BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8670

Length=870
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358767.1|  PREDICTED: cytochrome P450 83B1-like               334   5e-110   
ref|XP_004247903.2|  PREDICTED: cytochrome P450 83B1-like               339   6e-110   Solanum lycopersicum
ref|XP_006358766.1|  PREDICTED: cytochrome P450 83B1-like               338   2e-109   Solanum tuberosum [potatoes]
ref|XP_009601421.1|  PREDICTED: cytochrome P450 83B1-like               338   3e-109   Nicotiana tomentosiformis
ref|XP_009769778.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    327   2e-108   Nicotiana sylvestris
gb|AIC74456.1|  Cytochrome P450 CYPI                                    335   4e-108   Withania somnifera [ashwagandha]
ref|XP_009769777.1|  PREDICTED: cytochrome P450 83B1-like isoform X1    335   5e-108   Nicotiana sylvestris
ref|XP_009618532.1|  PREDICTED: cytochrome P450 83B1-like               333   1e-107   Nicotiana tomentosiformis
ref|XP_006358765.1|  PREDICTED: cytochrome P450 83B1-like               333   3e-107   Solanum tuberosum [potatoes]
ref|XP_004247905.1|  PREDICTED: cytochrome P450 83B1-like               331   9e-107   Solanum lycopersicum
ref|XP_006358769.1|  PREDICTED: cytochrome P450 83B1-like               331   1e-106   
ref|XP_009591953.1|  PREDICTED: cytochrome P450 83B1-like               323   2e-106   Nicotiana tomentosiformis
ref|XP_002280472.1|  PREDICTED: cytochrome P450 71A1                    330   3e-106   Vitis vinifera
ref|XP_009802554.1|  PREDICTED: cytochrome P450 83B1-like               329   5e-106   Nicotiana sylvestris
ref|XP_009622691.1|  PREDICTED: cytochrome P450 83B1-like               328   1e-105   Nicotiana tomentosiformis
ref|XP_002278372.1|  PREDICTED: cytochrome P450 71A1-like               328   2e-105   Vitis vinifera
ref|XP_006367342.1|  PREDICTED: cytochrome P450 83B1-like               328   2e-105   Solanum tuberosum [potatoes]
ref|XP_004228400.1|  PREDICTED: cytochrome P450 71A1-like               327   3e-105   Solanum lycopersicum
emb|CDP16101.1|  unnamed protein product                                327   4e-105   Coffea canephora [robusta coffee]
emb|CDP16106.1|  unnamed protein product                                325   8e-105   Coffea canephora [robusta coffee]
ref|XP_004247901.1|  PREDICTED: cytochrome P450 83B1-like               325   4e-104   Solanum lycopersicum
ref|XP_002278300.1|  PREDICTED: cytochrome P450 71A1                    324   5e-104   Vitis vinifera
gb|ABC69410.1|  CYP71AT2v3                                              324   5e-104   Nicotiana tabacum [American tobacco]
ref|XP_009591952.1|  PREDICTED: cytochrome P450 83B1-like               324   6e-104   Nicotiana tomentosiformis
ref|XP_004247907.1|  PREDICTED: cytochrome P450 83B1-like               324   6e-104   Solanum lycopersicum
gb|ABC69409.1|  CYP71AT2v2                                              324   6e-104   Nicotiana tabacum [American tobacco]
gb|ABC69408.1|  CYP71AT2v1                                              323   1e-103   Nicotiana tabacum [American tobacco]
ref|XP_006358810.1|  PREDICTED: cytochrome P450 83B1-like               323   1e-103   
ref|XP_006358770.1|  PREDICTED: cytochrome P450 83B1-like               323   2e-103   Solanum tuberosum [potatoes]
gb|EYU38763.1|  hypothetical protein MIMGU_mgv1a004763mg                323   2e-103   Erythranthe guttata [common monkey flower]
gb|KDO35932.1|  hypothetical protein CISIN_1g048189mg                   313   4e-103   Citrus sinensis [apfelsine]
ref|XP_002280438.1|  PREDICTED: cytochrome P450 71A1                    322   4e-103   Vitis vinifera
ref|XP_006358771.1|  PREDICTED: cytochrome P450 83B1-like isoform X1    322   5e-103   Solanum tuberosum [potatoes]
ref|XP_002278387.1|  PREDICTED: cytochrome P450 71A1                    322   5e-103   Vitis vinifera
ref|XP_006358768.1|  PREDICTED: cytochrome P450 83B1-like               321   7e-103   Solanum tuberosum [potatoes]
ref|XP_006367992.1|  PREDICTED: cytochrome P450 83B1-like               320   1e-102   
emb|CBI19823.3|  unnamed protein product                                331   2e-102   Vitis vinifera
ref|XP_004247900.1|  PREDICTED: cytochrome P450 83B1-like               320   2e-102   Solanum lycopersicum
ref|XP_004247904.1|  PREDICTED: cytochrome P450 83B1-like               320   2e-102   Solanum lycopersicum
ref|XP_006358824.1|  PREDICTED: cytochrome P450 83B1-like               320   3e-102   Solanum tuberosum [potatoes]
ref|XP_004247902.2|  PREDICTED: cytochrome P450 71A1-like               318   9e-102   Solanum lycopersicum
emb|CDP16099.1|  unnamed protein product                                318   2e-101   Coffea canephora [robusta coffee]
gb|KHN19810.1|  Cytochrome P450 83B1                                    315   2e-101   Glycine soja [wild soybean]
ref|XP_006358825.1|  PREDICTED: cytochrome P450 83B1-like               318   3e-101   
gb|AJD25156.1|  cytochrome P450 CYP71AT92                               317   3e-101   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004249946.1|  PREDICTED: cytochrome P450 83B1-like               317   5e-101   Solanum lycopersicum
ref|XP_003551894.1|  PREDICTED: cytochrome P450 83B1-like               315   2e-100   Glycine max [soybeans]
emb|CDP16103.1|  unnamed protein product                                315   3e-100   Coffea canephora [robusta coffee]
ref|XP_006365688.1|  PREDICTED: cytochrome P450 83B1-like               314   4e-100   
ref|XP_011091358.1|  PREDICTED: cytochrome P450 71A1-like               314   4e-100   Sesamum indicum [beniseed]
ref|XP_011091673.1|  PREDICTED: cytochrome P450 71A1-like               313   7e-100   
ref|XP_006443324.1|  hypothetical protein CICLE_v10023683mg             312   9e-100   
ref|XP_006445533.1|  hypothetical protein CICLE_v10004104mg             312   2e-99    Citrus clementina [clementine]
ref|XP_010671012.1|  PREDICTED: cytochrome P450 83B1-like               312   3e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006445535.1|  hypothetical protein CICLE_v10004103mg             312   3e-99    Citrus clementina [clementine]
ref|XP_006358823.1|  PREDICTED: cytochrome P450 83B1-like               312   3e-99    Solanum tuberosum [potatoes]
gb|KHN02071.1|  Cytochrome P450 83B1                                    311   4e-99    Glycine soja [wild soybean]
ref|XP_003516815.1|  PREDICTED: cytochrome P450 83B1-like               311   5e-99    Glycine max [soybeans]
gb|AES59645.2|  cytochrome P450 family 71 protein                       312   5e-99    Medicago truncatula
emb|CDP16102.1|  unnamed protein product                                311   9e-99    Coffea canephora [robusta coffee]
ref|XP_006479041.1|  PREDICTED: cytochrome P450 83B1-like               310   2e-98    
ref|XP_007146429.1|  hypothetical protein PHAVU_006G039800g             310   2e-98    Phaseolus vulgaris [French bean]
ref|XP_007017736.1|  Cytochrome P450                                    309   3e-98    
ref|XP_011091688.1|  PREDICTED: cytochrome P450 71A1-like               310   3e-98    Sesamum indicum [beniseed]
ref|XP_002280459.1|  PREDICTED: cytochrome P450 71A1                    309   4e-98    Vitis vinifera
ref|XP_007010977.1|  Cytochrome P450                                    309   5e-98    
ref|XP_010674264.1|  PREDICTED: cytochrome P450 71A1-like               303   5e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU34271.1|  hypothetical protein MIMGU_mgv1a020847mg                307   5e-98    Erythranthe guttata [common monkey flower]
ref|XP_003589394.1|  Cytochrome P450                                    311   7e-98    
emb|CDP18845.1|  unnamed protein product                                308   1e-97    Coffea canephora [robusta coffee]
gb|KDO39631.1|  hypothetical protein CISIN_1g035827mg                   307   2e-97    Citrus sinensis [apfelsine]
ref|XP_006427939.1|  hypothetical protein CICLE_v10027382mg             307   2e-97    Citrus clementina [clementine]
emb|CDP21727.1|  unnamed protein product                                307   5e-97    Coffea canephora [robusta coffee]
ref|XP_004490658.1|  PREDICTED: cytochrome P450 83B1-like               306   5e-97    Cicer arietinum [garbanzo]
gb|EYU29507.1|  hypothetical protein MIMGU_mgv1a005223mg                305   8e-97    Erythranthe guttata [common monkey flower]
gb|EYU38764.1|  hypothetical protein MIMGU_mgv1a004668mg                306   1e-96    Erythranthe guttata [common monkey flower]
ref|XP_002307703.2|  hypothetical protein POPTR_0005s25740g             303   4e-96    
ref|XP_011045132.1|  PREDICTED: cytochrome P450 83B1-like               303   8e-96    Populus euphratica
gb|AIC74457.1|  Cytochrome P450 CYPII                                   303   1e-95    Withania somnifera [ashwagandha]
ref|XP_011087181.1|  PREDICTED: cytochrome P450 71A9-like               302   2e-95    Sesamum indicum [beniseed]
gb|KDO39891.1|  hypothetical protein CISIN_1g013651mg                   300   3e-95    Citrus sinensis [apfelsine]
ref|XP_004506482.1|  PREDICTED: cytochrome P450 83B1-like               301   5e-95    Cicer arietinum [garbanzo]
ref|XP_006479002.1|  PREDICTED: cytochrome P450 71A1-like               301   5e-95    Citrus sinensis [apfelsine]
ref|XP_002535120.1|  cytochrome P450, putative                          292   1e-94    
ref|XP_011077693.1|  PREDICTED: cytochrome P450 83B1-like               300   1e-94    Sesamum indicum [beniseed]
gb|KJB73274.1|  hypothetical protein B456_011G225200                    300   2e-94    Gossypium raimondii
gb|KDO39228.1|  hypothetical protein CISIN_1g038171mg                   299   3e-94    Citrus sinensis [apfelsine]
ref|XP_011077701.1|  PREDICTED: cytochrome P450 71A1-like               299   3e-94    Sesamum indicum [beniseed]
ref|XP_006443223.1|  hypothetical protein CICLE_v10023326mg             299   4e-94    
gb|EPS69225.1|  hypothetical protein M569_05542                         298   4e-94    Genlisea aurea
ref|XP_010670999.1|  PREDICTED: cytochrome P450 83B1-like               298   5e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011091687.1|  PREDICTED: cytochrome P450 71A1-like               298   5e-94    
ref|XP_006443326.1|  hypothetical protein CICLE_v10023966mg             298   8e-94    
gb|KDP36955.1|  hypothetical protein JCGZ_08246                         295   1e-93    Jatropha curcas
ref|XP_007017732.1|  Cytochrome P450, putative                          299   1e-93    
ref|XP_010670930.1|  PREDICTED: cytochrome P450 71A1-like               298   1e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012073846.1|  PREDICTED: cytochrome P450 83B1-like               297   1e-93    Jatropha curcas
gb|KDO47250.1|  hypothetical protein CISIN_1g010479mg                   297   2e-93    Citrus sinensis [apfelsine]
ref|XP_004490657.1|  PREDICTED: cytochrome P450 83B1-like               297   2e-93    Cicer arietinum [garbanzo]
gb|EYU31746.1|  hypothetical protein MIMGU_mgv1a022569mg                296   3e-93    Erythranthe guttata [common monkey flower]
gb|KJB17922.1|  hypothetical protein B456_003G024500                    296   3e-93    Gossypium raimondii
ref|XP_006443222.1|  hypothetical protein CICLE_v10019775mg             296   5e-93    Citrus clementina [clementine]
gb|KEH29148.1|  cytochrome P450 family 71 protein                       296   6e-93    Medicago truncatula
gb|KJB17921.1|  hypothetical protein B456_003G024400                    292   1e-92    Gossypium raimondii
ref|XP_012073889.1|  PREDICTED: cytochrome P450 83B1-like               295   1e-92    Jatropha curcas
ref|XP_010670941.1|  PREDICTED: cytochrome P450 83B1-like               291   1e-92    
ref|XP_006435134.1|  hypothetical protein CICLE_v10000924mg             295   2e-92    Citrus clementina [clementine]
ref|XP_010670987.1|  PREDICTED: cytochrome P450 83B1-like               294   2e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003615846.1|  Cytochrome P450 71B35                              294   3e-92    
gb|KJB73271.1|  hypothetical protein B456_011G224900                    294   4e-92    Gossypium raimondii
gb|AES98804.2|  cytochrome P450 family 71 protein                       294   4e-92    Medicago truncatula
gb|KHN35607.1|  Cytochrome P450 83B1                                    293   4e-92    Glycine soja [wild soybean]
gb|KEH29139.1|  cytochrome P450 family 71 protein                       288   1e-91    Medicago truncatula
ref|XP_006577403.1|  PREDICTED: cytochrome P450 71A1-like               286   2e-91    
gb|ACJ86287.1|  unknown                                                 285   2e-91    Medicago truncatula
ref|XP_003522006.2|  PREDICTED: cytochrome P450 83B1-like isoform X1    291   2e-91    
ref|XP_007134003.1|  hypothetical protein PHAVU_010G010900g             291   3e-91    Phaseolus vulgaris [French bean]
ref|XP_002301993.2|  Cytochrome P450 83A1 family protein                291   3e-91    
ref|XP_006473617.1|  PREDICTED: cytochrome P450 71B35-like isofor...    289   3e-91    
ref|XP_006445534.1|  hypothetical protein CICLE_v10004105mg             291   4e-91    Citrus clementina [clementine]
ref|XP_006479316.1|  PREDICTED: cytochrome P450 83B1-like               291   4e-91    
ref|XP_002510498.1|  cytochrome P450, putative                          291   5e-91    Ricinus communis
gb|KDO38362.1|  hypothetical protein CISIN_1g009872mg                   291   6e-91    Citrus sinensis [apfelsine]
ref|XP_006443319.1|  hypothetical protein CICLE_v10019709mg             291   6e-91    
gb|KJB73931.1|  hypothetical protein B456_011G262400                    290   7e-91    Gossypium raimondii
ref|XP_006473616.1|  PREDICTED: cytochrome P450 71B35-like isofor...    290   9e-91    Citrus sinensis [apfelsine]
ref|XP_004491826.1|  PREDICTED: cytochrome P450 71A1-like               290   1e-90    Cicer arietinum [garbanzo]
ref|XP_007010975.1|  Cytochrome P450, putative                          289   2e-90    
ref|XP_002510500.1|  cytochrome P450, putative                          289   3e-90    Ricinus communis
ref|XP_007017731.1|  Cytochrome P450                                    289   3e-90    
gb|AJD25155.1|  cytochrome P450 CYP71AT91                               289   3e-90    Salvia miltiorrhiza [Chinese salvia]
ref|XP_003521971.1|  PREDICTED: cytochrome P450 71A1-like               289   3e-90    Glycine max [soybeans]
gb|KEH29140.1|  cytochrome P450 family 71 protein                       288   7e-90    Medicago truncatula
ref|XP_006386182.1|  hypothetical protein POPTR_0002s02700g             286   1e-89    
gb|KJB73272.1|  hypothetical protein B456_011G225000                    287   2e-89    Gossypium raimondii
ref|XP_003615837.1|  Cytochrome P450 71B37                              287   2e-89    
gb|KHN09046.1|  Cytochrome P450 83B1                                    286   2e-89    Glycine soja [wild soybean]
ref|XP_003538072.1|  PREDICTED: cytochrome P450 83B1                    286   2e-89    Glycine max [soybeans]
gb|ABC59084.1|  cytochrome P450 monooxygenase CYP83G1                   287   2e-89    Medicago truncatula
ref|XP_006386181.1|  hypothetical protein POPTR_0002s02690g             286   2e-89    
ref|XP_011028970.1|  PREDICTED: cytochrome P450 83B1-like               286   3e-89    Populus euphratica
ref|XP_010670964.1|  PREDICTED: cytochrome P450 71B9-like               286   3e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670952.1|  PREDICTED: cytochrome P450 83B1-like               286   3e-89    Beta vulgaris subsp. vulgaris [field beet]
gb|ABD97102.1|  cytochrome P450 monooxygenase CYP83G2                   286   4e-89    Medicago truncatula
ref|XP_007134823.1|  hypothetical protein PHAVU_010G079100g             285   7e-89    Phaseolus vulgaris [French bean]
ref|XP_007017735.1|  Cytochrome P450, putative                          286   8e-89    
ref|XP_010670976.1|  PREDICTED: cytochrome P450 83B1-like               284   1e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003589393.1|  Cytochrome P450                                    285   2e-88    Medicago truncatula
ref|XP_007134796.1|  hypothetical protein PHAVU_010G077000g             283   5e-88    Phaseolus vulgaris [French bean]
gb|EYU31745.1|  hypothetical protein MIMGU_mgv1a017772mg                283   6e-88    Erythranthe guttata [common monkey flower]
gb|AFK34313.1|  unknown                                                 283   8e-88    Medicago truncatula
gb|KJB73277.1|  hypothetical protein B456_011G225500                    283   9e-88    Gossypium raimondii
gb|AES59642.2|  cytochrome P450 family 71 protein                       283   9e-88    Medicago truncatula
ref|XP_003521997.1|  PREDICTED: cytochrome P450 83B1-like               282   1e-87    Glycine max [soybeans]
ref|XP_003614173.1|  Cytochrome P450 71B10                              282   1e-87    Medicago truncatula
gb|ACU18750.1|  unknown                                                 282   1e-87    Glycine max [soybeans]
gb|KHN38814.1|  Cytochrome P450 83B1                                    282   1e-87    Glycine soja [wild soybean]
gb|KEH16181.1|  cytochrome P450 family 71 protein                       282   2e-87    Medicago truncatula
ref|XP_007134004.1|  hypothetical protein PHAVU_010G011000g             281   2e-87    Phaseolus vulgaris [French bean]
ref|XP_010677521.1|  PREDICTED: cytochrome P450 71A1-like               281   2e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006358826.1|  PREDICTED: cytochrome P450 71B37-like              271   2e-87    
ref|XP_012075259.1|  PREDICTED: cytochrome P450 83B1-like               281   3e-87    Jatropha curcas
ref|XP_003589391.1|  Cytochrome P450                                    282   4e-87    
ref|XP_011074242.1|  PREDICTED: cytochrome P450 71B36-like              281   4e-87    Sesamum indicum [beniseed]
ref|XP_010270695.1|  PREDICTED: cytochrome P450 71A9-like               279   2e-86    Nelumbo nucifera [Indian lotus]
ref|NP_001240228.1|  cytochrome P450 83B1-like precursor                279   2e-86    Glycine max [soybeans]
ref|XP_010064675.1|  PREDICTED: cytochrome P450 71A1-like               279   3e-86    Eucalyptus grandis [rose gum]
dbj|BAF98468.1|  cytochrome P450                                        278   3e-86    Coptis japonica var. dissecta
ref|XP_011087278.1|  PREDICTED: cytochrome P450 71A9-like               278   4e-86    Sesamum indicum [beniseed]
ref|XP_010272816.1|  PREDICTED: cytochrome P450 71A1-like               278   5e-86    Nelumbo nucifera [Indian lotus]
ref|XP_011074244.1|  PREDICTED: cytochrome P450 83B1-like               274   6e-86    
ref|XP_004499226.1|  PREDICTED: cytochrome P450 71B37-like              277   1e-85    Cicer arietinum [garbanzo]
ref|XP_003621357.1|  Cytochrome P450 71B37                              276   2e-85    Medicago truncatula
gb|KDO50377.1|  hypothetical protein CISIN_1g010151mg                   276   3e-85    Citrus sinensis [apfelsine]
ref|XP_007140954.1|  hypothetical protein PHAVU_008G155000g             276   3e-85    Phaseolus vulgaris [French bean]
ref|XP_006432552.1|  hypothetical protein CICLE_v10000886mg             276   4e-85    Citrus clementina [clementine]
ref|XP_011085392.1|  PREDICTED: cytochrome P450 83B1-like               275   6e-85    
ref|XP_007017733.1|  Cytochrome P450, putative                          272   8e-85    
ref|XP_010272814.1|  PREDICTED: cytochrome P450 71A1-like               275   9e-85    Nelumbo nucifera [Indian lotus]
ref|XP_004516029.1|  PREDICTED: cytochrome P450 83B1-like               274   1e-84    Cicer arietinum [garbanzo]
gb|AET50435.1|  putative cytochrome P450                                265   1e-84    Citrus sinensis [apfelsine]
gb|KEH29137.1|  cytochrome P450 family 71 protein                       274   2e-84    Medicago truncatula
ref|XP_002512136.1|  cytochrome P450, putative                          272   2e-84    
ref|XP_006493394.1|  PREDICTED: cytochrome P450 83B1-like               270   2e-84    
ref|XP_006473076.1|  PREDICTED: cytochrome P450 83B1-like               273   3e-84    Citrus sinensis [apfelsine]
ref|XP_011028965.1|  PREDICTED: cytochrome P450 83B1-like               273   4e-84    Populus euphratica
ref|XP_003521973.1|  PREDICTED: cytochrome P450 83B1-like               273   5e-84    Glycine max [soybeans]
ref|XP_002300723.2|  hypothetical protein POPTR_0002s02800g             272   1e-83    
ref|XP_010912890.1|  PREDICTED: cytochrome P450 71A9-like               271   2e-83    Elaeis guineensis
ref|XP_002300724.2|  hypothetical protein POPTR_0002s02740g             271   2e-83    
ref|XP_010256342.1|  PREDICTED: cytochrome P450 71A1-like               271   2e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010271424.1|  PREDICTED: cytochrome P450 71A1-like               271   3e-83    Nelumbo nucifera [Indian lotus]
ref|XP_011094079.1|  PREDICTED: cytochrome P450 71A1-like               270   8e-83    Sesamum indicum [beniseed]
ref|XP_007017738.1|  Cytochrome P450, putative                          267   1e-82    
gb|KDO55355.1|  hypothetical protein CISIN_1g010727mg                   269   1e-82    Citrus sinensis [apfelsine]
ref|XP_006427663.1|  hypothetical protein CICLE_v10025429mg             268   2e-82    Citrus clementina [clementine]
ref|XP_007022289.1|  Cytochrome P450, family 71, subfamily B, pol...    268   3e-82    
ref|XP_002300725.2|  hypothetical protein POPTR_0002s02730g             268   3e-82    
ref|XP_006576430.1|  PREDICTED: cytochrome P450 83B1-like               268   4e-82    Glycine max [soybeans]
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    268   4e-82    Persea americana
ref|XP_011072187.1|  PREDICTED: cytochrome P450 71A9-like               267   6e-82    
gb|AJD25157.1|  cytochrome P450 CYP71AT93                               267   6e-82    Salvia miltiorrhiza [Chinese salvia]
ref|XP_006427664.1|  hypothetical protein CICLE_v10027422mg             266   6e-82    
ref|XP_008779115.1|  PREDICTED: cytochrome P450 71A1-like               259   9e-82    Phoenix dactylifera
gb|KHN38812.1|  Cytochrome P450 83B1                                    266   1e-81    Glycine soja [wild soybean]
ref|XP_006427665.1|  hypothetical protein CICLE_v10025431mg             266   2e-81    Citrus clementina [clementine]
ref|XP_007134795.1|  hypothetical protein PHAVU_010G076900g             256   2e-81    Phaseolus vulgaris [French bean]
ref|XP_003521980.1|  PREDICTED: cytochrome P450 83B1-like               265   4e-81    Glycine max [soybeans]
ref|XP_002523238.1|  cytochrome P450, putative                          265   7e-81    
gb|KHN35606.1|  Cytochrome P450 83B1                                    264   1e-80    Glycine soja [wild soybean]
ref|XP_002523235.1|  cytochrome P450, putative                          264   1e-80    Ricinus communis
gb|AFK39905.1|  unknown                                                 263   2e-80    Lotus japonicus
ref|XP_008809621.1|  PREDICTED: cytochrome P450 71A1-like               263   3e-80    Phoenix dactylifera
ref|XP_008777462.1|  PREDICTED: cytochrome P450 71A1-like               262   3e-80    
gb|AFK47273.1|  unknown                                                 263   3e-80    Lotus japonicus
ref|XP_010931872.1|  PREDICTED: cytochrome P450 71A9-like               263   4e-80    Elaeis guineensis
gb|KEH29143.1|  cytochrome P450 family 71 protein                       253   4e-80    Medicago truncatula
emb|CAN60733.1|  hypothetical protein VITISV_023587                     263   4e-80    Vitis vinifera
ref|XP_012079912.1|  PREDICTED: cytochrome P450 71A1-like               262   1e-79    Jatropha curcas
ref|XP_010911404.1|  PREDICTED: cytochrome P450 71A1-like               261   1e-79    Elaeis guineensis
ref|XP_011034037.1|  PREDICTED: cytochrome P450 71B10-like              261   1e-79    Populus euphratica
ref|XP_002285456.1|  PREDICTED: cytochrome P450 71B34-like              261   2e-79    Vitis vinifera
ref|XP_010102935.1|  Cytochrome P450 71A9                               259   2e-79    
emb|CBI19817.3|  unnamed protein product                                257   2e-79    Vitis vinifera
gb|ABC59082.1|  cytochrome P450 monooxygenase CYP83E8                   261   2e-79    Medicago truncatula
gb|AIU56748.1|  cytochrome P450 CYP71B40v3                              261   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_002312660.2|  hypothetical protein POPTR_0008s18810g             261   2e-79    Populus trichocarpa [western balsam poplar]
gb|AJD25153.1|  cytochrome P450 CYP71AT89                               260   3e-79    Salvia miltiorrhiza [Chinese salvia]
