF-TVVYAAQSNFLKAVQTVWKVAKDGIEVGTNMVPETVPRP  89

Query  354  LARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDES  533
            +ARIS+TVVA++ AL++LKSFLSTAFF LATMG+ YF +IALNKD+ P+    +T  +E 
Sbjct  90   VARISITVVALSVALYVLKSFLSTAFFVLATMGLAYFIYIALNKDDRPKGGADSTPTEED  149

Query  534  -LEEARRIMDKYK  569
             +EEARRIM+KYK
Sbjct  150  PVEEARRIMEKYK  162



>ref|XP_010684953.1| PREDICTED: uncharacterized protein LOC104899456 [Beta vulgaris 
subsp. vulgaris]
Length=176

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 114/171 (67%), Gaps = 5/171 (3%)
 Frame = +3

Query  66   ILCSTSPSCLHPKSHQRNR---ALPSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQP  236
            +LC   P    P++  + R    + SQFLS NS   L  +     +R   L  R   A  
Sbjct  8    MLCGILPILPLPRTCLKYRHISTIHSQFLSFNSSFSLTTKILLPNLRISGLRKRNSHAP-  66

Query  237  SFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSF  416
              I+A QSNF +VIQT  ++GKDG++AGTNLVP+S+PRP+AR+SV V+A    LF+L+SF
Sbjct  67   -LIFAAQSNFFRVIQTALKIGKDGVEAGTNLVPESVPRPVARLSVGVLASAVTLFVLRSF  125

Query  417  LSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            LSTAFF L  MG +YF ++ALNKD+ P++D K  S D+++EEAR+IMDKYK
Sbjct  126  LSTAFFTLGFMGFVYFIYLALNKDKGPKLDDKPGSTDDAIEEARKIMDKYK  176



>ref|XP_010435300.1| PREDICTED: uncharacterized protein LOC104719141 [Camelina sativa]
Length=180

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            RF  L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  52   RFTPLQPQRVRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  110

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS-----VDESLE  539
            + A+  +LF++KSFLSTAFF L TMG  YF FIALNKDE+P++ G+  S     +D+ LE
Sbjct  111  IAALAVSLFVVKSFLSTAFFVLGTMGFAYFLFIALNKDEAPKLRGEDKSSGSKPLDDPLE  170

Query  540  EARRIMDKYK  569
            EA+RIMDKYK
Sbjct  171  EAKRIMDKYK  180



>gb|EPS72222.1| hypothetical protein M569_02530 [Genlisea aurea]
Length=142

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 3/108 (3%)
 Frame = +3

Query  249  AVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTA  428
            A QS  L+VIQTVW+VG+ GI+ GTNLVPD+IPRP+ARISVTVV +  ALF+LKSFLST 
Sbjct  37   AGQSGLLRVIQTVWKVGRSGIEGGTNLVPDAIPRPIARISVTVVVLALALFVLKSFLSTL  96

Query  429  FFALATMGVIYFAFIALNKDE-SPRVDGKTTSVDESLEEARRIMDKYK  569
            FFALA MG+ YFAF+ALNKDE  P+   K+TSV++SLEEAR+IM+KYK
Sbjct  97   FFALAVMGLSYFAFLALNKDEVGPK--EKSTSVEDSLEEARKIMEKYK  142



>ref|XP_002264856.1| PREDICTED: uncharacterized protein LOC100256241 [Vitis vinifera]
 emb|CBI37261.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 103/133 (77%), Gaps = 8/133 (6%)
 Frame = +3

Query  192  VRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISV  371
            ++ +KL  R+ +++P  + A QSNFL+VIQTVW++GKDGI+AGTNLVP+S+PRP+ARISV
Sbjct  44   IQTQKLRIRKSRSRP-VVCASQSNFLRVIQTVWKIGKDGIEAGTNLVPESVPRPIARISV  102

Query  372  TVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNK-------DESPRVDGKTTSVDE  530
            TVV +  ALF+ KSFLSTAFF LA MG+IYF FIALNK            VDG T S ++
Sbjct  103  TVVTLAVALFVFKSFLSTAFFVLAMMGLIYFTFIALNKDDGPRGGGGGGGVDGGTPSTED  162

Query  531  SLEEARRIMDKYK  569
            SLEEARRIM+KYK
Sbjct  163  SLEEARRIMEKYK  175



>ref|XP_003532307.1| PREDICTED: uncharacterized protein LOC100794171 isoform X1 [Glycine 
max]
 ref|XP_006586271.1| PREDICTED: uncharacterized protein LOC100794171 isoform X2 [Glycine 
max]
Length=177

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = +3

Query  213  SRRFQAQPS--FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAV  386
            S R Q  PS   + A QSNF+KV+Q  W+VG+DGI+AGTNL P+S+PRP+ARISVT+VA+
Sbjct  55   SSRTQKPPSSFVVSAAQSNFVKVLQNAWKVGRDGIEAGTNLAPNSVPRPIARISVTIVAL  114

Query  387  TFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS--VDESLEEARRIMD  560
            +  LF+LK+FLSTAFF LAT+G+ YFA++A NKD+ P  +G T S  +D+ +EEAR+IM+
Sbjct  115  SVTLFVLKAFLSTAFFILATIGLAYFAYLAFNKDQGPSGNGGTASTPMDDPVEEARKIME  174

Query  561  KYK  569
            KYK
Sbjct  175  KYK  177



>gb|KJB10973.1| hypothetical protein B456_001G234600 [Gossypium raimondii]
Length=187

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 124/179 (69%), Gaps = 24/179 (13%)
 Frame = +3

Query  81   SPSCLHPKSHQRNRALP-SQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAVQ  257
            SP C H   + +  ALP S FLS  S L+LK++T FS ++F K  + R       +YA+Q
Sbjct  17   SPKCYH---NNQTLALPHSNFLSPTSFLRLKRKTLFSNIQFNKPLAPR-----PLVYALQ  68

Query  258  SNFLK---------------VIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTF  392
            SNF K                IQTVW+VGKDG++AGTNLVPDS+PRP+ARISV+VV +  
Sbjct  69   SNFFKGLVVSMVFADNHVISFIQTVWKVGKDGVEAGTNLVPDSVPRPIARISVSVVVLFV  128

Query  393  ALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
             LF+LKSFLSTAFFALATMG++YF FIALNKD+ PR    + S+++ +EEAR+IM+KYK
Sbjct  129  TLFVLKSFLSTAFFALATMGLVYFVFIALNKDQGPRGGSGSESMEDPVEEARKIMEKYK  187



>ref|XP_011024551.1| PREDICTED: uncharacterized protein LOC105125688 [Populus euphratica]
 ref|XP_011024552.1| PREDICTED: uncharacterized protein LOC105125688 [Populus euphratica]
 ref|XP_011024554.1| PREDICTED: uncharacterized protein LOC105125688 [Populus euphratica]
Length=172

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRP  353
            Q+    +R +   ++  ++ P  ++A QSNFLKV+QTVW+VGKDGI+AGTNLVP+ +PRP
Sbjct  42   QSLLPNLRVKNPRTKNPRSAPVVVFAAQSNFLKVVQTVWKVGKDGIEAGTNLVPNPVPRP  101