ref|XP_006386188.1|  hypothetical protein POPTR_0002s02790g             261   3e-79    Populus trichocarpa [western balsam poplar]
ref|XP_007048751.1|  4-hydroxyphenylacetaldehyde oxime monooxygen...    261   3e-79    
gb|ADO16183.1|  cytochrome P450 mono-oxygenase                          259   4e-79    Artemisia annua [sweet Annie]
ref|XP_007134793.1|  hypothetical protein PHAVU_010G076700g             260   4e-79    Phaseolus vulgaris [French bean]
gb|KDO62263.1|  hypothetical protein CISIN_1g0110962mg                  253   4e-79    Citrus sinensis [apfelsine]
ref|XP_003612313.1|  Cytochrome P450 71B10                              259   5e-79    
ref|XP_010519644.1|  PREDICTED: cytochrome P450 71B11-like              259   5e-79    
ref|XP_010910121.1|  PREDICTED: cytochrome P450 71A1-like               259   6e-79    Elaeis guineensis
ref|XP_007210941.1|  hypothetical protein PRUPE_ppa024670mg             259   7e-79    Prunus persica
gb|KJB73276.1|  hypothetical protein B456_011G225400                    259   8e-79    Gossypium raimondii
gb|AIU56747.1|  cytochrome P450 CYP71B41v2                              259   8e-79    Populus trichocarpa [western balsam poplar]
gb|KDP36616.1|  hypothetical protein JCGZ_08432                         254   1e-78    Jatropha curcas
gb|KFK33558.1|  hypothetical protein AALP_AA5G029200                    258   2e-78    Arabis alpina [alpine rockcress]
gb|ABK94709.1|  unknown                                                 258   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_007210185.1|  hypothetical protein PRUPE_ppa020002mg             259   2e-78    Prunus persica
emb|CBI19821.3|  unnamed protein product                                253   2e-78    Vitis vinifera
ref|XP_002279272.2|  PREDICTED: 2-methylbutanal oxime monooxygena...    258   3e-78    Vitis vinifera
emb|CAN80448.1|  hypothetical protein VITISV_039229                     258   3e-78    Vitis vinifera
ref|XP_010450434.1|  PREDICTED: cytochrome P450 71B17-like              254   3e-78    
gb|KDP26674.1|  hypothetical protein JCGZ_17832                         258   3e-78    Jatropha curcas
ref|XP_010931871.1|  PREDICTED: cytochrome P450 71A9-like               258   3e-78    Elaeis guineensis
gb|KDO50397.1|  hypothetical protein CISIN_1g020458mg                   252   4e-78    Citrus sinensis [apfelsine]
ref|XP_012085503.1|  PREDICTED: cytochrome P450 71B36-like              258   4e-78    
ref|XP_007047924.1|  4-hydroxyphenylacetaldehyde oxime monooxygen...    257   4e-78    
ref|XP_002312659.2|  hypothetical protein POPTR_0008s18790g             257   5e-78    
ref|XP_007044858.1|  Cytochrome P450, family 71, subfamily B, pol...    257   6e-78    
ref|XP_012076015.1|  PREDICTED: cytochrome P450 71B34-like              257   7e-78    
ref|XP_008787049.1|  PREDICTED: cytochrome P450 71A1-like               256   8e-78    Phoenix dactylifera
ref|XP_002530056.1|  cytochrome P450, putative                          256   1e-77    Ricinus communis
gb|AIU56749.1|  cytochrome P450 CYP71B63v2                              256   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_006483977.1|  PREDICTED: cytochrome P450 71B35-like              256   1e-77    Citrus sinensis [apfelsine]
ref|XP_002312665.2|  hypothetical protein POPTR_0008s18870g             256   1e-77    
ref|XP_007047925.1|  Cytochrome P450, family 71, subfamily B, pol...    256   1e-77    
ref|XP_007047923.1|  Cytochrome P450, family 71, subfamily B, pol...    256   1e-77    
gb|ADO16182.1|  cytochrome P450 mono-oxygenase                          256   2e-77    Artemisia annua [sweet Annie]
ref|XP_010531521.1|  PREDICTED: cytochrome P450 71B34-like              256   2e-77    Tarenaya hassleriana [spider flower]
ref|XP_006438217.1|  hypothetical protein CICLE_v10033591mg             256   2e-77    Citrus clementina [clementine]
gb|AAL24049.1|AF426451_1  cytochrome P450                               256   2e-77    Citrus sinensis [apfelsine]
gb|KDO82173.1|  hypothetical protein CISIN_1g010614mg                   256   2e-77    Citrus sinensis [apfelsine]
ref|XP_010667688.1|  PREDICTED: cytochrome P450 71A4-like               256   2e-77    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004135495.2|  PREDICTED: cytochrome P450 71B37-like              256   2e-77    Cucumis sativus [cucumbers]
emb|CDP12691.1|  unnamed protein product                                255   3e-77    Coffea canephora [robusta coffee]
ref|XP_010264863.1|  PREDICTED: cytochrome P450 71A1-like               255   3e-77    Nelumbo nucifera [Indian lotus]
ref|XP_012073921.1|  PREDICTED: cytochrome P450 71B34-like              255   4e-77    Jatropha curcas
ref|XP_006439958.1|  hypothetical protein CICLE_v10023549mg             254   4e-77    
ref|XP_006438218.1|  hypothetical protein CICLE_v10031247mg             255   4e-77    Citrus clementina [clementine]
ref|XP_007160690.1|  hypothetical protein PHAVU_001G008900g             255   4e-77    Phaseolus vulgaris [French bean]
ref|XP_008367043.1|  PREDICTED: cytochrome P450 71B26-like              255   4e-77    
emb|CDY13616.1|  BnaA06g33070D                                          256   5e-77    Brassica napus [oilseed rape]
ref|XP_006483976.1|  PREDICTED: cytochrome P450 71B37-like              255   5e-77    Citrus sinensis [apfelsine]
gb|KJB73275.1|  hypothetical protein B456_011G225300                    254   6e-77    Gossypium raimondii
ref|XP_006443321.1|  hypothetical protein CICLE_v10022473mg             244   7e-77    
ref|XP_010519601.1|  PREDICTED: cytochrome P450 71B11-like              254   9e-77    
ref|XP_011464172.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    253   1e-76    
ref|XP_010929928.1|  PREDICTED: cytochrome P450 71A1-like               254   1e-76    
gb|KHG17560.1|  Cytochrome P450 protein                                 254   1e-76    
ref|XP_010909221.1|  PREDICTED: cytochrome P450 71A1-like               253   1e-76    
gb|KEH34014.1|  cytochrome P450 family 71 protein                       254   1e-76    
ref|XP_010425289.1|  PREDICTED: cytochrome P450 71B17-like              253   1e-76    
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               253   2e-76    
ref|XP_009405041.1|  PREDICTED: cytochrome P450 71A1-like               253   2e-76    
ref|XP_010100350.1|  Cytochrome P450                                    253   2e-76    
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   253   2e-76    
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             253   2e-76    
ref|XP_009152074.1|  PREDICTED: cytochrome P450 71B17-like              253   2e-76    
ref|XP_010514262.1|  PREDICTED: cytochrome P450 71B17-like isofor...    253   2e-76    
ref|XP_002321645.1|  hypothetical protein POPTR_0015s09760g             253   2e-76    
gb|KDO62262.1|  hypothetical protein CISIN_1g0110962mg                  246   2e-76    
ref|XP_010102938.1|  Cytochrome P450 71A1                               253   2e-76    
ref|XP_010502533.1|  PREDICTED: cytochrome P450 71B25-like              253   2e-76    
ref|XP_011651857.1|  PREDICTED: cytochrome P450 71A1-like               253   3e-76    
gb|ABO32529.1|  cytochrome P450-dependent monooxygenase-like protein    253   3e-76    
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             253   3e-76    
ref|XP_009387345.1|  PREDICTED: cytochrome P450 71A1-like               253   4e-76    
ref|XP_002318091.2|  hypothetical protein POPTR_0012s09180g             252   4e-76    
ref|XP_004981041.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...    253   4e-76    
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             252   5e-76    
ref|XP_010667690.1|  PREDICTED: cytochrome P450 71A4-like               253   5e-76    
gb|AAB94589.1|  CYP83D1p                                                252   6e-76    
ref|XP_010425290.1|  PREDICTED: cytochrome P450 71B17-like              252   6e-76    
ref|XP_010425326.1|  PREDICTED: cytochrome P450 71B25                   251   6e-76    
emb|CDP19789.1|  unnamed protein product                                248   6e-76    
emb|CDP12692.1|  unnamed protein product                                252   6e-76    
ref|XP_003550413.1|  PREDICTED: cytochrome P450 71A1                    252   6e-76    
ref|XP_009121542.1|  PREDICTED: cytochrome P450 71B9-like               244   7e-76    
ref|XP_006576431.1|  PREDICTED: cytochrome P450 71B37-like              243   8e-76    
ref|XP_010100302.1|  Cytochrome P450 71A1                               249   8e-76    
ref|XP_006292803.1|  hypothetical protein CARUB_v10019054mg             251   9e-76    
ref|XP_010695999.1|  PREDICTED: cytochrome P450 71A1-like               251   9e-76    
ref|XP_009392073.1|  PREDICTED: cytochrome P450 71A1-like               251   1e-75    
gb|KJB19523.1|  hypothetical protein B456_003G107400                    251   1e-75    
ref|XP_012079911.1|  PREDICTED: cytochrome P450 71A1-like               251   2e-75    
ref|XP_004301023.1|  PREDICTED: cytochrome P450 71A9-like               251   2e-75    
ref|XP_002461858.1|  hypothetical protein SORBIDRAFT_02g009410          248   2e-75    
ref|XP_011005615.1|  PREDICTED: cytochrome P450 71A1-like               251   2e-75    
ref|XP_011040453.1|  PREDICTED: cytochrome P450 71A1-like               251   2e-75    
ref|XP_008793722.1|  PREDICTED: cytochrome P450 71A1-like               251   2e-75    
ref|XP_004981040.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...    251   2e-75    
gb|KGN51731.1|  Cytochrome P450                                         245   2e-75    
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             250   2e-75    
ref|XP_008778727.1|  PREDICTED: cytochrome P450 71A1-like               251   2e-75    
ref|XP_010556347.1|  PREDICTED: cytochrome P450 71B10-like              250   2e-75    
ref|XP_002276558.2|  PREDICTED: cytochrome P450 71A1-like               250   2e-75    
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              250   3e-75    
ref|XP_012076029.1|  PREDICTED: cytochrome P450 71B34-like              250   3e-75    
ref|XP_004135499.1|  PREDICTED: cytochrome P450 71B19-like              250   3e-75    
gb|EYU17608.1|  hypothetical protein MIMGU_mgv1a022583mg                242   3e-75    
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like               250   3e-75    
ref|NP_001234847.1|  cytochrome P450 71 family protein                  249   3e-75    
gb|AAK59528.2|  putative cytochrome P450 monooxygenase                  242   4e-75    
ref|XP_007148448.1|  hypothetical protein PHAVU_006G209700g             250   4e-75    
ref|XP_010650716.1|  PREDICTED: cytochrome P450 71B34-like              249   4e-75    
gb|KJB50271.1|  hypothetical protein B456_008G161500                    250   4e-75    
emb|CBI14915.3|  unnamed protein product                                247   4e-75    
ref|XP_011656251.1|  PREDICTED: cytochrome P450 71B10-like              249   4e-75    
ref|XP_006292809.1|  hypothetical protein CARUB_v10019060mg             249   4e-75    
emb|CDY40993.1|  BnaA02g27830D                                          246   4e-75    
gb|AJD25152.1|  cytochrome P450 CYP71AP14                               250   5e-75    
ref|XP_010502525.1|  PREDICTED: cytochrome P450 71B17-like              249   5e-75    
ref|XP_010440788.1|  PREDICTED: cytochrome P450 71B17-like              249   5e-75    
ref|XP_012087624.1|  PREDICTED: 2-methylbutanal oxime monooxygena...    243   7e-75    
ref|XP_008778632.1|  PREDICTED: cytochrome P450 71A1-like               249   7e-75    
ref|XP_006359799.1|  PREDICTED: cytochrome P450 71A1-like               249   7e-75    
emb|CAN83446.1|  hypothetical protein VITISV_019663                     258   8e-75    
ref|NP_974364.1|  cytochrome P450 71B20                                 244   9e-75    
ref|XP_008462004.1|  PREDICTED: cytochrome P450 71A1-like               249   1e-74    
ref|XP_008221936.1|  PREDICTED: cytochrome P450 71B37-like              249   1e-74    
ref|XP_010916488.1|  PREDICTED: cytochrome P450 71A1-like               249   1e-74    
ref|XP_004135281.2|  PREDICTED: cytochrome P450 71B2-like isoform X1    248   2e-74    
ref|XP_010100355.1|  Cytochrome P450                                    248   2e-74    
ref|XP_010248827.1|  PREDICTED: cytochrome P450 71A1-like               248   2e-74    
ref|XP_006479001.1|  PREDICTED: cytochrome P450 71A1-like               249   2e-74    
ref|XP_007225745.1|  hypothetical protein PRUPE_ppa004343mg             248   2e-74    
gb|KHN38815.1|  Cytochrome P450 71B37                                   243   2e-74    
dbj|BAB40324.1|  cytochrome P450                                        248   2e-74    
dbj|BAB40323.1|  cytochrome P450                                        248   2e-74    
ref|XP_010100351.1|  Cytochrome P450                                    248   2e-74    
ref|XP_003601151.1|  Cytochrome P450                                    248   2e-74    
gb|KDO62260.1|  hypothetical protein CISIN_1g020837mg                   242   3e-74    
ref|XP_007047927.1|  4-hydroxyphenylacetaldehyde oxime monooxygen...    248   3e-74    
emb|CDX99726.1|  BnaC02g35940D                                          244   3e-74    
ref|XP_008221935.1|  PREDICTED: cytochrome P450 71B36-like              248   3e-74    
ref|XP_006388081.1|  hypothetical protein POPTR_0357s00220g             247   3e-74    
ref|XP_006290945.1|  hypothetical protein CARUB_v10017061mg             247   3e-74    
ref|XP_002876961.1|  CYP71B34                                           247   4e-74    
gb|KHG11226.1|  Cytochrome P450                                         247   4e-74    
ref|XP_007223157.1|  hypothetical protein PRUPE_ppa004390mg             247   4e-74    
gb|AFK73717.1|  cytochrome P450                                         247   4e-74    
ref|XP_010502526.1|  PREDICTED: cytochrome P450 71B17-like isofor...    247   4e-74    
ref|XP_006290955.1|  hypothetical protein CARUB_v10017071mg             247   4e-74    
ref|XP_009628592.1|  PREDICTED: cytochrome P450 71A1-like               247   5e-74    
ref|XP_004501856.1|  PREDICTED: cytochrome P450 71A1-like               247   5e-74    
ref|XP_006439961.1|  hypothetical protein CICLE_v10019903mg             246   6e-74    
ref|XP_011651873.1|  PREDICTED: cytochrome P450 71A1-like               241   6e-74    
ref|XP_011651837.1|  PREDICTED: cytochrome P450 71A1-like               246   7e-74    
ref|XP_010514261.1|  PREDICTED: cytochrome P450 71B17-like              246   7e-74    
emb|CCO62222.1|  putative cytochrome P450 monooxygenase                 246   8e-74    
gb|EYU17754.1|  hypothetical protein MIMGU_mgv1a004502mg                247   8e-74    
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         246   8e-74    
ref|XP_004309993.1|  PREDICTED: cytochrome P450 71B34-like              246   8e-74    
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    246   9e-74    
emb|CDY71300.1|  BnaAnng36890D                                          238   1e-73    
ref|XP_002318090.2|  hypothetical protein POPTR_0012s09160g             246   1e-73    
gb|KJB17916.1|  hypothetical protein B456_003G023900                    236   1e-73    
ref|XP_009152073.1|  PREDICTED: cytochrome P450 71B19-like              246   1e-73    
ref|XP_004152500.1|  PREDICTED: cytochrome P450 71A1-like               246   1e-73    
ref|XP_004299157.1|  PREDICTED: cytochrome P450 71A1-like               246   1e-73    
ref|XP_011626486.1|  PREDICTED: cytochrome P450 71A1                    246   2e-73    
ref|XP_004135497.2|  PREDICTED: cytochrome P450 71B37-like              245   2e-73    
ref|XP_010531534.1|  PREDICTED: cytochrome P450 71B34-like              246   2e-73    
ref|XP_010663828.1|  PREDICTED: cytochrome P450 71A9-like               245   2e-73    
ref|XP_002876949.1|  CYP71B16                                           245   2e-73    
ref|XP_009759043.1|  PREDICTED: cytochrome P450 71A1-like               246   2e-73    
emb|CDY65175.1|  BnaCnng45890D                                          245   2e-73    
ref|XP_010911323.1|  PREDICTED: cytochrome P450 71A1-like               245   2e-73    
gb|ACF85688.1|  unknown                                                 242   3e-73    
gb|KEH34023.1|  cytochrome P450 family 71 protein                       243   3e-73    
ref|XP_010696004.1|  PREDICTED: cytochrome P450 71A8-like               240   3e-73    
gb|AAL38987.1|  cytochrome P450-1                                       245   3e-73    
ref|XP_009129563.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    245   3e-73    
emb|CDX99716.1|  BnaC02g36040D                                          243   3e-73    
ref|XP_004955981.1|  PREDICTED: 4-hydroxyphenylacetaldehyde oxime...    245   3e-73    
gb|ADW54460.1|  cytochrome P450 83B1                                    244   4e-73    
emb|CDP19360.1|  unnamed protein product                                244   4e-73    
gb|AGD95056.1|  cytochrome P450 monooxygenase 83-5                      244   4e-73    
emb|CDX80735.1|  BnaC08g05690D                                          244   4e-73    
ref|XP_006293198.1|  hypothetical protein CARUB_v10019518mg             244   4e-73    
gb|KEH34013.1|  cytochrome P450 family 71 protein                       244   5e-73    
gb|ACH41741.1|  CYP83B1                                                 244   5e-73    
emb|CDY35791.1|  BnaA08g04520D                                          244   5e-73    
sp|O48958.1|C71E1_SORBI  RecName: Full=4-hydroxyphenylacetaldehyd...    245   5e-73    
ref|XP_008779328.1|  PREDICTED: cytochrome P450 71A1-like               244   5e-73    
ref|XP_009123565.1|  PREDICTED: cytochrome P450 71B37-like              244   5e-73    
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              244   6e-73    
ref|XP_006285988.1|  hypothetical protein CARUB_v10007516mg             244   6e-73    
ref|XP_004135282.2|  PREDICTED: cytochrome P450 71B37-like              244   7e-73    
gb|KFK33574.1|  hypothetical protein AALP_AA5G031500                    242   7e-73    
gb|AHI49893.1|  cytochrome P450                                         234   8e-73    
ref|XP_006291162.1|  hypothetical protein CARUB_v10017280mg             242   8e-73    
ref|XP_008447001.1|  PREDICTED: cytochrome P450 71B34-like              251   8e-73    
gb|ACJ06267.2|  CYP83B1                                                 243   8e-73    
ref|XP_011660355.1|  PREDICTED: cytochrome P450 71A1-like               244   8e-73    
ref|XP_010530341.1|  PREDICTED: cytochrome P450 83B1                    243   8e-73    
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   243   8e-73    
ref|NP_189249.1|  cytochrome P450 71B20                                 243   9e-73    
ref|XP_009107632.1|  PREDICTED: cytochrome P450 83B1                    244   9e-73    
ref|XP_006856442.1|  PREDICTED: cytochrome P450 71A1                    243   1e-72    
gb|AAL16177.1|AF428409_1  AT3g26180/MTC11_8                             243   1e-72    
ref|XP_006290957.1|  hypothetical protein CARUB_v10017073mg             243   1e-72    
gb|AHB11193.1|  cytochrome P450 83B1                                    243   1e-72    
gb|KHN34368.1|  Cytochrome P450 71A9                                    241   1e-72    
emb|CDY56372.1|  BnaAnng14250D                                          243   1e-72    
ref|XP_006350771.1|  PREDICTED: cytochrome P450 71A9-like               243   2e-72    
ref|NP_194878.1|  cytochrome P450 83B1                                  243   2e-72    
ref|NP_189248.1|  cytochrome P450 71B19                                 243   2e-72    
gb|AAL38986.1|  cytochrome P450-3                                       242   2e-72    
gb|AAM63679.1|  cytochrome P450, putative                               243   2e-72    
ref|XP_004135500.1|  PREDICTED: cytochrome P450 71B37-like              242   2e-72    
ref|XP_010909080.1|  PREDICTED: cytochrome P450 71A1-like               243   2e-72    
ref|XP_002466097.1|  hypothetical protein SORBIDRAFT_01g001180          245   2e-72    
gb|KEH28447.1|  cytochrome P450 family 71 protein                       240   2e-72    
ref|XP_009620580.1|  PREDICTED: cytochrome P450 71A9-like               242   2e-72    
ref|XP_010502529.1|  PREDICTED: cytochrome P450 71B19                   243   2e-72    
ref|XP_002867299.1|  CYP83B1                                            242   2e-72    
gb|KFK33565.1|  hypothetical protein AALP_AA5G030000                    242   2e-72    
ref|XP_012076039.1|  PREDICTED: cytochrome P450 71B34-like              243   2e-72    
dbj|BAH84782.1|  cytochrome P450                                        242   2e-72    
gb|KHN27239.1|  Cytochrome P450 71D11                                   241   2e-72    
ref|XP_007037782.1|  Cytochrome P450 71A1                               243   2e-72    
gb|EMT29843.1|  Cytochrome P450 71D8                                    236   3e-72    
ref|XP_010438031.1|  PREDICTED: cytochrome P450 83B1-like               236   3e-72    
gb|KDO55356.1|  hypothetical protein CISIN_1g035623mg                   233   3e-72    
gb|KHN30969.1|  Cytochrome P450 71A1                                    234   3e-72    
emb|CDX99721.1|  BnaC02g35990D                                          236   3e-72    
gb|AFK73716.1|  cytochrome P450                                         242   3e-72    
ref|XP_002876952.1|  CYP71B19                                           242   3e-72    
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              242   3e-72    
ref|XP_006395567.1|  hypothetical protein EUTSA_v10004067mg             242   3e-72    
ref|XP_011014656.1|  PREDICTED: cytochrome P450 71A1-like               239   3e-72    
ref|XP_006578667.1|  PREDICTED: cytochrome P450 71A1-like               235   3e-72    
ref|XP_010696002.1|  PREDICTED: cytochrome P450 71A9-like               242   3e-72    
ref|XP_008793763.1|  PREDICTED: cytochrome P450 71A9-like               242   3e-72    
ref|NP_849653.1|  cytochrome P450 71B2                                  238   4e-72    
ref|XP_010909896.1|  PREDICTED: cytochrome P450 71A1-like               242   4e-72    
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         242   4e-72    
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             242   4e-72    
gb|ACU20174.1|  unknown                                                 242   4e-72    
ref|XP_006395573.1|  hypothetical protein EUTSA_v10005389mg             241   4e-72    
ref|XP_002876954.1|  CYP71B23                                           241   4e-72    
gb|KDP29691.1|  hypothetical protein JCGZ_18626                         239   5e-72    
ref|XP_010514264.1|  PREDICTED: cytochrome P450 71B19-like              241   5e-72    
ref|NP_001141382.1|  uncharacterized protein LOC100273473               242   5e-72    
ref|XP_009388172.1|  PREDICTED: cytochrome P450 71A1-like               241   5e-72    
emb|CDP14644.1|  unnamed protein product                                237   6e-72    
emb|CDY48995.1|  BnaA02g28010D                                          240   6e-72    
ref|XP_002515012.1|  cytochrome P450, putative                          242   7e-72    
ref|XP_008446152.1|  PREDICTED: uncharacterized protein LOC103488960    249   7e-72    
gb|KEH31104.1|  cytochrome P450 family 71 protein                       241   7e-72    
ref|NP_001239692.1|  cytochrome P450 71A9 precursor                     241   7e-72    
ref|XP_009113192.1|  PREDICTED: cytochrome P450 71B17-like              234   8e-72    
ref|XP_002523241.1|  cytochrome P450, putative                          240   8e-72    
ref|XP_008360773.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    241   8e-72    
ref|XP_006290953.1|  hypothetical protein CARUB_v10017069mg             241   9e-72    
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         241   9e-72    
gb|KDP34533.1|  hypothetical protein JCGZ_11083                         242   9e-72    
ref|XP_007037784.1|  Cytochrome P450 71A9, putative                     239   9e-72    
gb|AGS49168.1|  cytochrome P450 CYP83B1                                 241   9e-72    
ref|XP_006396006.1|  hypothetical protein EUTSA_v10004064mg             241   1e-71    
ref|XP_010251006.1|  PREDICTED: cytochrome P450 71A1                    241   1e-71    
ref|XP_007044859.1|  Cytochrome P450, family 71, subfamily B, pol...    236   1e-71    
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              241   1e-71    
ref|NP_189252.1|  cytochrome P450 71B23                                 241   1e-71    