Query  354  LARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDES  533
            +AR++VTVV +  +LFLLKSFLST FFALATMG++YF FIALNKD+ P+  G TT +++ 
Sbjct  102  IARVAVTVVVLAVSLFLLKSFLSTVFFALATMGLVYFTFIALNKDQGPKGGGGTT-LEDP  160

Query  534  LEEARRIMDKYK  569
             EEARRIM+KYK
Sbjct  161  EEEARRIMEKYK  172



>ref|XP_010450306.1| PREDICTED: uncharacterized protein LOC104732456 [Camelina sativa]
Length=180

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   +  RR +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  52   RIAPVQPRRVRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  110

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS-----VDESLE  539
            + A+  +LF++KSFLSTAFF L TMG  YF FIALNKDE+P++ G+  S     +D+ LE
Sbjct  111  IAALAVSLFVVKSFLSTAFFVLGTMGFAYFLFIALNKDEAPKLRGEDKSSGSKPLDDPLE  170

Query  540  EARRIMDKYK  569
            EA+RIMDKYK
Sbjct  171  EAKRIMDKYK  180



>gb|KHN25000.1| hypothetical protein glysoja_027114 [Glycine soja]
Length=177

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = +3

Query  213  SRRFQAQPS--FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAV  386
            S R Q  PS   + A QSNF+KV+Q  W+VG+DGI+AGTNLVP+ +PRP+ARISVT+VA+
Sbjct  55   SSRTQKPPSSFVVSAAQSNFVKVLQNAWKVGRDGIEAGTNLVPNFVPRPIARISVTIVAL  114

Query  387  TFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS--VDESLEEARRIMD  560
            +  LF+LK+FLSTAFF LAT+G+ YFA++A NKD+ P  +G T S  +D+ +EEAR+IM+
Sbjct  115  SVTLFVLKAFLSTAFFILATIGLAYFAYLAFNKDQGPSGNGGTASTPMDDPVEEARKIME  174

Query  561  KYK  569
            KYK
Sbjct  175  KYK  177



>ref|XP_002863159.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39418.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=179

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   L S+R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  51   RIAPLQSQRVRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  109

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS-----VDESLE  539
            + A+  +LF++KSFLSTAFF L TMG  YF FIALNKDE+P++ G   S     +D+ LE
Sbjct  110  IAALAVSLFVVKSFLSTAFFVLGTMGFAYFLFIALNKDEAPKLRGDDNSSGSKPMDDPLE  169

Query  540  EARRIMDKYK  569
            EA++IMDKYK
Sbjct  170  EAKKIMDKYK  179



>ref|XP_010440666.1| PREDICTED: uncharacterized protein LOC104723933 [Camelina sativa]
Length=180

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  52   RIAPLQPQRVRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  110

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS-----VDESLE  539
            + A+  +LF++KSFLSTAFF L TMG  YF FIALNKDE+P++ G+  S     +D+ LE
Sbjct  111  IAALAVSLFVVKSFLSTAFFVLGTMGFAYFLFIALNKDEAPKLRGEDKSSGSKPLDDPLE  170

Query  540  EARRIMDKYK  569
            EA+RIMDKYK
Sbjct  171  EAKRIMDKYK  180



>ref|NP_193058.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAR20713.1| At4g13220 [Arabidopsis thaliana]
 gb|AAS92334.1| At4g13220 [Arabidopsis thaliana]
 gb|AEE83247.1| uncharacterized protein AT4G13220 [Arabidopsis thaliana]
Length=176

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  48   RIAPLQPQRLRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  106

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGK-----TTSVDESLE  539
            + A+  +LF++KSFLSTAFF L TMG  YF FIALNKDE+P++ G      + S+D+ LE
Sbjct  107  IAALAVSLFVVKSFLSTAFFVLGTMGFAYFLFIALNKDEAPKLRGDDNSSGSKSMDDPLE  166

Query  540  EARRIMDKYK  569
            EA++IMDKYK
Sbjct  167  EAKKIMDKYK  176



>ref|XP_006284538.1| hypothetical protein CARUB_v10005740mg, partial [Capsella rubella]
 gb|EOA17436.1| hypothetical protein CARUB_v10005740mg, partial [Capsella rubella]
Length=207

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 6/130 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  79   RIAPLQPQRVRSK-TLVLSAQSSFLKVLRTAWSIGKDGIEAGTNLVPVSVPRPVARISVT  137

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGK-----TTSVDESLE  539
            + A+  +LF++KSFLSTAFF L TMG  YF FIALNKDE+P++ G+     + S+D+ LE
Sbjct  138  IAALAVSLFVVKSFLSTAFFVLGTMGFAYFLFIALNKDEAPKLRGEDNSSGSKSMDDPLE  197

Query  540  EARRIMDKYK  569
            EA+RIMDKYK
Sbjct  198  EAKRIMDKYK  207



>ref|XP_010048694.1| PREDICTED: uncharacterized protein LOC104437453 [Eucalyptus grandis]
 gb|KCW81062.1| hypothetical protein EUGRSUZ_C02436 [Eucalyptus grandis]
Length=176

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 114/172 (66%), Gaps = 15/172 (9%)
 Frame = +3

Query  87   SCLH--PKSHQRNRA--LPSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAV  254
            S LH  P+S  R RA  LPS+ +S  +      +        R+L  RR     S + A 
Sbjct  9    SLLHIPPRSSTRPRAQLLPSKPISRLNNPAPFARAGAHHGPIRRLGGRRS----STVVAS  64

Query  255  QSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFF  434
            QSNFLKV QTVW+VG+D I+AGTNLVPD++PRP+ARISVT V ++ ALF+LKSFLSTAFF
Sbjct  65   QSNFLKVAQTVWKVGRDAIEAGTNLVPDAVPRPVARISVTFVGLSVALFVLKSFLSTAFF  124

Query  435  ALATMGVIYFAFIALNKDESPRVDGKTTS-------VDESLEEARRIMDKYK  569
             LATMG+IYF F+ALNKD  P+  G           +D+ +EEAR+IM+KYK
Sbjct  125  VLATMGLIYFTFLALNKDNGPKGGGDGPKGGGAAPPMDDPMEEARKIMEKYK  176



>ref|XP_006414949.1| hypothetical protein EUTSA_v10026377mg [Eutrema salsugineum]
 gb|ESQ56402.1| hypothetical protein EUTSA_v10026377mg [Eutrema salsugineum]
Length=176

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  186  STVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARI  365
            S  R   L S+R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARI
Sbjct  45   SRTRISPLQSKRARSK-TIVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARI  103

Query  366  SVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRV--DGKTTS---VDE  530
            SVT  A+  +LF+LKSF+STAFF L TMG  YF FIALNKDE+P+   D K++S   +D+
Sbjct  104  SVTTAALAVSLFVLKSFVSTAFFVLGTMGFAYFLFIALNKDEAPKQGRDSKSSSSKPMDD  163

Query  531  SLEEARRIMDKYK  569
             LEEA++IM+KYK
Sbjct  164  PLEEAKKIMEKYK  176



>ref|XP_011620359.1| PREDICTED: uncharacterized protein LOC18426027 [Amborella trichopoda]
Length=168

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +3

Query  234  PSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKS  413
            P+ + AV+S   KVIQT WRVGKDG++AGTNLVPDS+PRP+ARI V V+ +T +L++LKS
Sbjct  50   PATVVAVRSTVSKVIQTAWRVGKDGLEAGTNLVPDSVPRPIARIGVAVLTLTLSLYVLKS  109

Query  414  FLSTAFFALATMGVIYFAFIALNKDE------SPRVDGKTTSVDESLEEARRIMDKYK  569
             LSTAFF LA MG+IYF FIALNKDE             T+S DE+LEEARRIM+KY+
Sbjct  110  LLSTAFFVLAMMGLIYFVFIALNKDEGPGRGGGGGGGDGTSSTDETLEEARRIMEKYR  167



>ref|XP_010532868.1| PREDICTED: uncharacterized protein LOC104808772 [Tarenaya hassleriana]
Length=179

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = +3

Query  186  STVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARI  365
            S +RF  L +RR +++ + + +VQSNF+KV++T W +G+DGI+AGTNL+P+S+PRP+AR+
Sbjct  49   SGIRFSPLGTRRARSR-TVVLSVQSNFMKVLRTAWNIGRDGIEAGTNLIPESVPRPVARV  107

Query  366  SVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPR----VDGKTTSVDES  533
            SVT+ A   +LF+LKSFLSTAFF L TMG  YF FIALNK + PR        +  +++ 
Sbjct  108  SVTIAASMVSLFVLKSFLSTAFFVLGTMGFAYFLFIALNKGDGPRPGGGSSSGSEPMEDP  167

Query  534  LEEARRIMDKYK  569
            L+EAR+IMDKYK
Sbjct  168  LDEARKIMDKYK  179



>gb|KEH22830.1| transmembrane protein, putative [Medicago truncatula]
Length=174

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 3/112 (3%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            ++A QSN  KV+Q  WRVGKDGIDAGTNLVP+S+PRP+ARISVT VA++  LF+ KS LS
Sbjct  63   VFAEQSNLSKVLQNAWRVGKDGIDAGTNLVPNSVPRPIARISVTFVALSALLFVFKSLLS  122

Query  423  TAFFALATMGVIYFAFIALNKDES-PRVDGKTTS--VDESLEEARRIMDKYK  569
            TAFF LAT+G+ YFA++A NKD+  P  +G TT+  +D+ LEEA RIMDKYK
Sbjct  123  TAFFILATIGLAYFAYLAFNKDQGPPSGNGGTTTKPMDDPLEEANRIMDKYK  174



>ref|XP_010940646.1| PREDICTED: uncharacterized protein LOC105059127 [Elaeis guineensis]
Length=170

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 7/112 (6%)
 Frame = +3

Query  255  QSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFF  434
             SNF +V+QT WR+GKD  +AGT +VPD +PRP+ARI V VVA T ALFL+KSFLSTAFF
Sbjct  59   NSNFFRVVQTAWRIGKDVTEAGTKIVPDVVPRPIARIGVAVVAGTVALFLVKSFLSTAFF  118

Query  435  ALATMGVIYFAFIALNK------DESPRVDGKTTSVDE-SLEEARRIMDKYK  569
             LA MG IYF FIALN       DES RVDG T S +E +LEEARRIM+KYK
Sbjct  119  VLAMMGFIYFVFIALNTDESSRVDESSRVDGSTMSTEEDALEEARRIMEKYK  170



>gb|KFK39768.1| hypothetical protein AALP_AA3G285200 [Arabis alpina]
Length=172

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 101/134 (75%), Gaps = 7/134 (5%)
 Frame = +3

Query  186  STVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARI  365
            S  R   L S+R +++ + + + QSNF KV++  W +GKDGI+AGT+LVP S+PRP+ARI
Sbjct  40   SRTRIVPLQSQRVRSK-TLVLSAQSNFFKVLRKAWNIGKDGIEAGTSLVPVSVPRPVARI  98

Query  366  SVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESP---RVDGKTTS---VD  527
            SVT+ A+  +LF+LKSF+STAFF L TMG  YF FIALNKDE+P   R +G ++S   +D
Sbjct  99   SVTIAALGVSLFVLKSFVSTAFFVLGTMGFAYFLFIALNKDEAPKQRRGEGDSSSSKPMD  158

Query  528  ESLEEARRIMDKYK  569
            + LEEA++IMDKYK
Sbjct  159  DPLEEAKKIMDKYK  172



>emb|CAN75300.1| hypothetical protein VITISV_008677 [Vitis vinifera]
Length=221

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 7/130 (5%)
 Frame = +3

Query  192  VRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISV  371
            ++ +KL  R+ +++P  + A QSNFL+VIQTVW++GKDGI+AGTNLVP+S+PRP+ARISV
Sbjct  44   IQTQKLRIRKSRSRP-VVCASQSNFLRVIQTVWKIGKDGIEAGTNLVPESVPRPIARISV  102

Query  372  TVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNK------DESPRVDGKTTSVDES  533
            TVV +  ALF+ KSFLSTAFF LA MG+IYF FIALNK           VDG T S ++S
Sbjct  103  TVVTLAVALFVFKSFLSTAFFVLAMMGLIYFTFIALNKDDGPRGGGGGGVDGGTPSTEDS  162

Query  534  LEEARRIMDK  563
            LEEARRIM+K
Sbjct  163  LEEARRIMEK  172



>emb|CAB41932.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78364.1| hypothetical protein [Arabidopsis thaliana]
Length=180

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 10/134 (7%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  48   RIAPLQPQRLRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  106

Query  375  VVAVTFALFLLKSFLSTAFFAL----ATMGVIYFAFIALNKDESPRVDGK-----TTSVD  527
            + A+  +LF++KSFLSTAFF L     TMG  YF FIALNKDE+P++ G      + S+D
Sbjct  107  IAALAVSLFVVKSFLSTAFFVLVCCVGTMGFAYFLFIALNKDEAPKLRGDDNSSGSKSMD  166

Query  528  ESLEEARRIMDKYK  569
            + LEEA++IMDKYK
Sbjct  167  DPLEEAKKIMDKYK  180



>emb|CDY71052.1| BnaCnng71100D [Brassica napus]
Length=185

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 94/132 (71%), Gaps = 7/132 (5%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R R  +S R   +   + + Q++ LKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT
Sbjct  54   RIRISSSHRVPTKTLVVLSAQTSLLKVLKTAWNIGKDGIEAGTNLVPVSVPRPVARISVT  113

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPR-------VDGKTTSVDES  533
            + A+  +LF+LKSFLSTAFF L TMG  YF FIA NKDE+P+       + G T   ++ 
Sbjct  114  IAALAVSLFVLKSFLSTAFFVLGTMGFAYFLFIAFNKDEAPKQRGGEDNISGSTPMDNDP  173

Query  534  LEEARRIMDKYK  569
            LEEA++IMDKYK
Sbjct  174  LEEAKKIMDKYK  185



>ref|XP_004152015.1| PREDICTED: uncharacterized protein LOC101207451 isoform X1 [Cucumis 
sativus]
Length=177