>ref|XP_006358767.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=344

 Score =   334 bits (857),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 188/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KSM+GDILD+L+ LK E S+S++LT D IK +LM VFVAGSDTSAA + WAMTAL+K P+
Sbjct  109  KSMEGDILDLLLQLKKERSTSIDLTLDDIKGILMDVFVAGSDTSAAAVEWAMTALIKNPK  168

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            IM  VQ EIR+ +G KG +NE+DIQ + YFK+V+KET RLYPP P+L+ RET+   T++G
Sbjct  169  IMKKVQKEIRETIGTKGIVNEDDIQNMSYFKSVIKETFRLYPPAPLLIPRETMKKSTLEG  228

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI P  ++ VNSWAIARDPE WEN  EF PERFL++ +D+KGQ+FE IPFG GRR CPG
Sbjct  229  YEIHPGTIIHVNSWAIARDPEIWENSEEFIPERFLNSDIDFKGQNFELIPFGAGRRGCPG  288

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            I LGVAS ELAL+NLLYAFDWELP  +KKEDIDT V PG TMH+K  LCL+ +K
Sbjct  289  ITLGVASMELALSNLLYAFDWELPYGMKKEDIDTYVKPGTTMHRKNDLCLIPRK  342



>ref|XP_004247903.2| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=495

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 190/234 (81%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ L  E S+ ++LT D+IKA+LM +FV G+DTSAA +VWAMTALMK P
Sbjct  259  PKSMEGDIIDLLLQLMKEQSTPIDLTLDNIKAILMNIFVGGTDTSAATVVWAMTALMKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            ++M  VQ EIR  +G KG +NE+D+Q + YFKAV+KET RLYPP PILV RET+   T++
Sbjct  319  KVMKKVQEEIRKSIGTKGFVNEDDVQNMSYFKAVIKETFRLYPPAPILVPRETMKKSTLE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   ++ VNSWAIARDPE WENP EF PERFL++ +D+KGQDFE +PFG GRR CP
Sbjct  379  GYEIQLGTIIHVNSWAIARDPEVWENPEEFMPERFLNSDIDFKGQDFELLPFGAGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVA+ +L L+NLLYAFDWELP  +KKEDIDTNV PGITMHKK  LCLV K
Sbjct  439  GIALGVATVDLMLSNLLYAFDWELPCGMKKEDIDTNVMPGITMHKKNDLCLVPK  492



>ref|XP_006358766.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=496

 Score =   338 bits (867),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 189/234 (81%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK E S  ++LT + IK +LM V VAGSDTSAA IVW MTALMK P
Sbjct  260  PKSMEGDIVDLLLQLKKEKSIPIDLTLEDIKGLLMDVLVAGSDTSAAGIVWTMTALMKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  +G KG +NE+DIQ +PYFKAV+KE  RLYPPVP+LV+RE++   T++
Sbjct  320  KAMKKVQEEIRKSIGNKGIVNEDDIQNMPYFKAVIKEAFRLYPPVPLLVQRESMKKSTLE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+ + +V VNSWAIARDPE WENP EF PERFL++ +DYKGQ++E IPFG GRR CP
Sbjct  380  GYEIQARTIVHVNSWAIARDPEIWENPEEFIPERFLNSDIDYKGQNYELIPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ LGVAS ELAL+NLLYAFDWELP  +KKEDIDTNV PGITMHKK  LCL+ K
Sbjct  440  GMTLGVASMELALSNLLYAFDWELPHGMKKEDIDTNVRPGITMHKKNELCLIPK  493



>ref|XP_009601421.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=496

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 190/234 (81%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK E+S+ +N+T D+IKA+LM +FVAG+DT A  +VWAMTAL+  P
Sbjct  260  PKSMEGDILDLLLQLKKEHSTPINITLDNIKAILMNIFVAGTDTVAISLVWAMTALIMNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  VGKKG +NE+DIQ   Y KAV+KET RLYPP P L+ RET+ N  ++
Sbjct  320  KAMKKVQEEIRKSVGKKGMVNEDDIQNFHYLKAVIKETFRLYPPAPTLLARETIQNSILE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I PK +++VN WAIARDPE WENP EF PERFL++ +DYKGQDFEFIPFG GRRVCP
Sbjct  380  GYKIPPKTIIYVNYWAIARDPEYWENPEEFIPERFLNSNIDYKGQDFEFIPFGAGRRVCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVA+ EL L+NL+YAFDWELP  +KKEDIDT+V PG+TMHKK  LCLV K
Sbjct  440  GIALGVATLELILSNLVYAFDWELPCDMKKEDIDTDVLPGLTMHKKNALCLVPK  493



>ref|XP_009769778.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Nicotiana sylvestris]
Length=234

 Score =   327 bits (837),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 184/231 (80%), Gaps = 0/231 (0%)
 Frame = -1

Query  855  MDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIM  676
            M+GDILD+L+ LK E S+ +N+T D+IKA+LM +FVAG+DT A  +VW MTAL+  P+ M
Sbjct  1    MEGDILDLLLQLKKEASTPINITLDNIKAILMNIFVAGTDTVAISLVWTMTALIMNPKAM  60

Query  675  NIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
              VQ EIR  VGKKG +NE+DIQ   Y KAV+KET RLYPP P LV RET+ N  ++GY+
Sbjct  61   KKVQEEIRKSVGKKGMVNEDDIQNFHYLKAVIKETFRLYPPAPTLVARETIQNSILEGYK  120

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIA  316
            I PK +V+VN WAIARDPE WENP EF PERFL++ +DYKGQDFEFIPFG GRR CPGIA
Sbjct  121  IPPKTIVYVNYWAIARDPEYWENPEEFIPERFLNSNIDYKGQDFEFIPFGAGRRGCPGIA  180

Query  315  LGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            LGVA+ EL L+NL+YAFDWELP  +KKEDIDT+V PG+TMHKK  LCLV K
Sbjct  181  LGVATLELILSNLVYAFDWELPCDMKKEDIDTDVLPGVTMHKKNALCLVPK  231



>gb|AIC74456.1| Cytochrome P450 CYPI [Withania somnifera]
Length=498

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 186/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P SM+GDI+D+L+ LK E S+ ++L  + IK +LM V VAGSDTSAA +VWAMTAL+K P
Sbjct  262  PTSMEGDIVDLLLQLKKEQSTPIDLALEDIKGILMDVLVAGSDTSAAAVVWAMTALIKNP  321

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M  VQ EIR  +G+KG + E+DIQ +PYFK VVKE  RLYPPVP+LV RE++    ++
Sbjct  322  EVMRTVQEEIRKSIGRKGIVTEDDIQNMPYFKLVVKEVFRLYPPVPLLVLRESMKKSKLE  381

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   ++ VNSWAIARDPE WENP EF PER L++ +DYKGQDFE IPFG GRRVCP
Sbjct  382  GYEIQAGTIIHVNSWAIARDPEIWENPEEFIPERLLNSDIDYKGQDFELIPFGAGRRVCP  441

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVAS ELAL+NLLYAFDWELP  +KKEDIDTNV PGITMHKK  LCL+ K
Sbjct  442  GIALGVASMELALSNLLYAFDWELPRGMKKEDIDTNVRPGITMHKKNELCLIPK  495



>ref|XP_009769777.1| PREDICTED: cytochrome P450 83B1-like isoform X1 [Nicotiana sylvestris]
Length=496

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK E S+ +N+T D+IKA+LM +FVAG+DT A  +VW MTAL+  P
Sbjct  260  PKSMEGDILDLLLQLKKEASTPINITLDNIKAILMNIFVAGTDTVAISLVWTMTALIMNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  VGKKG +NE+DIQ   Y KAV+KET RLYPP P LV RET+ N  ++
Sbjct  320  KAMKKVQEEIRKSVGKKGMVNEDDIQNFHYLKAVIKETFRLYPPAPTLVARETIQNSILE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I PK +V+VN WAIARDPE WENP EF PERFL++ +DYKGQDFEFIPFG GRR CP
Sbjct  380  GYKIPPKTIVYVNYWAIARDPEYWENPEEFIPERFLNSNIDYKGQDFEFIPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVA+ EL L+NL+YAFDWELP  +KKEDIDT+V PG+TMHKK  LCLV K
Sbjct  440  GIALGVATLELILSNLVYAFDWELPCDMKKEDIDTDVLPGVTMHKKNALCLVPK  493