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +3

Query  204  KLNSRRFQAQPSF--IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTV  377
            ++   R +  PSF  +YA Q+NFL+V QTVW++GKDGI+AGT+LVPDS+PRP+ARISV +
Sbjct  50   QIEKLRTRGSPSFPLVYAAQNNFLRVFQTVWKIGKDGIEAGTDLVPDSVPRPIARISVGI  109

Query  378  VAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKD----ESPRVDGKTTSVDESLEEA  545
            VA+T  LFL KS LSTA F LA MG IYF FIALNKD             TS +E+LEEA
Sbjct  110  VALTIGLFLFKSVLSTALFVLAMMGAIYFIFIALNKDEGPRGGGGSSSSPTSTEETLEEA  169

Query  546  RRIMDKYK  569
            RRIM+KYK
Sbjct  170  RRIMEKYK  177



>emb|CDY64817.1| BnaA08g31610D [Brassica napus]
Length=187

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 88/117 (75%), Gaps = 8/117 (7%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + Q++ LKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT+ A+  +LF+LKSFLS
Sbjct  71   VLSAQTSLLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVTIAALAVSLFVLKSFLS  130

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDG--------KTTSVDESLEEARRIMDKYK  569
            TAFF L TMG  YF FIALNKDE+P+  G        K    D+ LEEA++IMDKYK
Sbjct  131  TAFFVLGTMGFAYFLFIALNKDEAPKQRGGEDNISGSKPMDYDDPLEEAKKIMDKYK  187



>ref|XP_009386598.1| PREDICTED: uncharacterized protein LOC103973687 [Musa acuminata 
subsp. malaccensis]
Length=161

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +3

Query  255  QSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFF  434
            QSN  K IQT WR+GKD  +AG NLVPDSIPRP+ARI +  VAVT ALF+LKSF+ST FF
Sbjct  56   QSNLFKAIQTAWRIGKDVTEAGANLVPDSIPRPIARIGIITVAVTIALFILKSFVSTVFF  115

Query  435  ALATMGVIYFAFIALNKDE-SPRVDGKTTSVDESLEEARRIMDKYK  569
             LA MG++YF F++LN DE S R    T++ +E+LEEARRIM+KYK
Sbjct  116  VLAVMGLVYFVFVSLNTDELSTRSKITTSNEEETLEEARRIMEKYK  161



>ref|XP_009110710.1| PREDICTED: uncharacterized protein LOC103836221 [Brassica rapa]
Length=185

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + Q++ LKV++T W +GKDGI+AGTNLVP S+PRP+ARISVT+ A+  +LF+LKSFLS
Sbjct  71   VLSAQTSLLKVLRTAWNIGKDGIEAGTNLVPVSVPRPVARISVTIAALAVSLFVLKSFLS  130

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDG------KTTSVDESLEEARRIMDKYK  569
            TAFF + TMG  YF FIALNKDE+P+  G       + ++D+ LEEA++IMDKYK
Sbjct  131  TAFFVVGTMGFAYFLFIALNKDEAPKQRGGEDNISGSKTMDDPLEEAKKIMDKYK  185



>ref|XP_008447333.1| PREDICTED: uncharacterized protein LOC103489804 [Cucumis melo]
Length=174

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 111/171 (65%), Gaps = 25/171 (15%)
 Frame = +3

Query  96   HPKSHQRNR--ALPSQFlssnsllklkkQTAFSTVRFRK---LNSRRFQAQPSF--IYAV  254
            HP +  RN   +L SQF               ++++ +K   +   R +  PSF  +YA 
Sbjct  16   HPLTRHRNPTISLHSQF------------LPLNSLKLKKQSQIEKLRARGSPSFPLVYAA  63

Query  255  QSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFF  434
            Q+NFL+V QTVW++GKDGI+AGT+LVP S+PRP+ARISV +VA+   LFL KS LSTA F
Sbjct  64   QNNFLRVFQTVWKIGKDGIEAGTDLVPGSVPRPIARISVGIVALAIGLFLFKSILSTALF  123

Query  435  ALATMGVIYFAFIALNKDESPR------VDGKTTSVDESLEEARRIMDKYK  569
             LA MG IYF FIALNKDE PR          +TS +E+LEEARRIM+KYK
Sbjct  124  VLAMMGAIYFIFIALNKDEGPRGGGGSSSSSSSTSTEETLEEARRIMEKYK  174



>ref|XP_008789533.1| PREDICTED: uncharacterized protein LOC103706994 [Phoenix dactylifera]
Length=195

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 85/121 (70%), Gaps = 9/121 (7%)
 Frame = +3

Query  234  PSFIYAVQSN--FLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLL  407
            P  + A QSN  F +VIQT WR+GKD  +AGT LVPD +PRPLARI V V A T AL L 
Sbjct  75   PPVVVAAQSNSNFFRVIQTAWRIGKDVTEAGTKLVPDVVPRPLARIGVAVAAGTVALILF  134

Query  408  KSFLSTAFFALATMGVIYFAFIALNKDESPRVD------GKTTSV-DESLEEARRIMDKY  566
            KSFLSTAFF LA MG IYF FIALN DES R D      G T S  D++LEEARRIM+KY
Sbjct  135  KSFLSTAFFVLAMMGFIYFVFIALNTDESSRGDESSMGGGSTASTEDDTLEEARRIMEKY  194

Query  567  K  569
            K
Sbjct  195  K  195



>ref|XP_003563208.1| PREDICTED: uncharacterized protein LOC100828168 [Brachypodium 
distachyon]
Length=156

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 6/128 (5%)
 Frame = +3

Query  192  VRFRKLN-SRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARIS  368
            +R+R LN S+R       + + QSNF K +QT WRVGKD +DAG++LVP S+PRP+ARI 
Sbjct  33   LRYRNLNPSKRLLV----VSSSQSNFSKAVQTAWRVGKDAVDAGSSLVPGSVPRPVARIG  88

Query  369  VTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRV-DGKTTSVDESLEEA  545
            VT VAV+ ALFLLKS +STA F LA MG+IYF F+ +N  E  RV +G T   ++  EEA
Sbjct  89   VTFVAVSVALFLLKSVISTALFVLAMMGLIYFGFLVMNPKEGSRVNEGDTNPSEDPAEEA  148

Query  546  RRIMDKYK  569
            RRIM+KYK
Sbjct  149  RRIMEKYK  156



>gb|EEC78795.1| hypothetical protein OsI_19050 [Oryza sativa Indica Group]
Length=159

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + QSNF +V+QT W+VG+D ++AGT LVP S+PRP+ARI VT VA++ ALFLLKS +S
Sbjct  51   VVSAQSNFSRVVQTAWKVGRDAVEAGTTLVPGSVPRPVARIGVTFVALSIALFLLKSVVS  110

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            TAFF LA MG+IY  F+A+N  E  RVD    S ++ +EEARRIM+KYK
Sbjct  111  TAFFVLAMMGLIYLGFLAMNPKEGSRVDEGANSSEDPVEEARRIMEKYK  159