>ref|XP_009618532.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=497

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK M+GDI+D+L+ LK E S+ ++LT + IK +LM V VAGSDTSAA  VWAMTAL+K P
Sbjct  261  PKYMEGDIVDLLLQLKKEQSTPIDLTLEDIKGILMNVLVAGSDTSAAATVWAMTALIKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQSEIR  +GKKG +NEED+Q +PY KAV+KE  RLYPPVP+LV RE++    ++
Sbjct  321  KTMKKVQSEIRKSIGKKGIVNEEDVQNMPYLKAVIKEIFRLYPPVPLLVPRESMEKIILE  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P  +V VN+WAIARDPE WENP EF PERFL++ +DYKG+DFE IPFG GRR CP
Sbjct  381  GYEIRPGTIVHVNAWAIARDPEIWENPEEFIPERFLNSNIDYKGKDFELIPFGAGRRGCP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVAS ELAL+NLLYAFDWELP  +KKEDIDTN  PGITMHKK  L L+ K
Sbjct  441  GIALGVASMELALSNLLYAFDWELPFGMKKEDIDTNARPGITMHKKNELYLIPK  494



>ref|XP_006358765.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=497

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 193/235 (82%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMD-GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKE  688
            PKSM+ GDI+D+L+ LK E S+ ++LT D+IKA++M + V G++TSAA I+WAMTAL+  
Sbjct  260  PKSMEEGDIIDLLLQLKKEKSTPIDLTLDNIKAIIMNMLVGGTNTSAATIIWAMTALIAN  319

Query  687  PRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            P  M  VQ+EIR+ VGKK  +NE+D+Q LPYFKAV+KETLRLYPP P+LV RET+ N  +
Sbjct  320  PNAMKKVQAEIRESVGKKSMVNEDDVQTLPYFKAVIKETLRLYPPAPLLVPRETMENSIL  379

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +GYEIKPK +++VN+WAIARDPE WENP EF PERFL++ +D+KGQ FE IPFG GRR C
Sbjct  380  EGYEIKPKTIIYVNAWAIARDPEIWENPEEFIPERFLNSDIDFKGQHFELIPFGAGRRGC  439

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            P +ALGVA+ EL L+NLLYAFDWELP  +K+EDIDT+V PG+TMHKK PLCLV +
Sbjct  440  PAMALGVANVELVLSNLLYAFDWELPCGMKREDIDTDVLPGLTMHKKKPLCLVPQ  494



>ref|XP_004247905.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=491

 Score =   331 bits (849),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 190/235 (81%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK E S+ ++LT + IK +LM V VAGSDTSAA++VWAMTAL+K P
Sbjct  255  PKSMEGDILDLLLQLKKEQSTPIDLTLEDIKGLLMNVLVAGSDTSAAVVVWAMTALIKNP  314

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            ++M  VQ EIR  +G KG +NE+DIQ + Y KAV+KET RLYPP P+L+ RE++   T++
Sbjct  315  KVMKKVQEEIRKSIGTKGVVNEDDIQNMSYLKAVIKETFRLYPPDPLLIPRESMKKSTLE  374

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+PK +V +N+WAIARDPE WENP EF PERFL++ VD+K +D+E IPFG GRR CP
Sbjct  375  GYEIQPKTIVHINAWAIARDPEIWENPKEFIPERFLNSDVDFKKEDYELIPFGAGRRGCP  434

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            GI LG+ + ELAL+NLLYAFDWELP  LKKEDIDTNV  GITMHKK  LCL++KK
Sbjct  435  GITLGITAIELALSNLLYAFDWELPYGLKKEDIDTNVRHGITMHKKNDLCLISKK  489



>ref|XP_006358769.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=495

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 188/235 (80%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+G+ILD+L+ LK E S+ ++LT + IKA++M V +AGS+TSAA ++W MTALMK P
Sbjct  259  PKSMEGNILDILLQLKKEKSTPIDLTMEDIKAIVMNVLLAGSETSAATVIWTMTALMKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  +G KG +NE+DIQ + YFKAV+KET RLYP VP L+ RE++   T++
Sbjct  319  KAMKKVQEEIRKSIGNKGIVNEDDIQNMSYFKAVIKETFRLYPSVPTLIPRESMKKSTLE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+PK +V VNSWAIARDPE WENP EF  ERFL++ +D+KGQDFE IPFG  RR CP
Sbjct  379  GYEIQPKTIVHVNSWAIARDPEIWENPEEFMSERFLNSDIDFKGQDFELIPFGARRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+ LG+AS ELAL+NLLY+FDWELP  +KKEDIDTNV PGITMHKK  LCL+ KK
Sbjct  439  GMTLGIASVELALSNLLYSFDWELPYGMKKEDIDTNVRPGITMHKKNVLCLIPKK  493



>ref|XP_009591953.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=288

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 187/235 (80%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK E S+ ++LT + IKA++M V +AGSDTSAA +VW MTALMK P
Sbjct  51   PKSMEGDILDILLQLKKEKSTPIDLTLEDIKALVMNVLLAGSDTSAAAVVWTMTALMKNP  110

Query  684  RIMNIVQSEIRDRVGKKGRI-NEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            + M  VQ EIR  VGKK  I  E+DIQ LPYFKAV+KE+ RLYPPVP+L+ RE++   T+
Sbjct  111  KAMKKVQEEIRKSVGKKSNIVTEDDIQNLPYFKAVIKESFRLYPPVPVLLPRESMEKSTL  170

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            + YEI+P  ++ VNSWAI RDPE WEN  +F  ERFL++ +D+KG DF++IPFG GRR C
Sbjct  171  EQYEIQPGTIIHVNSWAILRDPEIWENSEQFIAERFLNSNIDFKGHDFDYIPFGAGRRGC  230

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            PGIALGVAS ELAL+NLLYAFDWELP  +KKEDIDT+V PGITMHKK  LCL+ K
Sbjct  231  PGIALGVASMELALSNLLYAFDWELPCGMKKEDIDTDVKPGITMHKKNELCLIPK  285



>ref|XP_002280472.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
 emb|CAN64422.1| hypothetical protein VITISV_032274 [Vitis vinifera]
Length=498

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 185/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DI DVLI L+ +NS ++++TWDHIK VLM +FV G+DT AA ++WAMTALMK PR
Sbjct  263  KQEQEDITDVLIGLQKDNSFAIDITWDHIKGVLMNIFVGGTDTGAATVIWAMTALMKNPR  322

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M   Q E+R+  GKKG I E+D+++LPY KAVVKET+RL P VP+L+ RETL  C+IDG
Sbjct  323  VMKKAQEEVRNTFGKKGFIGEDDVEKLPYLKAVVKETMRLLPAVPLLIPRETLQKCSIDG  382

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI PK LVFVN+WAI RDPE WENP EF PERFL + VD++GQ+++ IPFG GRRVCPG
Sbjct  383  YEIPPKTLVFVNAWAIGRDPEAWENPEEFIPERFLGSSVDFRGQNYKLIPFGAGRRVCPG  442

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            I +G  + EL LANLLY+FDWE+P+ + KEDID +V PG+TMHKK  LCL+AKK
Sbjct  443  IHIGAVTVELTLANLLYSFDWEMPAGMNKEDIDFDVIPGLTMHKKNALCLMAKK  496



>ref|XP_009802554.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana sylvestris]
Length=495

 Score =   329 bits (844),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK E S+ ++LT + IK +LM V VAGSDTSAA  VWAMTAL+K P
Sbjct  259  PKSMEGDIVDLLLLLKKEQSTPIDLTMEDIKGLLMNVLVAGSDTSAAATVWAMTALIKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ+EIR  VGKKG +NEED+Q +PY KAV+KE  RLYPP P+LV RE++    I+
Sbjct  319  KAMEKVQTEIRKSVGKKGIVNEEDVQNMPYLKAVIKEIFRLYPPAPLLVPRESMEKTIIE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
             YEI P  +V+VN+WAIARDPE WEN  EF PERFL++ +DYKGQDFE +PFG GRR CP
Sbjct  379  AYEIWPGTIVYVNAWAIARDPEIWENSEEFIPERFLNSDIDYKGQDFELLPFGAGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVAS ELAL+NLLYAFDWELP  +KKEDIDT+V PGITMHKK  LCL+ K
Sbjct  439  GIALGVASMELALSNLLYAFDWELPYGVKKEDIDTHVRPGITMHKKNELCLIPK  492



>ref|XP_009622691.1| PREDICTED: cytochrome P450 83B1-like, partial [Nicotiana tomentosiformis]
Length=489

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 188/233 (81%), Gaps = 1/233 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+SM+GDILD+L+ L+ E S+ ++LT D+IKA+LM + V G+DT AA IVW MTAL+K P
Sbjct  252  PQSMEGDILDLLLQLRKEQSTPIDLTLDNIKAILMNILVGGTDTGAAAIVWGMTALIKNP  311

Query  684  RIMNIVQSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            + M  VQ+EIR+ VG KKG +NE+DIQ LPY KAV+KET RLYPPVP+LV RET+    +
Sbjct  312  KAMKQVQTEIRESVGSKKGMVNEDDIQNLPYLKAVIKETFRLYPPVPLLVPRETMHKSIL  371

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +GYEI+PK ++ VNSWAIARDPE WENP EF PERF ++ +D+KGQDFE +PFG GRR C
Sbjct  372  EGYEIQPKTIIHVNSWAIARDPEYWENPEEFIPERFFNSNIDFKGQDFELLPFGAGRRGC  431

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            PGIALGVA+ EL L+NLLYAFDWELP  +  +DIDT+V PG+TMHKK  LCLV
Sbjct  432  PGIALGVATVELVLSNLLYAFDWELPCGVNIQDIDTDVLPGLTMHKKNALCLV  484



>ref|XP_002278372.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=496

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI DVL+ L+ + SS+V+LTWDHIKA+ + +FVAG+DTSAA +VWAMT LMK P +M   
Sbjct  266  DITDVLLRLQKDRSSTVDLTWDHIKAMFVDIFVAGTDTSAATVVWAMTELMKNPIVMKKA  325

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R+ +GKKG ++E+D+Q+L Y KA+VKET+RL+P  P+LV RETL  C IDGYEI P
Sbjct  326  QEELRNLIGKKGFVDEDDLQKLSYLKALVKETMRLHPAAPLLVPRETLEKCVIDGYEIAP  385

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LVFVN+WAI RDPE WENP EF PERFL + +D+KGQD++ IPFGGGRRVCPG+ LG 
Sbjct  386  KTLVFVNAWAIGRDPEFWENPEEFMPERFLGSSIDFKGQDYQLIPFGGGRRVCPGLLLGA  445

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
               EL LANLLY+FDWE+P+ + KEDIDT+V PGITMHKK  LCL+A+
Sbjct  446  VMVELTLANLLYSFDWEMPAGMNKEDIDTDVKPGITMHKKNALCLLAR  493



>ref|XP_006367342.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=503

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 194/241 (80%), Gaps = 8/241 (3%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMEN--SSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMK  691
            PKSMDGDI+D+LI LK +N  SSS+NLTWDHIKAVLM +F+AG+DT+AA +VWAMTALMK
Sbjct  258  PKSMDGDIVDMLIVLKDQNLSSSSLNLTWDHIKAVLMDIFIAGTDTNAAALVWAMTALMK  317

Query  690  EP-RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNC  514
            E    M  +Q  IR+ VGKKGR++E+DIQ LPY +AV+KETLRLYPP P L+ RET+  C
Sbjct  318  EGGSAMRKLQEGIRELVGKKGRVDEDDIQNLPYLRAVIKETLRLYPPTP-LIPRETIEKC  376

Query  513  TIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERF--LDNK--VDYKGQDFEFIPFG  346
            +IDGYEIK    + +N+WAI RDPECWENP EF PERF  ++NK  +DYK  +FE IPFG
Sbjct  377  SIDGYEIKQNTPISINAWAIGRDPECWENPDEFIPERFCNVNNKDIIDYKSGEFEMIPFG  436

Query  345  GGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            GGRR CPGI+LGVA+ ELALANLLYAFDWEL   + KEDID +  PG+TMHKK PLCLVA
Sbjct  437  GGRRGCPGISLGVATVELALANLLYAFDWELSYGMVKEDIDIDTLPGMTMHKKNPLCLVA  496

Query  165  K  163
            K
Sbjct  497  K  497



>ref|XP_004228400.1| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=504

 Score =   327 bits (839),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 191/242 (79%), Gaps = 8/242 (3%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMEN--SSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMK  691
            PKSMDGDI+D+LI+L+ +N  SSS+NLTWDHIKAVLM +F+AG+DT+AA +VWAMTALMK
Sbjct  260  PKSMDGDIIDMLIALRDQNQSSSSLNLTWDHIKAVLMDIFIAGTDTNAAALVWAMTALMK  319

Query  690  EP-RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNC  514
            E       +Q  IR+ VGKKGR+ E+DIQ LPY +AV+KETL+LYPP P L+ RET+  C
Sbjct  320  EGGSARRKLQQGIRELVGKKGRVYEDDIQNLPYLRAVIKETLKLYPPAP-LIPRETMEKC  378

Query  513  TIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLD----NKVDYKGQDFEFIPFG  346
             IDGYEIK    V +N+WAI RDPECWENP EF PERF D      VDYK  +FE IPFG
Sbjct  379  IIDGYEIKQNTPVSINAWAIGRDPECWENPDEFIPERFCDVNNNGIVDYKSGEFEMIPFG  438

Query  345  GGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            GGRR CPGI+LGVA+ ELALANLLYAFDWELP  + KEDID +  PG+TMHKK PLCLVA
Sbjct  439  GGRRGCPGISLGVATVELALANLLYAFDWELPYGMVKEDIDIDTLPGMTMHKKNPLCLVA  498

Query  165  KK  160
            KK
Sbjct  499  KK  500



>emb|CDP16101.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 190/235 (81%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM  D+LD+LI LK E SS + L+WDHIKA+LM +F+AG+DT+AA I+WAMTALMK P
Sbjct  260  PKSMKDDLLDLLIQLKEEQSSIIGLSWDHIKAILMDIFIAGTDTAAAAIIWAMTALMKSP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              +  VQ+E+R  VG+KGR++EEDIQELPY KAV+KETLRLYPP P+L  RET   CTI+
Sbjct  320  SALKKVQAEVRKLVGEKGRVDEEDIQELPYLKAVIKETLRLYPPAPLLGPRETTQECTIE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEIK K LV++N+WAI RDPECW++P +F PERFL++ +D++GQDFE IPFG GRR CP
Sbjct  380  GYEIKYKTLVYINAWAIGRDPECWKSPDDFIPERFLNSNIDFRGQDFEMIPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G +LG+A+ ELALANLLY FDW+LP  +K ED+DT V PG+TMH K  L L AKK
Sbjct  440  GFSLGLATVELALANLLYHFDWKLPFGMKAEDVDTEVMPGLTMHPKNALSLFAKK  494



>emb|CDP16106.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   325 bits (834),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P++M  D+LD+LI +K E SS   LTWDHIKA+LM +F+AG+DTSAA +VWAMTALMK P
Sbjct  234  PETMKDDVLDILIQIKQEQSSGFELTWDHIKALLMNIFIAGTDTSAATVVWAMTALMKNP  293

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              +  VQ+EIRD VG+KG +  E +Q+L Y  AV+KE LRLYPP P+LV RET  +C I+
Sbjct  294  SALKKVQAEIRDLVGQKGAVVGEKLQQLRYLDAVIKEALRLYPPAPVLVARETTQSCNIE  353

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K LV++N WAI+RDPE WE P EF PERFL+N +D +G DFE IPFG GRR CP
Sbjct  354  GYEIGSKTLVYINDWAISRDPESWERPDEFIPERFLNNAIDVRGNDFEVIPFGAGRRGCP  413

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            GI LG+++ +LALANLLY+F+WELPS ++ EDIDT+V PGITMHKK  LC++AK+
Sbjct  414  GIHLGLSTVKLALANLLYSFEWELPSGIRAEDIDTDVLPGITMHKKNALCILAKE  468



>ref|XP_004247901.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=502

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 188/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK E S+ ++LT ++IKA++M + V G++TSAA +VWAMTAL+ +P
Sbjct  262  PKSMEGDIIDLLLELKKEKSTPIDLTLENIKAIIMNMLVGGTNTSAAAVVWAMTALISKP  321

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  VQ+EIR+ VGKK  +NE+DI+ LPYFKAV+KET RLYPP P+L+ RET+ N  ++
Sbjct  322  NAMKKVQAEIREMVGKKSIVNEDDIRNLPYFKAVIKETFRLYPPGPLLIARETMQNSILE  381

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEIK K +V VN WAIARDPE WENP EF PERFL++ +D KGQ+FE IPFG GRR CP
Sbjct  382  GYEIKAKTIVHVNIWAIARDPEIWENPEEFIPERFLNSDIDLKGQNFELIPFGAGRRGCP  441

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             +ALGVA+ EL L+NLLYAFDWELP  + K+DIDTNV PG+T HKK PLCLV +
Sbjct  442  AVALGVATVELVLSNLLYAFDWELPCGMNKDDIDTNVLPGLTRHKKQPLCLVPR  495



>ref|XP_002278300.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=495

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 184/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+    DI DVL+ L+     +++LT+DHIKAVLM +F+AG+DTSAA +VWAMT LMK P
Sbjct  258  PEPEKEDITDVLLKLQKNRLFTIDLTFDHIKAVLMNIFLAGTDTSAATLVWAMTMLMKNP  317

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            R M   Q E+R+ +GKKG ++E+D+Q+LPY KA+VKET+RL+P  P+LV RETL  C ID
Sbjct  318  RTMTKAQEELRNLIGKKGFVDEDDLQKLPYLKAIVKETMRLHPASPLLVPRETLEKCVID  377

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI PK LV+VN+WAI RDPE WENP EF PERFL   +D+KGQD++ IPFGGGRR+CP
Sbjct  378  GYEIPPKTLVYVNAWAIGRDPESWENPEEFMPERFLGTSIDFKGQDYQLIPFGGGRRICP  437

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ LG A  EL LANLLY+FDWE+P+ + KEDID +V PGITMHKK  LCL+A+
Sbjct  438  GLNLGAAMVELTLANLLYSFDWEMPAGMNKEDIDIDVKPGITMHKKNALCLLAR  491



>gb|ABC69410.1| CYP71AT2v3 [Nicotiana tabacum]
Length=492

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK M+GDI+D+L+ LK E  + ++LT + IK +LM V VAGSDTSAA  VWAMTAL+K P
Sbjct  256  PKYMEGDIVDLLLQLKKEKLTPLDLTMEDIKGILMNVLVAGSDTSAAATVWAMTALIKNP  315

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  VGKKG +NEED+Q +PYFKAV+KE  RLYPP P+LV RE++    ++
Sbjct  316  KAMEKVQLEIRKSVGKKGIVNEEDVQNIPYFKAVIKEIFRLYPPAPLLVPRESMEKTILE  375

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P+ +V VN+WAIARDPE WENP EF PERFL++ +DYKGQDFE +PFG GRR CP
Sbjct  376  GYEIRPRTIVHVNAWAIARDPEIWENPDEFIPERFLNSSIDYKGQDFELLPFGAGRRGCP  435

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVAS ELAL+NLLYAFDWELP  +KKEDIDTNV PGI MHKK  LCLV K
Sbjct  436  GIALGVASMELALSNLLYAFDWELPYGVKKEDIDTNVRPGIAMHKKNELCLVPK  489



>ref|XP_009591952.1| PREDICTED: cytochrome P450 83B1-like [Nicotiana tomentosiformis]
Length=497