>gb|KCW81061.1| hypothetical protein EUGRSUZ_C02436 [Eucalyptus grandis]
Length=186

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 114/182 (63%), Gaps = 25/182 (14%)
 Frame = +3

Query  87   SCLH--PKSHQRNRA--LPSQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAV  254
            S LH  P+S  R RA  LPS+ +S  +      +        R+L  RR     S + A 
Sbjct  9    SLLHIPPRSSTRPRAQLLPSKPISRLNNPAPFARAGAHHGPIRRLGGRR----SSTVVAS  64

Query  255  QSNFLKVI----------QTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFL  404
            QSNFLK I          QTVW+VG+D I+AGTNLVPD++PRP+ARISVT V ++ ALF+
Sbjct  65   QSNFLKEIVRWQALKKFAQTVWKVGRDAIEAGTNLVPDAVPRPVARISVTFVGLSVALFV  124

Query  405  LKSFLSTAFFALATMGVIYFAFIALNKDESPRVDGKTTS-------VDESLEEARRIMDK  563
            LKSFLSTAFF LATMG+IYF F+ALNKD  P+  G           +D+ +EEAR+IM+K
Sbjct  125  LKSFLSTAFFVLATMGLIYFTFLALNKDNGPKGGGDGPKGGGAAPPMDDPMEEARKIMEK  184

Query  564  YK  569
            YK
Sbjct  185  YK  186



>ref|NP_001066563.1| Os12g0276100 [Oryza sativa Japonica Group]
 gb|ABA97079.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29582.1| Os12g0276100 [Oryza sativa Japonica Group]
 dbj|BAG88485.1| unnamed protein product [Oryza sativa Japonica Group]
Length=163

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + QSNF +V+QT W+VG+D ++AGT LVP S+PRP+ARI VT VA++ ALFLLKS +S
Sbjct  55   VVSAQSNFSRVVQTAWKVGRDAVEAGTTLVPGSVPRPVARIGVTFVALSIALFLLKSVVS  114

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            TAFF LA MG+IY  F+A+N  E  RVD    S ++ +EEARRIM+KYK
Sbjct  115  TAFFVLAMMGLIYLGFLAMNPKEGSRVDEGANSSEDPVEEARRIMEKYK  163



>gb|EMT26256.1| hypothetical protein F775_08778 [Aegilops tauschii]
Length=158

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (70%), Gaps = 7/129 (5%)
 Frame = +3

Query  189  TVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARIS  368
            ++R  + NSR        + + QSN  K +QT WRVGK+ +DAG+ LVPDS+PRP+ARI 
Sbjct  35   SMRLLRSNSRLL-----VVASAQSNLSKAVQTTWRVGKEAVDAGSALVPDSVPRPIARIG  89

Query  369  VTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRV--DGKTTSVDESLEE  542
            VT VAV+ ALFLLKS +STA F LA MG+IYFAF+A+N  E  R   +G +   D+  EE
Sbjct  90   VTFVAVSVALFLLKSVISTALFVLAMMGLIYFAFLAMNPKEGSRSVDEGDSPPSDDPAEE  149

Query  543  ARRIMDKYK  569
            ARRIM+KYK
Sbjct  150  ARRIMEKYK  158



>dbj|BAJ84991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 7/127 (6%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R  + NSR        + + QSN  K IQT WRVGK+ +DAG+ LVP S+PRP+ARI VT
Sbjct  44   RLLRPNSRLL-----VVASAQSNLSKAIQTTWRVGKEAVDAGSALVPGSVPRPIARIGVT  98

Query  375  VVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRV--DGKTTSVDESLEEAR  548
             VA + ALFLLKS +STA F LA MG+IYFAF+A+N  E  R   +G +   D+  EEAR
Sbjct  99   FVAASVALFLLKSVISTALFVLAMMGLIYFAFLAMNPKEGSRSVDEGDSPPSDDPAEEAR  158

Query  549  RIMDKYK  569
            RIM+KYK
Sbjct  159  RIMEKYK  165



>ref|XP_004515614.1| PREDICTED: uncharacterized protein LOC101498161 [Cicer arietinum]
Length=180

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 13/169 (8%)
 Frame = +3

Query  84   PSCLHPKSHQRNRALPS-QFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFI-YAVQ  257
            PSC       RN AL   QF S NS+LKLK  T  S   F+   SR  + + +F+ +A Q
Sbjct  18   PSC----CQNRNLALTHHQFRSPNSILKLKNPTFLSNTHFKV--SRSLKPRSNFVVFAAQ  71

Query  258  SNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFA  437
            SN  KV+Q  WRVGKDG++AGTNLVP SIPRP+ARISVT VA++  LF+ KS +STAFF 
Sbjct  72   SNIYKVLQNAWRVGKDGVEAGTNLVPSSIPRPIARISVTFVALSVFLFVFKSLISTAFFI  131

Query  438  LATMGVIYFAFIALNKDESPRVDGKTTSV-----DESLEEARRIMDKYK  569
            L T+G+ YFA++A NKDE P  +G TT+      D+ +EEA++IM+KYK
Sbjct  132  LGTIGLAYFAYLAFNKDEGPSGNGGTTTTTSPLDDDPVEEAKKIMEKYK  180



>ref|XP_008236525.1| PREDICTED: uncharacterized protein LOC103335292 [Prunus mume]
Length=183

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 93/115 (81%), Gaps = 6/115 (5%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            ++A Q NFLKV++TVW+VG+DGI+AGTNLVPDS+PR +AR+S+TVVA+  +LFLLKS LS
Sbjct  69   VFAAQPNFLKVVRTVWKVGRDGIEAGTNLVPDSVPRSIARVSLTVVALALSLFLLKSLLS  128

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDGKTTS------VDESLEEARRIMDKYK  569
            T FF LATMG++ F FIA NKDE P+  G TTS      +++S EEARRIM+KYK
Sbjct  129  TVFFVLATMGLVNFTFIAFNKDEGPKGGGGTTSTPKEEGMEDSPEEARRIMEKYK  183



>gb|EEE51982.1| hypothetical protein OsJ_33660 [Oryza sativa Japonica Group]
Length=112

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +3

Query  273  VIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMG  452
            V+QT W+VG+D ++AGT LVP S+PRP+ARI VT VA++ ALFLLKS +STAFF LA MG
Sbjct  14   VVQTAWKVGRDAVEAGTTLVPGSVPRPVARIGVTFVALSIALFLLKSVVSTAFFVLAMMG  73

Query  453  VIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            +IY  F+A+N  E  RVD    S ++ +EEARRIM+KYK
Sbjct  74   LIYLGFLAMNPKEGSRVDEGANSSEDPVEEARRIMEKYK  112



>ref|XP_004959593.1| PREDICTED: uncharacterized protein LOC101753469 [Setaria italica]
Length=195

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + Q +F + +QT WRVG D ++AG+N VP S+PRP+ARI VT  AV+ ALFLLKS +S
Sbjct  84   VASAQFDFARAVQTAWRVGTDAVEAGSNFVPGSVPRPIARIGVTFAAVSVALFLLKSVVS  143

Query  423  TAFFALATMGVIYFAFIALNKDES--PRVD--GKTTSVDESLEEARRIMDKYK  569
            TA F LA MG+IY  F+A+N  E+   R+D  G   S D  +EEARRIM+KYK
Sbjct  144  TALFVLAMMGLIYLGFLAMNPKEASGSRMDETGGNPSEDP-VEEARRIMEKYK  195



>tpg|DAA62158.1| TPA: hypothetical protein ZEAMMB73_942245 [Zea mays]
Length=164

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +3

Query  240  FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
            F+   Q +F + +QT WRVG D ++AG+NLVP S+PRP+ARI V   AV+ A FL+KS +
Sbjct  52   FVAYAQLDFSRAVQTAWRVGNDAVEAGSNLVPGSVPRPIARIGVAFAAVSVAFFLVKSIV  111

Query  420  STAFFALATMGVIYFAFIALNKDES--PRVDGKTTSVDES-LEEARRIMDKYK  569
            STA F LA MG+IY +F+A+N  E+   R+D    +  E  +EEARRIMDKYK
Sbjct  112  STALFVLAMMGLIYLSFLAMNPKEASGSRLDEAMGNPSEDPVEEARRIMDKYK  164



>ref|XP_002462636.1| hypothetical protein SORBIDRAFT_02g029370 [Sorghum bicolor]
 gb|EER99157.1| hypothetical protein SORBIDRAFT_02g029370 [Sorghum bicolor]
Length=166

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 4/117 (3%)
 Frame = +3

Query  231  QPSFIYA-VQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLL  407
            +P  + A  Q +F + +QT WRVG D ++AG+NLVP S+PRP+ARI VT  A+  ALFL+
Sbjct  50   KPRLVAASAQFDFSRAVQTAWRVGNDAVEAGSNLVPGSVPRPIARIGVTFAAMAVALFLV  109

Query  408  KSFLSTAFFALATMGVIYFAFIALNKDE--SPRVDGKTTSVDES-LEEARRIMDKYK  569
            KS +STA F LA MG+IY  F+A+N  E  S R+D       E  +EEARRIM+KYK
Sbjct  110  KSVVSTALFVLAMMGLIYLGFLAMNPKEASSSRLDEAMGDPSEDPVEEARRIMEKYK  166



>ref|NP_001144333.1| uncharacterized protein LOC100277230 [Zea mays]
 gb|ACG39600.1| hypothetical protein [Zea mays]
Length=164

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +3

Query  240  FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
            F+ + Q +F + +QT WRVG D ++AG+NLVP S+PRP+ARI V   AV+ A FL+KS +
Sbjct  52   FVASAQLDFSRAVQTAWRVGNDAVEAGSNLVPGSVPRPIARIGVAFAAVSVAFFLVKSIV  111

Query  420  STAFFALATMGVIYFAFIALNKDES--PRVDGKTTSVDES-LEEARRIMDKYK  569
            ST  F LA MG+IY +F+A+N  E+   R+D    +  E  +EEARRIM+KYK
Sbjct  112  STTLFVLAMMGLIYLSFLAMNPKEASGSRLDEAMGNPSEDPVEEARRIMEKYK  164



>ref|XP_006664487.1| PREDICTED: uncharacterized protein LOC102706620 [Oryza brachyantha]
Length=235

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + QSNF +V+QT  +VG+D ++AGT LVP S+PRP+ARI VT +A++FALFLLKS +S
Sbjct  127  VVSAQSNFSRVVQTALKVGRDAVEAGTTLVPASVPRPVARIGVTFLALSFALFLLKSVVS  186

Query  423  TAFFALATMGVIYFAFIALNKDESPRVDGKTTSVDESLEEARRIMDKYK  569
            TAFF LA MG+IY  F+A+N  E  RVD    S ++ +EEARRIM+KYK
Sbjct  187  TAFFVLAMMGLIYLGFLAMNPKEGSRVDEGANSSEDPVEEARRIMEKYK  235



>tpg|DAA40493.1| TPA: hypothetical protein ZEAMMB73_975194, partial [Zea mays]
Length=176

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +3

Query  243  IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLS  422
            + + Q +F + +QTVWRVG D ++AG+NLVP S+PRP+ARI V V AV+ ALFLLKS +S
Sbjct  65   VASAQFDFSRAVQTVWRVGNDAVEAGSNLVPGSVPRPIARIGVAVAAVSVALFLLKSIVS  124

Query  423  TAFFALATMGVIYFAFIALNKDES--PRVDGKTTSVDES-LEEARRIMDKYK  569
            TA F LA MG+IY  F+A+N  E+   R+D  T    E  +EEARRIM+KYK
Sbjct  125  TALFVLAMMGLIYLGFLAMNPKEASDSRLDEATGDPSEDQIEEARRIMEKYK  176



>ref|XP_007199009.1| hypothetical protein PRUPE_ppa017514mg, partial [Prunus persica]
 gb|EMJ00208.1| hypothetical protein PRUPE_ppa017514mg, partial [Prunus persica]
Length=103

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (76%), Gaps = 12/98 (12%)
 Frame = +3

Query  294  VGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFI  473
            VG+DGI+AGTNLVPDS+PR +AR+S+TVVA+  +LF+ KS L       AT+G++YF FI
Sbjct  1    VGRDGIEAGTNLVPDSVPRSIARVSLTVVALALSLFVPKSLLG------ATIGLVYFTFI  54

Query  474  ALNKDESPRVDGKTTS------VDESLEEARRIMDKYK  569
            ALNKDE P+  G TTS      ++++ EEARRIM+KYK
Sbjct  55   ALNKDEGPKGGGVTTSTPKEEGMEDTPEEARRIMEKYK  92



>ref|XP_010245677.1| PREDICTED: uncharacterized protein LOC104589156 isoform X2 [Nelumbo 
nucifera]
Length=146

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 13/137 (9%)
 Frame = +3

Query  72   CSTSPSCLHP--------KSHQRNRAL-----PSQFlssnsllklkkQTAFSTVRFRKLN  212
            CS++ +CLH         +S +R  +      PS+F+S  S    K +  F     + L 
Sbjct  3    CSSASTCLHSLSLHSSPFRSTKRRTSASFLLGPSRFVSPKSPTLRKSRRDFVLPNNKNLR  62

Query  213  SRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTF  392
              R  + P  + A QS+FL+VIQTVW+VGKDGI+AGTNLVPDSIPRP+ARI V VVA++ 
Sbjct  63   RYRPNSVPLVVVAAQSDFLRVIQTVWKVGKDGIEAGTNLVPDSIPRPIARIGVAVVALSV  122

Query  393  ALFLLKSFLSTAFFALA  443
            + F+LKS LSTAFF LA
Sbjct  123  SFFVLKSVLSTAFFVLA  139



>ref|XP_010245678.1| PREDICTED: uncharacterized protein LOC104589156 isoform X3 [Nelumbo 
nucifera]
Length=145

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (63%), Gaps = 17/144 (12%)
 Frame = +3