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 187/235 (80%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK E S+ ++LT + IKA++M V +AGSDTSAA +VW MTALMK P
Sbjct  260  PKSMEGDILDILLQLKKEKSTPIDLTLEDIKALVMNVLLAGSDTSAAAVVWTMTALMKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRI-NEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            + M  VQ EIR  VGKK  I  E+DIQ LPYFKAV+KE+ RLYPPVP+L+ RE++   T+
Sbjct  320  KAMKKVQEEIRKSVGKKSNIVTEDDIQNLPYFKAVIKESFRLYPPVPVLLPRESMEKSTL  379

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            + YEI+P  ++ VNSWAI RDPE WEN  +F  ERFL++ +D+KG DF++IPFG GRR C
Sbjct  380  EQYEIQPGTIIHVNSWAILRDPEIWENSEQFIAERFLNSNIDFKGHDFDYIPFGAGRRGC  439

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            PGIALGVAS ELAL+NLLYAFDWELP  +KKEDIDT+V PGITMHKK  LCL+ K
Sbjct  440  PGIALGVASMELALSNLLYAFDWELPCGMKKEDIDTDVKPGITMHKKNELCLIPK  494



>ref|XP_004247907.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=496

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/234 (63%), Positives = 184/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILDVL+ LK E S+ ++LT + IKA++M V +AGS+TSAA +VW +TALMK P
Sbjct  260  PKSMEGDILDVLLQLKKEKSTPIDLTLEDIKAIVMNVLLAGSETSAAAVVWTITALMKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ E+R  +G KG +NE+DIQ LPYFKAV+ E  RLYPP P+L+ RET+   T++
Sbjct  320  KAMKKVQQELRKSIGNKGTVNEDDIQNLPYFKAVINEAFRLYPPAPLLIPRETMKKSTLE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P  +V VN+WAIARD + WEN  EF PERF ++ +D+KGQDFEFIPFG GRR CP
Sbjct  380  GYEIQPGTIVHVNAWAIARDSDVWENSEEFIPERFFNSDIDFKGQDFEFIPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GI LGVAS ELAL+NLLY+FDWELP  +KKEDIDT+  PG+ +HKK  LCLV K
Sbjct  440  GITLGVASMELALSNLLYSFDWELPYGMKKEDIDTDFKPGLAIHKKNDLCLVPK  493



>gb|ABC69409.1| CYP71AT2v2 [Nicotiana tabacum]
Length=495

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK M+GDI+D+L+ LK E  + ++LT + IK +LM V VAGSDTSAA  VWAMTAL+K P
Sbjct  259  PKYMEGDIVDLLLQLKKEKLTPLDLTMEDIKGILMNVLVAGSDTSAAATVWAMTALIKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  VGKKG +NEED+Q +PYFKAV+KE  RLYPP P+LV RE++    ++
Sbjct  319  KAMEKVQLEIRKSVGKKGIVNEEDVQNIPYFKAVIKEIFRLYPPAPLLVPRESMEKTILE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P+ +V VN+WAIARDPE WENP EF PERFL++ +DYKGQDFE +PFG GRR CP
Sbjct  379  GYEIRPRTIVHVNAWAIARDPEIWENPDEFIPERFLNSSIDYKGQDFELLPFGAGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVAS ELAL+NLLYAFDWELP  +KKEDIDTNV PGI MHKK  LCLV K
Sbjct  439  GIALGVASMELALSNLLYAFDWELPYGVKKEDIDTNVRPGIAMHKKNELCLVPK  492



>gb|ABC69408.1| CYP71AT2v1 [Nicotiana tabacum]
Length=495

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 186/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK M+GDI+D+L+ LK E  + ++LT + IK +LM V VAGSDTSAA  VWAMTAL+K P
Sbjct  259  PKYMEGDIVDLLLQLKKEKLTPLDLTMEDIKGILMNVLVAGSDTSAAATVWAMTALIKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  VGKKG +NEED+Q +PYFKAV+KE  RLYPP P+LV RE++    ++
Sbjct  319  KAMEKVQLEIRKSVGKKGIVNEEDVQNIPYFKAVIKEIFRLYPPAPLLVPRESMEKTILE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P+ +V VN+WAIARDPE WENP EF PERFL++  DYKGQDFE +PFG GRR CP
Sbjct  379  GYEIRPRTIVHVNAWAIARDPEIWENPDEFIPERFLNSSTDYKGQDFELLPFGAGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVAS ELAL+NLLYAFDWELP  +KKEDIDTNV PGI MHKK  LCLV K
Sbjct  439  GIALGVASMELALSNLLYAFDWELPYGVKKEDIDTNVRPGIAMHKKNELCLVPK  492



>ref|XP_006358810.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=495

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 184/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK E S  ++LT + IK +LM V VAG DTSAA IVW MTALMK P
Sbjct  259  PKSMEGDIVDLLLQLKKEKSIPIDLTLEDIKGLLMNVLVAGLDTSAAGIVWTMTALMKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  +G KG +NE+DIQ +PYFKAV+KE+ RLYPPVP+LV RE++   TI+
Sbjct  319  KAMKKVQEEIRKSIGNKGIVNEDDIQNMPYFKAVIKESFRLYPPVPLLVPRESMKKSTIE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   +V VNSWAIARDP  WEN  EF PERFL++ +DYKGQ++E IPFG GRR CP
Sbjct  379  GYEIQAGTIVHVNSWAIARDPGIWENSEEFIPERFLNSDIDYKGQNYELIPFGAGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GI LGVAS ELAL+NLLYAFDW+LP  +KKEDIDTNV PGITMHKK  L L+ K
Sbjct  439  GITLGVASIELALSNLLYAFDWKLPHGMKKEDIDTNVRPGITMHKKNDLWLIPK  492



>ref|XP_006358770.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=497

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 187/235 (80%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK +  + ++LT + IKA++M V +AGSDTSAA ++W MTALMK P
Sbjct  260  PKSMEGDILDLLLQLKRDKLTPIDLTLEDIKAIVMNVLLAGSDTSAAAVIWTMTALMKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRI-NEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            + M  VQ E+R    KK  I NE+DIQ LPYFKAV+KE+ RLYP VP+L+ RE++    +
Sbjct  320  KAMKKVQEEMRKSFKKKRDILNEDDIQNLPYFKAVIKESFRLYPSVPLLLPRESMEKSIL  379

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +GYEI+P  ++ VN+WAIARDPE WENP EF PERFL++ +D+KGQDFE IPFG GRR C
Sbjct  380  EGYEIQPGTIINVNAWAIARDPEIWENPEEFIPERFLNSDIDFKGQDFELIPFGAGRRGC  439

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            PGIALGVAS ELAL+NLLYAFDWELP  +KKEDIDTNV PGITMHKK  LCL+ K
Sbjct  440  PGIALGVASMELALSNLLYAFDWELPCGMKKEDIDTNVKPGITMHKKNDLCLIPK  494



>gb|EYU38763.1| hypothetical protein MIMGU_mgv1a004763mg [Erythranthe guttata]
Length=511

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 184/229 (80%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            +ILD+ I LK E SSS++LTWDH+KA +M +FVAG+DT AA I+W MTALM+ P+ M  +
Sbjct  275  NILDLFIQLKEEKSSSIDLTWDHVKATIMDIFVAGTDTGAATIIWTMTALMQNPKSMKKL  334

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q+EIRD +G KGR++E+D+  LPY KA VKE LRLYPP P+L+ RET+  C I+G+ I P
Sbjct  335  QNEIRDSIGGKGRVDEDDLHNLPYLKATVKEALRLYPPAPLLIPRETIEECEIEGHVIHP  394

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV++N+WAIARDP+ WE P EF PERFL++ VD  GQDF+ IPFG GRR CPGI++G+
Sbjct  395  KTLVYINAWAIARDPDHWERPDEFAPERFLNSSVDIVGQDFQVIPFGSGRRGCPGISMGL  454

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ ELA+ANL+Y+FDW LP  +KKEDIDT+V PG+TMHKK+PLCLV  K
Sbjct  455  ATVELAVANLVYSFDWGLPEGMKKEDIDTDVLPGVTMHKKVPLCLVPTK  503



>gb|KDO35932.1| hypothetical protein CISIN_1g048189mg, partial [Citrus sinensis]
Length=252

 Score =   313 bits (803),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ ++ +    V+LT DHIKAVLM VFVAG+DTSAA +VWAMT LMK PR M  V
Sbjct  21   DIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKV  80

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+LV RET+  C IDGYEI 
Sbjct  81   QQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIP  140

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LVFVN+WAI RDPE WENP EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG+ +G
Sbjct  141  AKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMG  200

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K +D+D +V PGITMHKK  L L+AK
Sbjct  201  IATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAK  249



>ref|XP_002280438.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=496

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 180/229 (79%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI DVLI L+ +N  ++++TWDHIK VLM +F+ G+DT AA + WAMTALMK PR+M   
Sbjct  266  DITDVLIGLRKDNDFAIDITWDHIKGVLMNIFLGGTDTGAATVTWAMTALMKNPRVMKKA  325

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R+  GKKG I E+D+++LPY KAVVKET+RL P VP+LV RETL  C++DGYEI P
Sbjct  326  QEEVRNTFGKKGFIGEDDVEKLPYLKAVVKETMRLLPSVPLLVPRETLQKCSLDGYEIPP  385

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LVFVN+WAI RDPE WENP EF PERFL + VD++GQ ++ IPFG GRRVCPG+ +GV
Sbjct  386  KTLVFVNAWAIGRDPEAWENPEEFMPERFLGSSVDFRGQHYKLIPFGAGRRVCPGLHIGV  445

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             + EL LANLL++FDWE+P+ + +EDID +  PGI MHKK  LCLVAKK
Sbjct  446  VTVELTLANLLHSFDWEMPAGMNEEDIDLDTIPGIAMHKKNALCLVAKK  494



>ref|XP_006358771.1| PREDICTED: cytochrome P450 83B1-like isoform X1 [Solanum tuberosum]
 ref|XP_006358772.1| PREDICTED: cytochrome P450 83B1-like isoform X2 [Solanum tuberosum]
Length=496

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 187/234 (80%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILDVL+ LK E S+ ++LT + IKA++M V +AGS+TSAA +VW MTAL+K P
Sbjct  260  PKSMEGDILDVLLQLKKEKSTPIDLTLEDIKAIVMNVLLAGSETSAAAVVWTMTALIKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR  +G KG +NE+DIQ +PYFKAV+KE  RLYP  P+L+ RET+   T++
Sbjct  320  KAMKKVQEEIRKSIGNKGIVNEDDIQNMPYFKAVIKEAFRLYPSSPLLLPRETMKKSTLE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   +V VN+WAIARD E W+N  EF PERFL++ +D+KGQDFEFIPFG GR+ CP
Sbjct  380  GYEIQRGTIVQVNAWAIARDSEIWKNSEEFIPERFLNSNIDFKGQDFEFIPFGAGRKGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ALGVAS ELAL+NLLY+FDWELP  +KKEDIDT+V PG+TMHKK  LCL+ K
Sbjct  440  GMALGVASVELALSNLLYSFDWELPFGMKKEDIDTDVKPGLTMHKKNDLCLIPK  493



>ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=494

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 181/228 (79%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI D+L+ L+ + S +V+LTWDHIKA+LM +F+AG+DTSAA +VWAMT LMK P +M   
Sbjct  264  DITDILLRLQKDRSFTVDLTWDHIKAILMDIFIAGTDTSAATLVWAMTELMKNPIVMKKA  323

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E R+ +GKKG ++E+D+Q L Y KA+VKET+RL+P  P+LV RET   C IDGYEI P
Sbjct  324  QEEFRNSIGKKGFVDEDDLQMLCYLKALVKETMRLHPAAPLLVPRETREKCVIDGYEIAP  383

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LVFVN+WAI RDPE WENP EF PERFL + +D+KGQD++FIPFGGGRR CPG  LGV
Sbjct  384  KTLVFVNAWAIGRDPEFWENPEEFMPERFLGSSIDFKGQDYQFIPFGGGRRACPGSLLGV  443

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
               EL LANLLY+FDWE+P+ + KEDIDT+V PGIT+HKK  LCL+A+
Sbjct  444  VMVELTLANLLYSFDWEMPAGMNKEDIDTDVKPGITVHKKNALCLLAR  491



>ref|XP_006358768.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=491

 Score =   321 bits (823),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ LK E S+ ++LT + IK +LM V VAGSDTSAA++VWAMTALMK P
Sbjct  255  PKSMEGDILDLLLQLKKEQSTPIDLTMEDIKGLLMNVLVAGSDTSAAVVVWAMTALMKNP  314

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            ++M  VQ EIR  +G KG +NE+DIQ + Y KAV+KET RLYPP P+L+ RE++   T++
Sbjct  315  KVMKKVQEEIRKSIGTKGIVNEDDIQNMSYLKAVIKETFRLYPPDPLLIPRESMKKSTLE  374

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   +V +N+WAIARDPE WENP EF PERFL++ +D+K +D++ IPFG GRR CP
Sbjct  375  GYEIQQGTIVHINAWAIARDPEIWENPKEFIPERFLNSDIDFKKEDYQLIPFGAGRRGCP  434

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            GI LG+ + ELAL+NLLYAFDWELP   KKEDIDTNV  GITMHKK  LCL+  K
Sbjct  435  GITLGITAIELALSNLLYAFDWELPYGSKKEDIDTNVRHGITMHKKNDLCLIPNK  489



>ref|XP_006367992.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=494

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 189/234 (81%), Gaps = 1/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK E S+ ++LT ++IKA++M + V G+DTSAA +VWAMTAL+ +P
Sbjct  261  PKSMEGDIIDLLLQLKKEKSTPIDLTLENIKAIIMNMLVGGTDTSAAAVVWAMTALIAKP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  VQ+EIR+ VGKK  +NEEDIQ LPYFKAV+KET RL+PP P+L+ RET+ N  ++
Sbjct  321  NAMKKVQAEIREIVGKKSIVNEEDIQNLPYFKAVIKETFRLFPPGPLLIARETMQNSILE  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  + ++ VN WAIARDPE WENP EF PERFL++ +D+KGQ+FE IPFG GRR CP
Sbjct  381  GYEIN-QNIIHVNVWAIARDPEIWENPEEFIPERFLNSDIDFKGQNFELIPFGSGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             +ALGVA+ EL L+NLLYAFDWELP  +KKEDIDT+V PG+ MHKK PLCLV +
Sbjct  440  AMALGVATVELVLSNLLYAFDWELPCGMKKEDIDTDVLPGLAMHKKEPLCLVPR  493



>emb|CBI19823.3| unnamed protein product [Vitis vinifera]
Length=912

 Score =   331 bits (848),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 185/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DI DVLI L+ +NS ++++TWDHIK VLM +FV G+DT AA ++WAMTALMK PR
Sbjct  677  KQEQEDITDVLIGLQKDNSFAIDITWDHIKGVLMNIFVGGTDTGAATVIWAMTALMKNPR  736

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M   Q E+R+  GKKG I E+D+++LPY KAVVKET+RL P VP+L+ RETL  C+IDG
Sbjct  737  VMKKAQEEVRNTFGKKGFIGEDDVEKLPYLKAVVKETMRLLPAVPLLIPRETLQKCSIDG  796

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI PK LVFVN+WAI RDPE WENP EF PERFL + VD++GQ+++ IPFG GRRVCPG
Sbjct  797  YEIPPKTLVFVNAWAIGRDPEAWENPEEFIPERFLGSSVDFRGQNYKLIPFGAGRRVCPG  856

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            I +G  + EL LANLLY+FDWE+P+ + KEDID +V PG+TMHKK  LCL+AKK
Sbjct  857  IHIGAVTVELTLANLLYSFDWEMPAGMNKEDIDFDVIPGLTMHKKNALCLMAKK  910


 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DI DVLI L+ +NS ++++TWDHIK VLM +FV G+D   A ++WAMTALMK PR
Sbjct  263  KQEQEDITDVLIELQKDNSFAIDITWDHIKGVLMNIFVGGTDAGTATVIWAMTALMKNPR  322

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M   Q E+R+  GKKG I E+D+++LPY KAVVKET+RL P  P+L+ RETL  C+IDG
Sbjct  323  VMKKAQEEVRNTFGKKGFIGEDDVEKLPYLKAVVKETMRLLPAAPLLLPRETLQKCSIDG  382

Query  501  YEIKPKMLV  475
            YEI PK L 
Sbjct  383  YEIPPKTLT  391



>ref|XP_004247900.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=498

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 190/235 (81%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMD-GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKE  688
            PKSM+ GDI+D+L+ LK + S+ ++LT D+IKA++M + V G++TSAA I+WAMT+L+  
Sbjct  261  PKSMEKGDIIDLLLQLKKDKSTPIDLTLDNIKAIIMNMLVGGTNTSAATIIWAMTSLIAN  320

Query  687  PRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            P  M  VQ EIR+ VGKK  ++E+D+Q LPYFKAV+KET RLYPP P+LV RET+ N  +
Sbjct  321  PNAMKKVQEEIRESVGKKSIVSEDDVQNLPYFKAVIKETFRLYPPAPLLVPRETMRNSVL  380

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +GYEIK K +++VN+WAIARDPE WENP +F PERFL++ +D+KGQ+FE IPFG GRR C
Sbjct  381  EGYEIKAKSIIYVNAWAIARDPEIWENPEKFIPERFLNSDIDFKGQNFELIPFGAGRRGC  440

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            P + +GVA+ EL L+NLLYAFDWELP  +K+EDIDT+V PG+TMHKK PLCLV +
Sbjct  441  PAMTVGVATVELVLSNLLYAFDWELPCGMKREDIDTHVLPGLTMHKKKPLCLVPR  495



>ref|XP_004247904.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=496

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 183/232 (79%), Gaps = 0/232 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GD++D+L+  K E S  ++LT + IK +LM V VAGSDTSAA +VW MTALMK P
Sbjct  260  PKSMEGDMVDLLLQFKKEKSIPIDLTLEDIKGLLMNVLVAGSDTSAAGVVWTMTALMKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR+ +G KG +NE+D+Q +PYFKAV+KET RLYPP+P+LV RE++ N T++
Sbjct  320  KAMKKVQQEIRESIGNKGIVNEDDVQNMPYFKAVIKETFRLYPPIPLLVPRESMKNSTLE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   +V VNSWAIARDPE WENP EF PERFL++ +DYKGQ++E IPFG GRR CP
Sbjct  380  GYEIQAGTIVHVNSWAIARDPEIWENPEEFIPERFLNSDIDYKGQNYELIPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G  LGVA  ELAL+NLLYAFDWE P  +KKEDIDTNV  GIT +KK  LCL+
Sbjct  440  GKTLGVAFMELALSNLLYAFDWESPHGMKKEDIDTNVRRGITPYKKNELCLI  491



>ref|XP_006358824.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=494

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 188/235 (80%), Gaps = 5/235 (2%)
 Frame = -1

Query  864  PKSMD-GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKE  688
            PKSM+ GDI+D+L+ LK E S+  +LT D+IK +L    VAG+DTSAA ++WAMTALM  
Sbjct  261  PKSMEEGDIIDLLLQLKKEKSTPSDLTLDNIKNML----VAGTDTSAATVIWAMTALMAN  316

Query  687  PRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            P  MN VQ+EIR+ VG+K  +NE+++Q LPYFKAV+KET RLYP VP+LV RET+ N  +
Sbjct  317  PNSMNKVQAEIRESVGEKSIVNEDNVQNLPYFKAVIKETFRLYPAVPLLVARETMQNSIL  376

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +GYEIKPK +V+VN+WAI RDPE W+NP EF PERFL+N +D+KGQDFE IPFG GRR C
Sbjct  377  EGYEIKPKTIVYVNAWAIGRDPEIWKNPEEFIPERFLNNDIDFKGQDFELIPFGAGRRGC  436

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            PGIALGVA+ EL L+NLLYAFDWELP  +K +DIDT+V PGI  HKK PLCLV +
Sbjct  437  PGIALGVANVELVLSNLLYAFDWELPRGMKIKDIDTDVLPGIIPHKKKPLCLVPR  491