Query  72   CSTSPSCLHP--------KSHQRNRAL-----PSQFlssnsllklkkQTAFSTVRFRKLN  212
            CS++ +CLH         +S +R  +      PS+F+S  S    K +  F     + L 
Sbjct  3    CSSASTCLHSLSLHSSPFRSTKRRTSASFLLGPSRFVSPKSPTLRKSRRDFVLPNNKNLR  62

Query  213  SRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTF  392
              R  + P  + A QS+FL+VIQTVW+VGKDGI+AGTNLVPDSIPRP+ARI V VVA++ 
Sbjct  63   RYRPNSVPLVVVAAQSDFLRVIQTVWKVGKDGIEAGTNLVPDSIPRPIARIGVAVVALSV  122

Query  393  ALFLLKSFLSTAFFALATMGVIYF  464
            + F+LKS LSTAFF L    VI+F
Sbjct  123  SFFVLKSVLSTAFFVL----VIWF  142



>gb|KJB10975.1| hypothetical protein B456_001G234600 [Gossypium raimondii]
Length=139

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 9/121 (7%)
 Frame = +3

Query  81   SPSCLHPKSHQRNRALP-SQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAVQ  257
            SP C H   + +  ALP S FLS  S L+LK++T FS ++F K  + R       +YA+Q
Sbjct  17   SPKCYH---NNQTLALPHSNFLSPTSFLRLKRKTLFSNIQFNKPLAPR-----PLVYALQ  68

Query  258  SNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFA  437
            SNF KVIQTVW+VGKDG++AGTNLVPDS+PRP+ARISV+VV +   LF+LKSFLSTAFFA
Sbjct  69   SNFFKVIQTVWKVGKDGVEAGTNLVPDSVPRPIARISVSVVVLFVTLFVLKSFLSTAFFA  128

Query  438  L  440
            L
Sbjct  129  L  129



>ref|XP_006386895.1| hypothetical protein POPTR_0002s25310g [Populus trichocarpa]
 gb|ERP64692.1| hypothetical protein POPTR_0002s25310g [Populus trichocarpa]
Length=131

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +3

Query  225  QAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFL  404
            ++ P  ++A QSNFLKV+QTVW+VGKDGI+ GTNLVP+S+PRP+AR++VT V +  +LFL
Sbjct  59   RSAPVVVFAAQSNFLKVVQTVWKVGKDGIETGTNLVPNSVPRPIARVAVTFVVLAVSLFL  118

Query  405  LKSFLSTAFFAL  440
            LKSFLST FFAL
Sbjct  119  LKSFLSTVFFAL  130



>ref|XP_007200193.1| hypothetical protein PRUPE_ppa016150mg, partial [Prunus persica]
 gb|EMJ01392.1| hypothetical protein PRUPE_ppa016150mg, partial [Prunus persica]
Length=144

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 80/144 (56%), Gaps = 52/144 (36%)
 Frame = +3

Query  294  VGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLK---------------------  410
            VG+DGI+AGTNLVPDS+PR +AR+SVTVVA + +LF+LK                     
Sbjct  1    VGRDGIEAGTNLVPDSVPRSIARVSVTVVAFSPSLFVLKFSLCCRSMMLFDLLFPKCISS  60

Query  411  ----SFLSTAF---------------------FALATMGVIYFAFIALNKDESPRVDGKT  515
                SF+   F                     F LATMG++YF FIALNKDE P+  G T
Sbjct  61   MLVLSFVCLCFKINFFFCVTSFYKEMRCNEGKFPLATMGLVYFTFIALNKDEGPKGGGGT  120

Query  516  TS------VDESLEEARRIMDKYK  569
            TS      +++SLEEARRIM+KYK
Sbjct  121  TSTPKEEGMEDSLEEARRIMEKYK  144



>gb|KGN58332.1| hypothetical protein Csa_3G624000 [Cucumis sativus]
Length=136

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  204  KLNSRRFQAQPSF--IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTV  377
            ++   R +  PSF  +YA Q+NFL+V QTVW++GKDGI+AGT+LVPDS+PRP+ARISV +
Sbjct  50   QIEKLRTRGSPSFPLVYAAQNNFLRVFQTVWKIGKDGIEAGTDLVPDSVPRPIARISVGI  109

Query  378  VAVTFALFLLKSFLSTAFFAL  440
            VA+T  LFL KS LSTA F L
Sbjct  110  VALTIGLFLFKSVLSTALFVL  130



>gb|EMS54023.1| hypothetical protein TRIUR3_31680 [Triticum urartu]
Length=189

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  336  DSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKDESPRV--DG  509
            DS+PRP+ARI VT VAV+ ALFLLKS +STA F LA MG+IYFAF+A+N  E  R   +G
Sbjct  110  DSVPRPIARIGVTFVAVSVALFLLKSVISTALFVLAMMGLIYFAFLAMNPKEGSRSMDEG  169

Query  510  KTTSVDESLEEARRIMDKYK  569
             + S D+  EEARRIM+KYK
Sbjct  170  DSPSSDDPAEEARRIMEKYK  189



>gb|ERM98039.1| hypothetical protein AMTR_s00120p00080910 [Amborella trichopoda]
Length=73

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  273  VIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALAT  446
            VIQT WRVGKDG++AGTNLVPDS+PRP+ARI V V+ +T +L++LKS LSTAFF L T
Sbjct  7    VIQTAWRVGKDGLEAGTNLVPDSVPRPIARIGVAVLTLTLSLYVLKSLLSTAFFVLLT  64



>ref|XP_010480620.1| PREDICTED: uncharacterized protein LOC104759382 [Camelina sativa]
Length=174

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVT  374
            R   L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S+PR +ARISVT
Sbjct  52   RIAPLQPQRVRSK-THVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVSVPRSVARISVT  110

Query  375  VVAVTFALFLLKSFLSTAFFAL  440
            + A+  +LF++KSFLSTAFF L
Sbjct  111  IAALAVSLFVVKSFLSTAFFVL  132



>ref|XP_011651636.1| PREDICTED: uncharacterized protein LOC101207451 isoform X2 [Cucumis 
sativus]
Length=142

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 66/128 (52%), Gaps = 41/128 (32%)
 Frame = +3

Query  204  KLNSRRFQAQPSF--IYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTV  377
            ++   R +  PSF  +YA Q+NFL+V QTVW++GKDGI+AGT+LVP              
Sbjct  50   QIEKLRTRGSPSFPLVYAAQNNFLRVFQTVWKIGKDGIEAGTDLVP--------------  95

Query  378  VAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKD----ESPRVDGKTTSVDESLEEA  545
                                 A MG IYF FIALNKD             TS +E+LEEA
Sbjct  96   ---------------------AMMGAIYFIFIALNKDEGPRGGGGSSSSPTSTEETLEEA  134

Query  546  RRIMDKYK  569
            RRIM+KYK
Sbjct  135  RRIMEKYK  142



>ref|XP_008651235.1| PREDICTED: uncharacterized protein LOC100277230 isoform X1 [Zea 
mays]
Length=146

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  240  FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
            F+   Q +F + +QT WRVG D ++AG+NLVP S+PRP+ARI V   AV+ A FL+KS +
Sbjct  52   FVAYAQLDFSRAVQTAWRVGNDAVEAGSNLVPGSVPRPIARIGVAFAAVSVAFFLVKSIV  111

Query  420  STAFFALAT  446
            STA F L +
Sbjct  112  STALFVLVS  120



>gb|ACN27076.1| unknown [Zea mays]
 tpg|DAA62159.1| TPA: hypothetical protein ZEAMMB73_942245 [Zea mays]
Length=144

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +3

Query  240  FIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFL  419
            F+   Q +F + +QT WRVG D ++AG+NLVP S+PRP+ARI V   AV+ A FL+KS +
Sbjct  52   FVAYAQLDFSRAVQTAWRVGNDAVEAGSNLVPGSVPRPIARIGVAFAAVSVAFFLVKSIV  111

Query  420  STAFFALAT  446
            STA F L +
Sbjct  112  STALFVLVS  120



>ref|XP_001777100.1| predicted protein [Physcomitrella patens]
 gb|EDQ58093.1| predicted protein [Physcomitrella patens]
Length=231

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 71/146 (49%), Gaps = 38/146 (26%)
 Frame = +3

Query  228  AQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLL  407
            A+  F  A  + FL  ++T    GK+ +DAGTNLVP+SIPR +ARI V +V  +   + L
Sbjct  92   AEEKFDVAKAAGFL--VKT----GKNALDAGTNLVPESIPRGVARIIVGLVGASVVTYAL  145

Query  408  KSFLSTAFFAL----------------------------ATMGVIYFAFIALNK----DE  491
            ++  STA F L                            A  G  Y A++ LNK      
Sbjct  146  RALFSTALFILVRSGSLRKAIYDDCLSLRNWKRELIVSQAIAGFSYLAYMYLNKDSDSGS  205

Query  492  SPRVDGKTTSVDESLEEARRIMDKYK  569
                 GK  + D+SLEEARRIM+KYK
Sbjct  206  GGGGGGKPRNTDDSLEEARRIMEKYK  231



>gb|KJB10974.1| hypothetical protein B456_001G234600 [Gossypium raimondii]
Length=142

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 9/86 (10%)
 Frame = +3

Query  81   SPSCLHPKSHQRNRALP-SQFlssnsllklkkQTAFSTVRFRKLNSRRFQAQPSFIYAVQ  257
            SP C H   + +  ALP S FLS  S L+LK++T FS ++F K  + R       +YA+Q
Sbjct  17   SPKCYH---NNQTLALPHSNFLSPTSFLRLKRKTLFSNIQFNKPLAPR-----PLVYALQ  68

Query  258  SNFLKVIQTVWRVGKDGIDAGTNLVP  335
            SNF KVIQTVW+VGKDG++AGTNLVP
Sbjct  69   SNFFKVIQTVWKVGKDGVEAGTNLVP  94



>ref|XP_001782808.1| predicted protein [Physcomitrella patens]
 gb|EDQ52385.1| predicted protein [Physcomitrella patens]
Length=283

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = +3

Query  291  RVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAF  470
              GK   DA TNL+P+S+PR +ARI+V VV V+  +  L++F STA F +   G  Y A 
Sbjct  107  EAGKTAWDASTNLIPESVPRGVARITVGVVGVSLIIHALRAFFSTALFIMGIAGFSYLAP  166

Query  471  IALNKDESPRVDGKTTSVDESLEEARRIMD  560
            I LNK+      G    V     E R  +D
Sbjct  167  IHLNKNSD---SGSAGGVKPPNTEKREKVD  193



>ref|XP_008382656.1| PREDICTED: uncharacterized protein LOC103445426 isoform X2 [Malus 
domestica]
Length=115

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSI  344
            QT  S +R ++  ++  ++    ++A QSNF KV+QT W+VG+DG++AGTNLVP S+
Sbjct  45   QTLLSAIRIKRQRTQNHRSVVPVVFASQSNFFKVLQTAWKVGRDGVEAGTNLVPLSL  101



>ref|XP_009349846.1| PREDICTED: uncharacterized protein LOC103941378 isoform X2 [Pyrus 
x bretschneideri]
Length=115

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  174  QTAFSTVRFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDSI  344
            QT  S +R ++  S+  ++    ++A QSNF KV+QT W+VG+DG++AGTNLVP S+
Sbjct  45   QTLPSAIRIKRRRSQNHRSVVPVVFASQSNFFKVLQTAWKVGRDGVEAGTNLVPLSL  101



>ref|XP_002950405.1| hypothetical protein VOLCADRAFT_104657 [Volvox carteri f. nagariensis]
 gb|EFJ48606.1| hypothetical protein VOLCADRAFT_104657 [Volvox carteri f. nagariensis]
Length=153

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 9/96 (9%)
 Frame = +3

Query  309  IDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMGVIYFAFIALNKD  488
            +D  T+LVP+++PRP AR  V + +V F  +LL+  +S         GV Y+       D
Sbjct  58   VDKATDLVPETVPRPAARAGVAIASVMFIFWLLQKVISGVLTLALFAGVGYYFLTQQMAD  117

Query  489  ESPRVD--------GKT-TSVDESLEEARRIMDKYK  569
            +   +D        G++   +D+ L EARRIMDKYK
Sbjct  118  KDDTIDVTPPSKKGGRSGEDLDDPLAEARRIMDKYK  153



>dbj|BAH57253.1| AT4G13220 [Arabidopsis thaliana]
Length=97

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  195  RFRKLNSRRFQAQPSFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVPDS  341
            R   L  +R +++ + + + QS+FLKV++T W +GKDGI+AGTNLVP S
Sbjct  48   RIAPLQPQRLRSK-TLVLSAQSSFLKVLRTAWNIGKDGIEAGTNLVPVS  95



>ref|XP_001691952.1| SNF2 superfamily protein [Chlamydomonas reinhardtii]
 gb|EDP04442.1| SNF2 superfamily protein [Chlamydomonas reinhardtii]
Length=1254

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 17/116 (15%)
 Frame = +3

Query  273  VIQTVWRVGKDGIDAGTNLVPDSIPRPLARISVTVVAVTFALFLLKSFLSTAFFALATMG  452
            ++  V++     +D   +LVPDS+PR  A+  VTV  V F  ++L   +S         G
Sbjct  153  MVSGVFKTASGLVDKAADLVPDSVPRSTAKAGVTVAGVMFTFWVLNKVISGVVTLAVLAG  212

Query  453  VIYFAFIALNKDESPRVD-----------------GKTTSVDESLEEARRIMDKYK  569
            + Y+      KD+   +D                 GK + +D+ L EAR+IMDKYK
Sbjct  213  IGYYFLTQQGKDDDDAIDVTPKAGGGKAGGGKAGGGKGSDLDDPLAEARKIMDKYK  268



>ref|XP_010527292.1| PREDICTED: uncharacterized protein LOC104804650 [Tarenaya hassleriana]
Length=114

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  237  SFIYAVQSNFLKVIQTVWRVGKDGIDAGTNLVP  335
            + + AVQSNFLKV++T W +G+DG++AGT L+P
Sbjct  76   TVVLAVQSNFLKVLRTAWNIGRDGVEAGTKLIP  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497111138900