>ref|XP_004247902.2| PREDICTED: cytochrome P450 71A1-like [Solanum lycopersicum]
Length=497

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 181/234 (77%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GD++D+L+ L+ E S+ ++LT D+IKA+LM +F+AG+DTSA  ++WAMTALMK P
Sbjct  261  PKSMEGDMIDILLQLRKEQSTQIHLTLDNIKAILMNLFLAGTDTSAITVIWAMTALMKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ E+R  +GKKG +NE+D Q + Y KAV+KET RLYPP PILV RET+ N  + 
Sbjct  321  KAMKKVQEEVRKTMGKKGIVNEDDTQNMSYLKAVIKETFRLYPPAPILVARETMQNSILA  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY I PK  + VN WAIARDPE WEN  EF PERFL+N +D+KGQD+EFIPFG GRR CP
Sbjct  381  GYNIPPKTTIRVNYWAIARDPEYWENSEEFIPERFLNNNIDFKGQDYEFIPFGAGRRGCP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ALGVA+ EL L+NLLYAFDWELP  +  EDIDT    GITMHKK  LC+V K
Sbjct  441  GLALGVATVELILSNLLYAFDWELPFGMNIEDIDTESLRGITMHKKNDLCIVPK  494



>emb|CDP16099.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 187/237 (79%), Gaps = 1/237 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+SM+GDI+D+++ L+ + S+S +LT DHIKA+LM VF AGSDT+AA I+WAM ALMK P
Sbjct  264  PESMNGDIIDIMLQLRQQQSTSFDLTQDHIKAMLMDVFSAGSDTTAATIIWAMAALMKSP  323

Query  684  R-IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
              I+   Q+EIR  +G K  +NE+DIQ+LPY KA+VKET RLYPP P+LV R+TL+NC I
Sbjct  324  EAILKKAQAEIRGALGNKDIVNEDDIQKLPYLKAIVKETFRLYPPTPLLVPRQTLANCII  383

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +G+EI+   +V+ N WAI RDP+ WENP+EF PERFL++ VD KG+DF+ IPFG GRR C
Sbjct  384  NGHEIQSNSIVYTNVWAIGRDPDNWENPNEFLPERFLNSSVDMKGKDFQLIPFGAGRRGC  443

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            PG +LG+A  E+ LANLLY+FDWELPS +KKEDIDT V PG+TM KK  L LVAK V
Sbjct  444  PGYSLGLAMVEVGLANLLYSFDWELPSGIKKEDIDTEVLPGLTMLKKNDLLLVAKNV  500



>gb|KHN19810.1| Cytochrome P450 83B1 [Glycine soja]
Length=412

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 185/229 (81%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D L+ LK + S S++LT  HIK ++M + +AG+DTSAA +VWAMTALMK PR+M   
Sbjct  182  DIIDALLQLKDDPSFSMDLTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPRVMKKA  241

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+  G+K  I E+DIQ+LPY KAV+KET+R+YPP+P+L+ RET+  C+I+GYEI  
Sbjct  242  QEEIRNVFGEKDFIGEDDIQKLPYLKAVIKETMRMYPPLPLLIHRETIKKCSIEGYEIPE  301

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WA+ RDPE W+ P EFYPERFLD+K+D++G DFEFIPFG GRR+CPGI +G+
Sbjct  302  KTLVYVNAWAVHRDPETWKKPEEFYPERFLDSKIDFRGYDFEFIPFGTGRRICPGINMGI  361

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             + EL LANLLY+FDWE+P  ++++DIDT++ PG+  HKK PLCLVAKK
Sbjct  362  ITVELVLANLLYSFDWEMPQGMERKDIDTDMLPGLVQHKKNPLCLVAKK  410



>ref|XP_006358825.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=518

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 183/224 (82%), Gaps = 0/224 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK    + ++LT D+IKA+LM +FV G+DTSAA +VWAMTAL+K P
Sbjct  259  PKSMEGDIIDLLLQLKKAQLTPIDLTLDNIKAILMNIFVGGTDTSAATVVWAMTALIKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            ++M  VQ EIR  +G KG +NE+D+Q +PY KAV+KET RLYPP P+LV RET+   T++
Sbjct  319  KVMKKVQEEIRKSIGTKGFVNEDDVQNMPYLKAVIKETFRLYPPAPLLVPRETMKKSTLE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P  ++ VNSWAIARDPE WENP EF PERFL++ +D+KGQDFE +PFG GRR CP
Sbjct  379  GYEIQPGTIIHVNSWAIARDPEIWENPKEFMPERFLNSDIDFKGQDFELLPFGAGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMH  193
            GIALGVA+ +L L+NLLYAFDWELP  +KKEDIDT+V PGITMH
Sbjct  439  GIALGVATVDLMLSNLLYAFDWELPYGMKKEDIDTDVMPGITMH  482



>gb|AJD25156.1| cytochrome P450 CYP71AT92 [Salvia miltiorrhiza]
Length=506

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 187/231 (81%), Gaps = 0/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + DILDVLI +K E  SS++  WD +KA+L  +F+A +DTSAA  VW MTAL+K P++M 
Sbjct  273  EDDILDVLIKIKEEKLSSIDFDWDRVKALLADIFIAATDTSAASSVWTMTALIKAPKVMQ  332

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ+EIR+ VGKKG+++E+D   LPY KAV+KET RLYPP P+LV R+T+  CT++GYEI
Sbjct  333  KVQAEIRNLVGKKGKVDEDDFVNLPYLKAVIKETFRLYPPAPLLVPRQTIEKCTLEGYEI  392

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            +P+ +V+VN+WAIARDPE WENP EF PERFL++ +D KG+DFE IPFG GRR+CPG+ +
Sbjct  393  QPETVVYVNAWAIARDPEYWENPDEFVPERFLNSNIDVKGKDFELIPFGSGRRICPGMLM  452

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+++ EL +ANLLY+FDWELP+ ++ EDIDT+  PGITMHKK PL LVAKK
Sbjct  453  GLSNVELTVANLLYSFDWELPAGIRAEDIDTDPLPGITMHKKNPLLLVAKK  503



>ref|XP_004249946.1| PREDICTED: cytochrome P450 83B1-like [Solanum lycopersicum]
Length=497

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/235 (61%), Positives = 189/235 (80%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GD +D+L+ LK +  + ++L+ + IK +LM V +AGSDTS+++I+WAMT L+K P
Sbjct  261  PKSMEGDFIDILLQLKKDQLTPIDLSLEDIKGILMNVLLAGSDTSSSVIIWAMTILIKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + M  VQ EIR+ +G KG +NE+DIQ + Y KAV+KETLRL+PP P+L+ RE++   T++
Sbjct  321  KAMKKVQEEIRNLIGNKGIVNEDDIQNMHYLKAVIKETLRLFPPAPLLIPRESMKISTLE  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYE +P+ +V+VN+WAIARDPE WENP EF PERFL++ +D+KGQD+E IPFG GRR CP
Sbjct  381  GYEFQPRTIVYVNAWAIARDPEIWENPEEFMPERFLNSNIDFKGQDYELIPFGAGRRGCP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+ALGVAS ELAL+NLLYAFDWELP  LKKEDID N  PGIT++KK  LCL+ KK
Sbjct  441  GLALGVASVELALSNLLYAFDWELPYGLKKEDIDINGKPGITVNKKNDLCLIPKK  495



>ref|XP_003551894.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=501

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 185/229 (81%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D L+ LK + S S++LT  HIK ++M + +AG+DTSAA +VWAMTALMK PR+M   
Sbjct  271  DIIDALLQLKDDPSFSMDLTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPRVMKKA  330

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+  G+K  I E+DIQ+LPY KAV+KET+R+YPP+P+L+ RET+  C+I+GYEI  
Sbjct  331  QEEIRNVFGEKDFIGEDDIQKLPYLKAVIKETMRMYPPLPLLIHRETIKKCSIEGYEIPE  390

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WA+ RDPE W+ P EFYPERFLD+K+D++G DFEFIPFG GRR+CPGI +G+
Sbjct  391  KTLVYVNAWAVHRDPETWKKPEEFYPERFLDSKIDFRGYDFEFIPFGTGRRICPGINMGI  450

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             + EL LANLLY+FDWE+P  ++++DIDT++ PG+  HKK PLCLVAKK
Sbjct  451  ITVELVLANLLYSFDWEMPQGMERKDIDTDMLPGLVQHKKNPLCLVAKK  499



>emb|CDP16103.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 186/233 (80%), Gaps = 0/233 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSMDGDI+D+++ L+ + S+S  +T DHIKA+LM VF+AG+D SA  ++WAMTA++K P
Sbjct  264  PKSMDGDIIDLMLQLQHDGSTSFEITMDHIKAMLMNVFIAGTDRSAVTVIWAMTAMIKIP  323

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             ++  +Q+EIR+ +GKK  ++E+D+Q LPY KAVVKET RLYP VP+LV RET+  CTID
Sbjct  324  TVLKKLQAEIREIMGKKQMLDEDDVQMLPYLKAVVKETFRLYPAVPLLVPRETMGKCTID  383

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+PK LV+VN+W IARDPE W NP EF PERFL++ +D KGQDF   PFG GRR CP
Sbjct  384  GYEIQPKTLVYVNAWGIARDPEYWGNPDEFLPERFLNSTIDLKGQDFHLTPFGAGRRGCP  443

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            G ++G+A+ EL LAN+L++FDWELP  +KKEDIDT+  PGITM+KK  L LVA
Sbjct  444  GYSMGLATVELVLANILHSFDWELPPGVKKEDIDTDALPGITMNKKTDLRLVA  496



>ref|XP_006365688.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=495

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 191/235 (81%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P SM+GDI+D+L+ LK E  + ++L+ + IK +LM V +AGSDTSA++I+WAMT L+K P
Sbjct  259  PNSMEGDIIDLLLQLKKEKLTPIDLSLEDIKGILMNVLLAGSDTSASVIIWAMTILIKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            + +  VQ EIR+ +G KG +NE+DIQ +PYFKAV+KETLRL+PP P+L+ RE++   T++
Sbjct  319  KAVKRVQEEIRNLIGNKGIVNEDDIQNMPYFKAVIKETLRLFPPAPLLIPRESMKISTLE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYE +P+ +V+VN+WAIARDPE WENP EF PERFL++ +D+KGQD+EFIPFG GRR CP
Sbjct  379  GYEFQPRTIVYVNAWAIARDPEIWENPEEFMPERFLNSDIDFKGQDYEFIPFGAGRRRCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             +ALGVAS ELAL+NLLYAFDWELP  LKKEDID N  PGITM+KK  LCL+ KK
Sbjct  439  AMALGVASVELALSNLLYAFDWELPYGLKKEDIDINGRPGITMNKKNDLCLIPKK  493



>ref|XP_011091358.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=501

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 186/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+SM+GDILD+LI +K + SS+V + WDHIK VLM +FVAG+DT+AA I WAMTAL+K+P
Sbjct  265  PESMNGDILDMLIQMKEDRSSTVQIDWDHIKGVLMNMFVAGTDTTAATITWAMTALIKKP  324

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            +++N VQ EIR  VGKKG + E+DIQ+LPYFKAVVKETLRLY P P+ + R T+ +  ID
Sbjct  325  QVLNKVQQEIRSVVGKKGSVAEDDIQKLPYFKAVVKETLRLYAPAPLSLPRLTIKSSVID  384

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I+P  +V+VN WAI+RD + WENP EF PERFL++ VD+KGQDF F+PFG GRRVCP
Sbjct  385  GYDIEPNTIVYVNVWAISRDKDFWENPDEFLPERFLNSSVDFKGQDFGFLPFGSGRRVCP  444

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ALG A  E++LAN+LY F WELP  + ++D+D +  PGIT HKK  L L+AK
Sbjct  445  GMALGTAEVEVSLANILYCFHWELPPGMVEDDVDMDFLPGITTHKKNALYLMAK  498



>ref|XP_011091673.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=465

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 180/234 (77%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+SM+GDILD+LI LK + SSS+ + W+H+K VL+ +FVAG++TSA  I WAMTAL+K+P
Sbjct  229  PESMNGDILDLLIQLKEDRSSSIQINWEHVKGVLLDIFVAGTETSATTITWAMTALIKKP  288

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            +++N VQ EIR  V +KG + EEDI +LPY KAVVKETLRLYPP P+ + R T     ID
Sbjct  289  QVLNKVQQEIRTLVREKGSVAEEDILKLPYLKAVVKETLRLYPPSPLALPRLTTKTSIID  348

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P  +V+VN W IARDP  WENP EF PERFL++ VDYKGQDFEF+PFG GRRVCP
Sbjct  349  GYEIEPNTIVYVNVWKIARDPNFWENPDEFLPERFLNSNVDYKGQDFEFLPFGSGRRVCP  408

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ LG A  E  LANLLY+F+WELP  + ++D+D +  PG+   KK PLCL+AK
Sbjct  409  GMTLGTAEVEAVLANLLYSFNWELPPGMVEDDVDMDFVPGLVTQKKNPLCLMAK  462



>ref|XP_006443324.1| hypothetical protein CICLE_v10023683mg [Citrus clementina]
 gb|ESR56564.1| hypothetical protein CICLE_v10023683mg [Citrus clementina]
Length=468

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++ +    V+LT DHIKAVLM V VAG+DTSAA +VWAMT LMK PR M  V
Sbjct  234  DIIDVLLQIRKDRGFKVDLTLDHIKAVLMNVLVAGTDTSAATVVWAMTYLMKNPRAMKKV  293

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+LV RET+  C IDGYEI 
Sbjct  294  QQEIRLLIGANKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIP  353

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LVFVN+WAI RDPE WENP EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG+ +G
Sbjct  354  AKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSIIDFKGQHFELIPFGAGRRICPGLNMG  413

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K +D+D +V PGITMHKK  L L+AK
Sbjct  414  IATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAK  462



>ref|XP_006445533.1| hypothetical protein CICLE_v10004104mg [Citrus clementina]
 gb|ESR58773.1| hypothetical protein CICLE_v10004104mg [Citrus clementina]
Length=507

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ ++ +    V+LT DHIKAVLM VFVAG+DT AA +VWAMT LMK PR M  V
Sbjct  276  DIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTRAATVVWAMTYLMKNPRAMKKV  335

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+LV RET+  C IDGYEI 
Sbjct  336  QQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLVPRETIEKCVIDGYEIP  395

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LVFVN+WAI RDPE WENP EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG+ +G
Sbjct  396  AKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSFIDFKGQHFELIPFGAGRRICPGLNMG  455

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K +D+D +V PGITMHKK  L L+AK
Sbjct  456  IATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAK  504



>ref|XP_010671012.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 182/235 (77%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P S  GDI+DVL+ L+ + + +  LT DHIKA+L+ +FVAG+DTSAA++VWAMT L+K P
Sbjct  259  PTSQQGDIIDVLLHLRKQRTFTFELTIDHIKALLLNIFVAGTDTSAAMVVWAMTELIKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M  VQ EIR+  G KG +  ED+ +L Y KAV+KETLR  P  P+L+ RETL  C+I+
Sbjct  319  TVMKKVQEEIRNSAGNKGYVTVEDLTKLEYLKAVIKETLRFRPAAPVLLVRETLKKCSIE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I PK LVFVN W I RDPE W +P  F PERFL + +D+KGQDFEF+PFG GR++CP
Sbjct  379  GYDILPKTLVFVNIWTIGRDPEFWIDPDIFKPERFLGSSIDFKGQDFEFLPFGAGRKMCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+ LGVA+ ELALANLLY+F+WELP+ +K EDIDT+  PG+TMHKK PLCLVA+K
Sbjct  439  GMLLGVANFELALANLLYSFEWELPAGMKMEDIDTDTLPGVTMHKKNPLCLVARK  493



>ref|XP_006445535.1| hypothetical protein CICLE_v10004103mg [Citrus clementina]
 gb|ESR58775.1| hypothetical protein CICLE_v10004103mg [Citrus clementina]
Length=507

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ ++ +    V+LT DHIKAVLM VFVAG+DT AA +VWAMT LMK PR M  V
Sbjct  276  DIIDILLQIRKDRGFKVDLTLDHIKAVLMNVFVAGTDTRAATVVWAMTYLMKNPRAMKKV  335

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RET+  C IDGYEI 
Sbjct  336  QQEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLIPRETIQKCVIDGYEIP  395

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LVFVN+WAI RDPE WENP EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG+ +G
Sbjct  396  AKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMG  455

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K +D+D +V PGITMHKK  L L+AK
Sbjct  456  IATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAK  504



>ref|XP_006358823.1| PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum]
Length=498

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 179/234 (76%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ L+ E S+S++LT D+IK +LM +   G+DT+A  ++W+MTALMK P
Sbjct  260  PKSMEGDIIDLLLQLRKEQSTSIDLTLDNIKGILMDILTGGTDTNAVAVIWSMTALMKNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M  VQ EIR  +  KG +NE+DIQ +PYF AV+KE  RLYPP P+LV RE +    ++
Sbjct  320  EVMKKVQEEIRKSIRIKGIVNEDDIQNMPYFNAVIKEIFRLYPPAPLLVPREAMEKSILE  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P  ++ VNSWAIARDPE WENP EF PERFL+  +D+KGQ+FE IPFG GRR CP
Sbjct  380  GYEIQPGTIIHVNSWAIARDPEIWENPEEFIPERFLNCDIDFKGQNFELIPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALGVA+  L L+NLLYAFDWELP  + KEDIDT+  PG+ MHKK  LCLV K
Sbjct  440  GIALGVATINLILSNLLYAFDWELPHGMIKEDIDTDGLPGLAMHKKNALCLVPK  493



>gb|KHN02071.1| Cytochrome P450 83B1 [Glycine soja]
Length=497

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 183/231 (79%), Gaps = 0/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + DI+D L+ LK + S S++LT  HIK ++M + +AG+DTSAA +VWAMTALMK P +M 
Sbjct  265  EQDIIDALLQLKNDRSFSMDLTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPIVMK  324

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EIR+  G K  I E+DIQ+LPY +AV+KET+R+YPP+P+L++RET+  C+I GYEI
Sbjct  325  KAQEEIRNIFGGKDFIEEDDIQKLPYVQAVIKETMRIYPPLPLLLQRETIKKCSIAGYEI  384

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K LV+VN+WA+ RDPE WE P EFYPERFLD+K+D++G DFE IPFG GRR+CPGI +
Sbjct  385  PEKTLVYVNAWAVHRDPETWEEPEEFYPERFLDSKIDFRGYDFELIPFGAGRRICPGINM  444

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+ + EL LANLLY+FDWE+P  +K+EDIDT++ PG+  HKK PLCLVAKK
Sbjct  445  GIITVELVLANLLYSFDWEMPQGMKREDIDTDMLPGLIQHKKNPLCLVAKK  495



>ref|XP_003516815.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=501

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 183/231 (79%), Gaps = 0/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + DI+D L+ LK + S S++LT  HIK ++M + +AG+DTSAA +VWAMTALMK P +M 
Sbjct  269  EQDIIDALLQLKNDRSFSMDLTPAHIKPLMMNIILAGTDTSAAAVVWAMTALMKSPIVMK  328

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EIR+  G K  I E+DIQ+LPY +AV+KET+R+YPP+P+L++RET+  C+I GYEI
Sbjct  329  KAQEEIRNIFGGKDFIEEDDIQKLPYVQAVIKETMRIYPPLPLLLQRETIKKCSIAGYEI  388

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K LV+VN+WA+ RDPE WE P EFYPERFLD+K+D++G DFE IPFG GRR+CPGI +
Sbjct  389  PEKTLVYVNAWAVHRDPETWEEPEEFYPERFLDSKIDFRGYDFELIPFGAGRRICPGINM  448

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+ + EL LANLLY+FDWE+P  +K+EDIDT++ PG+  HKK PLCLVAKK
Sbjct  449  GIITVELVLANLLYSFDWEMPQGMKREDIDTDMLPGLIQHKKNPLCLVAKK  499



>gb|AES59645.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=514

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 183/230 (80%), Gaps = 1/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ +  ++S S +LT DHIKAVLM +F+AG+DTS+A++VWAMT LM  PR+MN V
Sbjct  282  DIIDILLQMMNDHSLSFDLTLDHIKAVLMNIFIAGTDTSSAIVVWAMTTLMNNPRVMNKV  341

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+    K  INE+DI++LPY KAVVKET+RL+PP P+LV RET+ NC IDGYEIKP
Sbjct  342  QMEIRNLYEDKYFINEDDIEKLPYLKAVVKETMRLFPPSPLLVPRETIENCNIDGYEIKP  401

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDPE W++P EFYPERF+ + VD+KG++FE IPFG GRR+CP + +GV
Sbjct  402  KTLVYVNAWAIGRDPENWKDPEEFYPERFIMSSVDFKGKNFELIPFGSGRRMCPAMNMGV  461

Query  306  ASAELALANLLYAFDWELPSWLKKEDI-DTNVSPGITMHKKIPLCLVAKK  160
             + EL LANLL++FDW+LP    KE + DT V PGITMHKKI LCL  +K
Sbjct  462  VTVELTLANLLHSFDWKLPHGFDKEQVLDTKVKPGITMHKKIDLCLFPRK  511



>emb|CDP16102.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   311 bits (796),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 185/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSMDGDI+D+++ L+ + S+S  +T DHIKA+LM VF A +DTS   ++WAMTA+M++P
Sbjct  264  PKSMDGDIIDLMLQLQQDGSTSFEITMDHIKAMLMNVFFAATDTSTVTVIWAMTAMMQKP  323

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M  +Q+EIR+ +GKK  ++E+D+Q LPY KAVVKET RLY  VP+LV RET+  CTID
Sbjct  324  TVMKKLQAEIREIMGKKQMLDEDDVQMLPYLKAVVKETFRLYLAVPLLVPRETIGKCTID  383

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I+PK LV+VN+W IARDPE WENP EF PERFL++ VD +GQDF+ IPFG GRR CP
Sbjct  384  GYDIQPKTLVYVNAWGIARDPEYWENPDEFLPERFLNSSVDVRGQDFQLIPFGAGRRGCP  443

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G  +G+ + EL LAN+L++FDWELP  +KKEDIDT+  PG+TM+KK  L LV K
Sbjct  444  GYPMGLVTVELVLANILHSFDWELPPGMKKEDIDTDALPGLTMNKKNDLWLVTK  497



>ref|XP_006479041.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
Length=507

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ ++ +    V+LT DHIKAVLM V VAG+DTSAA +VWAMT LMK PR M  V
Sbjct  276  DIIDILLQIRKDRGFKVDLTLDHIKAVLMNVLVAGTDTSAATVVWAMTYLMKNPRAMKKV  335

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RET+  C IDGYEI 
Sbjct  336  QLEIRSLIGCNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLIPRETIQKCVIDGYEIP  395

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LVFVN+WAI RDPE WENP EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG+ +G
Sbjct  396  AKTLVFVNAWAIGRDPEAWENPEEFYPERFVDSCIDFKGQHFELIPFGAGRRICPGLNMG  455

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K +D+D +V PGITMHKK  L L+AK
Sbjct  456  IATVDLALANLLYKFDWEMPPGMKSQDLDFDVLPGITMHKKNALSLLAK  504



>ref|XP_007146429.1| hypothetical protein PHAVU_006G039800g [Phaseolus vulgaris]
 gb|ESW18423.1| hypothetical protein PHAVU_006G039800g [Phaseolus vulgaris]
Length=500

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 178/228 (78%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D L+ LK + S S++LT  HIK ++M V +AGSDT AA +VWAMTALMK PR+M   
Sbjct  270  DIIDALLQLKNDPSFSMDLTPAHIKPLMMNVILAGSDTIAAAVVWAMTALMKNPRVMKKA  329

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+  G K  I EE+I++LPY KAV+KETLRLYPPVP+LV+RET+  C+I+GYEI  
Sbjct  330  QEEIRNVFGGKDMIEEEEIEKLPYLKAVIKETLRLYPPVPLLVQRETIKECSIEGYEIPE  389

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WA+ RDPE W +P EFYPERFLD+KVD++G D E IPFG GRRVCPGI +G+
Sbjct  390  KTLVYVNAWAVHRDPETWNDPEEFYPERFLDSKVDFRGYDMELIPFGAGRRVCPGIHMGI  449

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             + EL LANLLY+FDWEL   + +EDIDT++ PGI  HKK PLCLV K
Sbjct  450  ITMELVLANLLYSFDWELSEGITREDIDTDMLPGIVQHKKTPLCLVPK  497



>ref|XP_007017736.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14961.1| Cytochrome P450 [Theobroma cacao]
Length=500

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 177/230 (77%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ +  +   ++NLT DHIKAVLM VF+AG+DTSAA ++W MT LMK PR M  V
Sbjct  269  DIVDVLLQIWKDRDFAINLTMDHIKAVLMDVFIAGTDTSAATVIWVMTFLMKNPRCMKKV  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  +GKK  ++E+D Q L Y KAV+KET RL P VP+LV RET+  C+I GY+I  
Sbjct  329  QEEVRSLIGKKDFVSEDDAQGLTYLKAVIKETFRLQPIVPLLVPRETMRKCSIGGYDIPA  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WA+ RDPE WENP EFYPERF+ + +DYKG DFE IPFG GRR CPGI +GV
Sbjct  389  KTLVYVNAWAVGRDPEAWENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGIHMGV  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
             + ELALANLLY FDWE+P+ + KED+D +V PGIT HKKI LCLVAK++
Sbjct  449  VTVELALANLLYKFDWEMPTGMNKEDLDFDVIPGITTHKKIALCLVAKEI  498



>ref|XP_011091688.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=502

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 181/234 (77%), Gaps = 1/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+SM+GDILD+LI L+ + SSSV + WDHIK VLM VFV G++TSA  I WAM A++K+P
Sbjct  267  PESMNGDILDLLIQLREDRSSSVQIGWDHIKGVLMNVFVGGTETSAVTITWAMAAMIKKP  326

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            +++  VQ EIR  V KKG I+E+DI  L YFKAVVKETLRLYPP P L  R T   C +D
Sbjct  327  KVLKKVQQEIRTLVEKKGSIDEDDIHTLAYFKAVVKETLRLYPPAP-LSARVTTKACVVD  385

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY ++P  +V+VN WAI RD   WENP+EF PERFL++ VD+KGQDF F+PFG GRRVCP
Sbjct  386  GYHVEPDTIVYVNLWAIGRDRNFWENPYEFLPERFLNSDVDFKGQDFGFLPFGTGRRVCP  445

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ALG+A  ELALANLLY+FDWELP+ + ++D+D + SPG+  HKK PL L+AK
Sbjct  446  GMALGIAEVELALANLLYSFDWELPAGMVEDDVDMDSSPGVVTHKKNPLWLMAK  499



>ref|XP_002280459.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera]
Length=498

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 181/234 (77%), Gaps = 0/234 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DI DVLI L+ +NS ++++TWDHIK VLM +FV G+D   A ++WAMTALMK PR
Sbjct  263  KQEQEDITDVLIELQKDNSFAIDITWDHIKGVLMNIFVGGTDAGTATVIWAMTALMKNPR  322

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M   Q E+R+  GKKG I E+D+++LPY KAVVKET+RL P  P+L+ RETL  C+IDG
Sbjct  323  VMKKAQEEVRNTFGKKGFIGEDDVEKLPYLKAVVKETMRLLPAAPLLLPRETLQKCSIDG  382

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI PK LVFVN+WAI RDPE WENP EF PERFL + VD++GQ+++ IPFG GRRVCP 
Sbjct  383  YEIPPKTLVFVNAWAIGRDPEAWENPEEFIPERFLGSSVDFRGQNYKLIPFGAGRRVCPA  442

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            I +G  + EL LANLLY+FDWE+P+ + KEDID +V PG+TMHKK  LCL+AKK
Sbjct  443  IHIGAVTVELTLANLLYSFDWEMPAGMNKEDIDFDVIPGLTMHKKNALCLMAKK  496



>ref|XP_007010977.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY19787.1| Cytochrome P450 [Theobroma cacao]
Length=502

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 182/236 (77%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKS   DI+DVL+ +  +    V+LT+DHIKAVLM +FVAG+DTSAA ++WAMT L+K P
Sbjct  263  PKSEQEDIIDVLLQIWKDRVFQVDLTFDHIKAVLMNMFVAGTDTSAATVIWAMTFLLKNP  322

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            R M  VQ E+R+ +G    +NE+DIQ+LPY KAV+KET RL P  P+L+ RET+  C ID
Sbjct  323  RSMKKVQEEVRNLIGNNDFVNEDDIQDLPYLKAVIKETFRLQPIAPLLLPRETIRKCDID  382

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  + LVFVN+WAI +DPE WENP+EFYPERF+ + +DYKG DFE IPFG GRR CP
Sbjct  383  GYEIPAQTLVFVNAWAIGKDPEAWENPNEFYPERFIGSSIDYKGLDFELIPFGAGRRGCP  442

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI +G+A+ ELALANLL  FDWE+P+ + K+D+D +V PG+ MHKK  LCLVA+K+
Sbjct  443  GIHMGIATVELALANLLCKFDWEMPAGMNKDDLDFDVIPGLAMHKKNALCLVARKI  498



>ref|XP_010674264.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=312

 Score =   303 bits (775),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 176/230 (77%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK + SS  +LT +HIKAVLM +F+AG+DT++ ++VW MT L+K P IM  V
Sbjct  83   DIIDVLLKLKQQPSS--DLTLEHIKAVLMDIFLAGTDTTSTMVVWTMTELIKHPNIMKRV  140

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  V  K  IN  D++EL YFKAVVKET RL+P  P+L+ RET+   TI+GY+I P
Sbjct  141  QEELRKAVQNKEYINNNDLKELEYFKAVVKETFRLHPATPLLIVRETIRKSTIEGYDILP  200

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN WAI RDP  W++P  F PERFL + +D+KG DFE IPFG GRR+CPG+ LGV
Sbjct  201  KTLVYVNVWAIGRDPNSWKDPENFMPERFLGSSIDFKGNDFELIPFGAGRRICPGMNLGV  260

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            AS ELALANLLY FDWELPS LKKEDID +  PGITMHKK PLC +AKK+
Sbjct  261  ASYELALANLLYYFDWELPSGLKKEDIDIDTLPGITMHKKNPLCFLAKKI  310



>gb|EYU34271.1| hypothetical protein MIMGU_mgv1a020847mg [Erythranthe guttata]
Length=446

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  834  VLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEI  655
            VLI LK E S S++L WDHIKA+LM +F+A +DTSAA  VW MTALMK PR+M  VQ+EI
Sbjct  219  VLIKLKQEKSCSIDLNWDHIKALLMNIFIAATDTSAASTVWTMTALMKAPRVMEKVQAEI  278

Query  654  RDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPKMLV  475
            R+ + KKG+++E D+ +LPY KAV+ ETLRLYPP P+LV R+T+  CT++GY I+P+ LV
Sbjct  279  RNSIAKKGKVDENDLPKLPYLKAVISETLRLYPPAPLLVPRQTIEKCTLEGYVIEPRTLV  338

Query  474  FVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAE  295
            +VN+WAIARDP+ WENP EF PERFL++ +D KGQD+  IPFG GRR+CPG+ +G+A+ E
Sbjct  339  YVNAWAIARDPDYWENPDEFLPERFLNSNIDIKGQDYGVIPFGSGRRICPGMYMGLANVE  398

Query  294  LALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            L +ANLLY+F+WELP  ++ +DIDT+V PG+TMHKK  L L  KK
Sbjct  399  LTVANLLYSFNWELPPGIQAKDIDTDVMPGLTMHKKNALLLAPKK  443



>ref|XP_003589394.1| Cytochrome P450 [Medicago truncatula]
Length=591

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ +  ++S S +LT DHIKAVLM +F+AG+DTS+A++VWAMT LM  PR+MN V
Sbjct  282  DIIDILLQMMNDHSLSFDLTLDHIKAVLMNIFIAGTDTSSAIVVWAMTTLMNNPRVMNKV  341

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+    K  INE+DI++LPY KAVVKET+RL+PP P+LV RET+ NC IDGYEIKP
Sbjct  342  QMEIRNLYEDKYFINEDDIEKLPYLKAVVKETMRLFPPSPLLVPRETIENCNIDGYEIKP  401

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDPE W++P EFYPERF+ + VD+KG++FE IPFG GRR+CP + +GV
Sbjct  402  KTLVYVNAWAIGRDPENWKDPEEFYPERFIMSSVDFKGKNFELIPFGSGRRMCPAMNMGV  461

Query  306  ASAELALANLLYAFDWELPSWLKKEDI-DTNVSPGITMHKKIPL-----CLVAKKV*FVL  145
             + EL LANLL++FDW+LP    KE + DT V PGITMHKKI L     C   KK   + 
Sbjct  462  VTVELTLANLLHSFDWKLPHGFDKEQVLDTKVKPGITMHKKIDLSAEDICFAYKKCLLIF  521

Query  144  NFGSTL  127
              GS+L
Sbjct  522  FLGSSL  527



>emb|CDP18845.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 185/234 (79%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P SMDGD++D+++ L+ + ++S  +T  +IKA+LM VF AG+DTSA  I+WAMTA+MK+P
Sbjct  264  PNSMDGDLIDLMLQLRKDGTTSFEITMGNIKAMLMDVFFAGTDTSAVTIIWAMTAMMKKP  323

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M  VQ+EIR  +GKK  ++E+D+Q LPY KAVV+ET RLYP +P+LV R+T++ CT+D
Sbjct  324  TVMRKVQAEIRGIIGKKQMLDEDDVQNLPYLKAVVEETFRLYPALPLLVPRQTIAKCTVD  383

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+P+ LV+VN+W IARDPE WENP EF PERFL++ +D  GQDF  IPFG GRR CP
Sbjct  384  GYEIQPETLVYVNAWGIARDPEYWENPDEFLPERFLNSTLDVNGQDFHLIPFGAGRRGCP  443

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G ++G  + ELALAN+L++FDWELP  +KKEDIDT+  PGITM KK  L LVAK
Sbjct  444  GYSMGKGTVELALANILHSFDWELPPGVKKEDIDTDALPGITMCKKNDLRLVAK  497



>gb|KDO39631.1| hypothetical protein CISIN_1g035827mg [Citrus sinensis]
Length=507

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/234 (62%), Positives = 181/234 (77%), Gaps = 1/234 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    D++DVL+ ++ ++   V+LT DHIKAVLM +FVAG+DTSAA +VWAMT LMK PR
Sbjct  268  KVQQEDLVDVLLQIRKDHGFKVDLTLDHIKAVLMNIFVAGTDTSAATLVWAMTYLMKHPR  327

Query  681  IMNIVQSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            +M  VQ EIR  VG KK  ++E+D+QEL Y KAVVKET+RL PPVP+LV +ET+  CTID
Sbjct  328  VMKKVQEEIRSLVGGKKSFVDEDDVQELHYHKAVVKETMRLQPPVPLLVPKETIEKCTID  387

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K LV+VN+WAI RDPE WENP EF PERF+D  +D+KGQ+FE IPFG GRR+CP
Sbjct  388  GYEIPAKTLVYVNAWAIGRDPEAWENPEEFNPERFIDRSIDFKGQNFELIPFGAGRRICP  447

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+ LG A+ ELALANLLY FDWE+P  +K +D+D +V  GI +HKK  L L+AK
Sbjct  448  GMHLGTANVELALANLLYKFDWEMPPGMKNQDLDFDVLAGIAVHKKNYLFLLAK  501



>ref|XP_006427939.1| hypothetical protein CICLE_v10027382mg [Citrus clementina]
 ref|XP_006464855.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41179.1| hypothetical protein CICLE_v10027382mg [Citrus clementina]
Length=507

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 180/229 (79%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ ++ ++   V+LT DHIKAVLM +FVAG+DTSAA +VW MT LMK PR+M  V
Sbjct  273  DLVDVLLQIRKDHGFKVDLTLDHIKAVLMNIFVAGTDTSAATLVWVMTYLMKHPRVMKKV  332

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  VG KK  ++E+D+QEL Y KAVVKET+RL PPVP+LV +ET+  CTIDGYEI 
Sbjct  333  QEEIRSLVGGKKSFVDEDDVQELHYQKAVVKETMRLQPPVPLLVPKETIEKCTIDGYEIP  392

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LV+VN+WAI RDPE WENP EF PERF+D  +D+KGQ+FE IPFG GRR+CPG+ LG
Sbjct  393  AKTLVYVNAWAIGRDPEAWENPEEFNPERFIDRSIDFKGQNFELIPFGAGRRICPGMHLG  452

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             A+ ELALANLLY FDWE+P  +K +D+D +V PGI +HKK  L L+AK
Sbjct  453  TANVELALANLLYKFDWEMPPGMKNQDLDFDVLPGIAVHKKNYLFLLAK  501



>emb|CDP21727.1| unnamed protein product, partial [Coffea canephora]
Length=519

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 185/235 (79%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P SMDGDI+D+LI L+ + S++ +LT +HIKA LM VF AGS+TSA  ++WAMTAL+K P
Sbjct  281  PTSMDGDIIDLLIQLQKDRSTTFDLTVNHIKATLMNVFFAGSETSAGTVIWAMTALIKNP  340

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              +   Q+EI++ +G+K  I+E+DIQ+LPY KA++KET+RLYP  P+LV R T+ +C +D
Sbjct  341  TALEKAQNEIQEVLGEKKMIDEDDIQKLPYLKAIIKETMRLYPVAPLLVPRYTMESCILD  400

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+PK  V+VN+WAI RDPE WENPHEF PERFL++ +D  G+ F+ IPFG GRR CP
Sbjct  401  GYEIQPKTTVYVNAWAIGRDPEYWENPHEFLPERFLNSTIDATGKHFQLIPFGAGRRGCP  460

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G +LG+A+ ELALANLL +F+W LPS +KKEDIDT+V PG+ M KK  L LVAKK
Sbjct  461  GYSLGIAAVELALANLLNSFNWGLPSGVKKEDIDTDVLPGLAMLKKNALRLVAKK  515



>ref|XP_004490658.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=503

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++D LI LK +   S++LT +HIK ++M + +AG+DT AA +VWAMTALMK PR+M  V
Sbjct  268  DVIDALIQLKNDPYWSMDLTSEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKV  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR     KG I EED+Q+LPY KAV+KE++RLYP +PIL+ RET+  C IDGYEI  
Sbjct  328  QDEIRKAFKGKGFIEEEDVQKLPYLKAVIKESMRLYPTLPILLPRETMKKCNIDGYEIPD  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LVFVN+WAI RDPE W+NP EFYPERFL++ +D KGQDFE IPFG GRRVCPG+ + V
Sbjct  388  KTLVFVNAWAIHRDPEAWKNPEEFYPERFLNSDIDLKGQDFELIPFGSGRRVCPGLNMAV  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ EL LANLLY FDWE+P  +K EDID +  PG+  HKK PLCLVAKK
Sbjct  448  ATVELVLANLLYLFDWEMPEGVKSEDIDIDGLPGLVKHKKHPLCLVAKK  496



>gb|EYU29507.1| hypothetical protein MIMGU_mgv1a005223mg [Erythranthe guttata]
Length=493

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 186/236 (79%), Gaps = 2/236 (1%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDILD+L+ ++ + SSSV++T+DHIKA+LM +  AG+DT++AL+VWAMTAL+K P
Sbjct  254  PKSMEGDILDLLLGIRKDGSSSVDITFDHIKALLMNILTAGTDTTSALLVWAMTALIKNP  313

Query  684  RIMNIVQSEIRD--RVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCT  511
             IM  VQ+E+R    +  K  ++E+DI  LPY +AV+KET RLYPP P+L  RET+  C 
Sbjct  314  LIMKKVQTEVRQLATIDNKDLLDEDDISNLPYLRAVIKETFRLYPPAPLLSPRETIQKCR  373

Query  510  IDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRV  331
            I+GYEI+P  LV++N+WAI RDP+ WENP+EF PERFL   +D KG+D E IPFG GRR 
Sbjct  374  INGYEIEPGTLVYLNAWAIGRDPQTWENPNEFLPERFLKCDIDLKGKDPELIPFGIGRRR  433

Query  330  CPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            CPGI++GVA  E+ALANLL +FDWELP  +K+EDID +V PG+TMHKK  LC+VAK
Sbjct  434  CPGISIGVAKIEIALANLLRSFDWELPVGMKEEDIDFDVLPGMTMHKKNALCVVAK  489



>gb|EYU38764.1| hypothetical protein MIMGU_mgv1a004668mg [Erythranthe guttata]
Length=516

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 181/229 (79%), Gaps = 2/229 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            +ILD+LI LK + SSS++LTWD++KA LM +FVAG+DT  A IVW MTALM+ P  M  +
Sbjct  283  NILDLLIQLKEDESSSIDLTWDNVKATLMDIFVAGTDTGTATIVWTMTALMQNPTAMKKL  342

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIRD +G KG++NE+DI  +PY KAV+KE LRLYPP P+L+ R+TL    I+GY I P
Sbjct  343  QKEIRDLIGGKGKVNEDDIPNIPYLKAVIKEALRLYPPAPLLL-RQTLEKLNIEGYTIPP  401

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLD-NKVDYKGQDFEFIPFGGGRRVCPGIALG  310
            K  +F+N+WAIARDPE WENP+EF PERFL+ +  D  GQDF  IPFG GRR CPG+A+G
Sbjct  402  KTSIFINAWAIARDPEYWENPNEFSPERFLNSDAADVTGQDFRVIPFGSGRRGCPGMAMG  461

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A  ELA+ANL+Y+FDWELP+ +K+EDID+ V PG+TM+KKIPLCLV K
Sbjct  462  LAMVELAVANLVYSFDWELPNGMKEEDIDSQVLPGLTMYKKIPLCLVPK  510



>ref|XP_002307703.2| hypothetical protein POPTR_0005s25740g [Populus trichocarpa]
 gb|EEE94699.2| hypothetical protein POPTR_0005s25740g [Populus trichocarpa]
Length=482

 Score =   303 bits (777),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 172/228 (75%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK E S + +L  DHIKAVLM +FVAG+DTSA  + WAMTALMKEPR+MN V
Sbjct  247  DIIDVLLRLKKERSFAFDLNRDHIKAVLMNIFVAGTDTSAGTLEWAMTALMKEPRVMNKV  306

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R+ VG +  + E+D+  LPY KAVVKET RL P  P+L+ RET+ NC IDGY+I  
Sbjct  307  QEEVRNLVGDRKLVKEDDLLRLPYLKAVVKETWRLRPVAPLLLPRETIQNCNIDGYDIPA  366

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            + LVFVN+WAI RDPE WE P EFYPERF    VD+KGQD+E IPFG GRR CPGI +G 
Sbjct  367  RTLVFVNAWAIGRDPEAWEIPEEFYPERFFGKSVDFKGQDYELIPFGTGRRGCPGIHMGA  426

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             + ELALANLLY FDWE+P  LK EDID +V PG++ HKK  LCL+ +
Sbjct  427  VTVELALANLLYNFDWEMPQGLKAEDIDMDVLPGLSTHKKNALCLMPR  474



>ref|XP_011045132.1| PREDICTED: cytochrome P450 83B1-like [Populus euphratica]
Length=503

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 174/228 (76%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK E S + +LT DHIKAVLM +F+AG+DT+A  + WAMTALMKEPR+M  V
Sbjct  268  DIIDVLLRLKKERSFAFDLTRDHIKAVLMNIFIAGTDTTAGTLEWAMTALMKEPRVMKKV  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R+ VG +  + E+D+  LPY KAVVKET RL+P  P+L+ RET+ NC IDGY+I  
Sbjct  328  QEEVRNLVGDRKLVKEDDLLRLPYLKAVVKETWRLHPVAPLLLPRETIQNCNIDGYDIPA  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            + LV+VN+WAI RDPE WE P EFYPERF    +D+KGQD+E IPFG GRR CPGI +G 
Sbjct  388  RTLVYVNAWAIGRDPEAWEIPEEFYPERFFGKSIDFKGQDYELIPFGTGRRGCPGIHMGA  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             + ELA ANLLY+FDWE+P  LK ED+D +V PG++MHKK  LCL+ +
Sbjct  448  VTVELAFANLLYSFDWEMPQGLKAEDMDMDVLPGLSMHKKNALCLMPR  495



>gb|AIC74457.1| Cytochrome P450 CYPII [Withania somnifera]
Length=496

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 184/235 (78%), Gaps = 2/235 (1%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+D+L+ LK E  + ++LT + IKA+LM  ++ G     A ++WAM ALMK P
Sbjct  260  PKSMEGDIIDLLLHLKKEKLTPIDLTLEDIKAILMW-YLQGQKLEPAAVIWAMAALMKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRI-NEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            ++M  VQ E+R  VGK+  I  E+DIQ LPYFKAV+KE+ RL+P VP+L+ R+++   T+
Sbjct  319  KVMKKVQEEVRKSVGKRDHILKEDDIQNLPYFKAVIKESFRLHPSVPVLLPRKSMKKSTL  378

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
            +GYEI+P   ++VNSWAIARDPE WENP EF PERFL+N +D+KGQDFEFIPFG GRR C
Sbjct  379  EGYEIQPGTTIYVNSWAIARDPEIWENPEEFIPERFLNNNIDFKGQDFEFIPFGAGRRGC  438

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            PGIALGVAS ELAL+NLLYAFDWELP  + KEDIDTNV PGIT+HKK  LCL+ K
Sbjct  439  PGIALGVASMELALSNLLYAFDWELPCGMTKEDIDTNVRPGITVHKKNDLCLIPK  493



>ref|XP_011087181.1| PREDICTED: cytochrome P450 71A9-like [Sesamum indicum]
Length=496

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 184/236 (78%), Gaps = 1/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK+M+GDILD+L+ L  +  SS+ LT DH+KAV+M + V G+D +AA+ VWAMTALMK P
Sbjct  260  PKAMEGDILDILLGLMRDGLSSIPLTVDHVKAVIMNILVGGTDANAAITVWAMTALMKSP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q+EIR+ +GKK  I+E +I  LPY +AV+KE  RLYPP P+LV RETL  CTI+
Sbjct  320  IPMKRAQTEIRN-LGKKDLIDENEIASLPYLRAVIKEIFRLYPPAPLLVPRETLQECTIN  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+PK LV++N+WAIARDP+ W +  EF PERFL++++D +G D E IPFG GRR CP
Sbjct  379  GYEIQPKTLVYINAWAIARDPQFWNDADEFVPERFLESEIDVRGHDPEVIPFGIGRRGCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI++G+A+ ELALANLL AFDWELP+ +K+ED+D  V PG+TMHKK  LCLVAK V
Sbjct  439  GISMGMATVELALANLLNAFDWELPAGMKEEDLDFEVLPGMTMHKKNALCLVAKPV  494



>gb|KDO39891.1| hypothetical protein CISIN_1g013651mg [Citrus sinensis]
Length=439

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 173/229 (76%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++      V+LT DHIKAVLM VFVAG+DTSAA +VWAMT LMK PR M  V
Sbjct  204  DIIDVLLQIRKNCGFKVDLTLDHIKAVLMNVFVAGADTSAATVVWAMTYLMKNPRAMKKV  263

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RET+  C IDGY I 
Sbjct  264  QLEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLIPRETIQKCVIDGYAIP  323

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K  VFVN+WAI RDPE WENP EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG+ +G
Sbjct  324  AKTRVFVNAWAIGRDPEAWENPEEFYPERFIDSCIDFKGQHFELIPFGAGRRICPGLNMG  383

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K  D+D +V  GI MHKK  L L+ K
Sbjct  384  IATVDLALANLLYKFDWEMPLGIKSHDLDFDVLLGIAMHKKNALSLLPK  432



>ref|XP_004506482.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=497

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 174/230 (76%), Gaps = 0/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D DI+DVL+ LK   S S +LT+DH+K V+  + VA +DT++A  VWAMTAL+K PR+M 
Sbjct  265  DEDIVDVLLQLKKSRSFSFDLTFDHVKGVITDILVAATDTTSATSVWAMTALIKNPRVMK  324

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
            IVQ EIR    KK  ++E+DI+  PY KAV+KETLRLY P P+LV RE+   CTI GY+I
Sbjct  325  IVQEEIRSSRVKKYILDEDDIRNFPYLKAVIKETLRLYLPAPLLVPRESSEKCTIGGYQI  384

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              + +V+VN+W + RDP  W+NP EFYPERFLDN +++ GQDFE IPFG GRR+CPGI +
Sbjct  385  PARTIVYVNAWTLQRDPNIWKNPEEFYPERFLDNSINFLGQDFELIPFGAGRRICPGIPM  444

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             VAS EL LANLLY+FDW+LP  L KEDIDT + PGIT HKK PLCLVAK
Sbjct  445  AVASLELILANLLYSFDWKLPDGLLKEDIDTEMLPGITQHKKNPLCLVAK  494



>ref|XP_006479002.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=509

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 176/229 (77%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ ++      V+LT DHIKAVLM +FVAG+DTSAA +VW MT LMK PR+M  V
Sbjct  275  DLIDVLLQIRKHRGFKVDLTLDHIKAVLMNIFVAGTDTSAATLVWTMTYLMKHPRVMKKV  334

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  VG  K  ++E+D+QEL Y KAVVKE +RL PPVP+LV RET   C +DGYEI 
Sbjct  335  QEEIRSLVGGNKSFVDEDDVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIP  394

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K +V+VN+WAI RDPE WENP EF PERF+D  VD+KG++FEFIPFG GRR+CPG+ LG
Sbjct  395  AKTIVYVNAWAIGRDPEAWENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGMHLG  454

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +KK+D+D +   GIT+HKK  L L+AK
Sbjct  455  IATVDLALANLLYKFDWEMPPGMKKQDLDFDSLSGITVHKKNFLVLLAK  503



>ref|XP_002535120.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF27263.1| cytochrome P450, putative [Ricinus communis]
Length=267

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 175/234 (75%), Gaps = 0/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DILDVL+ +  + S    LT DHIKAVLM VFV G+DTSAA +VWAMT LMK P
Sbjct  31   PKPEQEDILDVLLQIWKDRSFKAYLTPDHIKAVLMNVFVGGTDTSAATVVWAMTFLMKNP  90

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q E+R  +GKKG ++EED Q+L Y KAV+KETLRL P +P+LV R++  +C + 
Sbjct  91   IAMKKAQEEVRHIIGKKGFVDEEDTQQLVYLKAVIKETLRLQPTIPLLVPRKSTQDCNLG  150

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            G EI    +V+VN+WAI RDPE WENP EF PERF+DN +D KGQDFE IPFG GRR+CP
Sbjct  151  GCEIPAHTVVYVNAWAIGRDPEVWENPEEFCPERFIDNPIDLKGQDFELIPFGAGRRICP  210

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GI +G+ + EL+LANLLY FDWE+P+ ++KE++D +V+PG+ +HKK  LCLVA+
Sbjct  211  GIYIGLTTVELSLANLLYKFDWEMPAGMEKENLDMDVNPGLAVHKKNALCLVAR  264



>ref|XP_011077693.1| PREDICTED: cytochrome P450 83B1-like [Sesamum indicum]
Length=511

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 188/236 (80%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK  + DILD+LI LK EN  S+ LTW+HIKA+LM +FVAG+DT AA I+WAMTAL+K P
Sbjct  273  PKPANPDILDLLIQLKEENLCSIKLTWNHIKAILMDIFVAGTDTGAAAIIWAMTALIKNP  332

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  +Q EIR+ +G+KG++ E+D+ +L Y  AV+KETLRLYPP P+L+ RETL  C ++
Sbjct  333  TTMKKLQREIREAIGEKGKVTEDDLPKLSYLNAVIKETLRLYPPAPLLLPRETLEKCNLE  392

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY I PK +V++N+WAIARDPE W+ P EF PERFL+ KVD  GQDF+ IPFG GRR CP
Sbjct  393  GYIIPPKTVVYINAWAIARDPEYWDRPDEFVPERFLNTKVDIIGQDFQVIPFGAGRRGCP  452

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI++G+A+ ELALANLLY FDWELP+ +K+EDIDT V PGITMHKK PLCLV K++
Sbjct  453  GISMGLATVELALANLLYTFDWELPAGMKREDIDTAVLPGITMHKKNPLCLVPKQI  508



>gb|KJB73274.1| hypothetical protein B456_011G225200 [Gossypium raimondii]
Length=503

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D+LDVL+ ++M+ +   +LT DHIKA+LM VF+AG++T+AA ++W M+ALMK P+ +   
Sbjct  272  DLLDVLLRIRMDRNFPFDLTIDHIKAILMNVFIAGTNTTAATVIWVMSALMKNPKCLKKA  331

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q+E+RD VGKKG INE+D+Q L Y KAVVKET RL+P  P+L+ RETL NC I GY+I  
Sbjct  332  QAEVRDLVGKKGFINEDDVQALTYLKAVVKETFRLHPTAPMLLPRETLRNCNIGGYQIPA  391

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDP+ W+NP EF PERFL N +DYKG +FEF+PFG GRRVCPG+ +GV
Sbjct  392  KTLVYVNAWAIGRDPKVWKNPEEFCPERFLGNSIDYKGLNFEFLPFGAGRRVCPGMRIGV  451

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            A  ELALANLLY FDWE+P+ + KED+D +  PG+ + KK  L L+A+K+
Sbjct  452  AEVELALANLLYKFDWEMPTGMNKEDLDFDAVPGLAVLKKNDLILMARKI  501



>gb|KDO39228.1| hypothetical protein CISIN_1g038171mg [Citrus sinensis]
Length=509

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ ++      V+LT DHIKAVLM +FVAG+DTSAA +VW MT LMK PR+M  V
Sbjct  275  DLVDVLLQIRKHRGFKVDLTLDHIKAVLMNIFVAGTDTSAATLVWTMTYLMKHPRVMKKV  334

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  VG  K  ++E+D+QEL Y KAVVKET+RL PP P+LV RET     IDGYEI 
Sbjct  335  QEEIRSLVGGNKSFVDEDDVQELHYLKAVVKETMRLQPPAPLLVPRETTEKSIIDGYEIP  394

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LV+VN+WAI RDPE WENP EF PERF+D  VD+KG++FEFIPFG GRR+CPG+ LG
Sbjct  395  AKTLVYVNAWAIGRDPEAWENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGMHLG  454

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +KK+D+D +   GIT+HKK  L L+AK
Sbjct  455  IATVDLALANLLYKFDWEMPPGMKKQDLDFDSLSGITVHKKNFLVLLAK  503



>ref|XP_011077701.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=501

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 187/236 (79%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK  + DILD+LI LK EN  S+ LTW+HIKA+LM +F+AG+DT AA I+WAMTAL+K P
Sbjct  261  PKPANPDILDLLIRLKEENLCSIELTWNHIKAILMNIFIAGTDTGAAAIIWAMTALIKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  VQ EIR+ +G+KG++ E+D+ +L Y  AV+KETLRLYPP P+L+ RETL  C I+
Sbjct  321  TTMKKVQREIREAIGEKGKVTEDDLPKLSYLNAVIKETLRLYPPTPLLLPRETLEKCNIE  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY I PK LV++N+WAIARDPE W+ P EF PERFL+ KVD  GQDF+ IPFG GRR CP
Sbjct  381  GYIIPPKTLVYINAWAIARDPEYWDCPDEFVPERFLNTKVDIIGQDFQVIPFGAGRRGCP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI +G+A+ ELALANLLY FDWELP+ +K+EDIDT V PG+TMHKK PLCLV K++
Sbjct  441  GIWMGLATVELALANLLYTFDWELPAGMKREDIDTAVLPGLTMHKKNPLCLVPKQI  496



>ref|XP_006443223.1| hypothetical protein CICLE_v10023326mg, partial [Citrus clementina]
 gb|ESR56463.1| hypothetical protein CICLE_v10023326mg, partial [Citrus clementina]
Length=511

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 175/229 (76%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ ++      V+LT DHIKAVLM +FVAG+DTSAA +VW MT LMK PR+M  V
Sbjct  277  DLVDVLLQIRKHRGFKVDLTLDHIKAVLMNIFVAGTDTSAATLVWTMTYLMKHPRVMKKV  336

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  VG  K  ++E+D+QEL Y KAVVKET+RL PP P+LV RET     IDGYEI 
Sbjct  337  QEEIRSLVGGNKSFVDEDDVQELHYLKAVVKETMRLQPPAPLLVPRETTEKSIIDGYEIP  396

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LV+VN+WAI RDPE WENP EF PERF+D  VD+KG++FEFIPFG GRR+CPG+ LG
Sbjct  397  AKTLVYVNAWAIGRDPEAWENPEEFNPERFIDRSVDFKGKNFEFIPFGAGRRICPGMHLG  456

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +KK+D+D +   GIT+HKK  L L+AK
Sbjct  457  IATVDLALANLLYKFDWEMPPGMKKQDLDFDSLSGITVHKKNFLVLLAK  505



>gb|EPS69225.1| hypothetical protein M569_05542, partial [Genlisea aurea]
Length=494

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 179/233 (77%), Gaps = 0/233 (0%)
 Frame = -1

Query  858  SMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRI  679
            S+  D+L +LI LK  NSS V++TW++IK +L+ +   G+DTSA  IVWAMT LM+ P I
Sbjct  260  SLKNDLLAILIQLKANNSSPVDITWENIKGILLDILAGGTDTSATTIVWAMTTLMQNPEI  319

Query  678  MNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGY  499
            M+ +  E+RD VG  G+  E+D+ + PY KAVVKE LR+YPP P+L+ RE+  +C I GY
Sbjct  320  MSRLGREVRDAVGIGGKATEDDVSKCPYLKAVVKEILRMYPPAPLLIPRESQKDCVIRGY  379

Query  498  EIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGI  319
            EI+ K +V+VN+WAI RDPE WENP +F PERFL+ + D  G++FE IPFG GRRVCPGI
Sbjct  380  EIEAKTMVYVNAWAIGRDPENWENPQQFIPERFLNGEADLIGKNFEAIPFGAGRRVCPGI  439

Query  318  ALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + G+A+ ELALANL+Y FDWELP+ ++ +DIDT+V+PGIT+ KK+PLCLV KK
Sbjct  440  STGLATVELALANLIYGFDWELPNGMEIKDIDTDVTPGITIAKKVPLCLVPKK  492



>ref|XP_010670999.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=500

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 173/230 (75%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL  L++    S+ LT DH+KAVLMI+F+AG+DTS+A+++W MT LMK P  M  V
Sbjct  265  DIVDVL--LQLMKDRSLELTLDHVKAVLMIIFIAGADTSSAMVIWTMTELMKNPHSMKKV  322

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R+ +  K  IN  D+ +L YFKAVVKET RL P  P+LV  ET+   TI+GY+I P
Sbjct  323  QDELREAIQNKVSINNNDLVKLEYFKAVVKETFRLQPATPLLVVHETIRKSTIEGYDILP  382

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDP  W+ P  F PERFL + +D+KG DFE IPFG GRR+CPG+ LGV
Sbjct  383  KTLVYVNAWAIGRDPNSWKEPENFMPERFLGSSIDFKGNDFELIPFGAGRRICPGMNLGV  442

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            AS ELALANLLY FDWELPS L+KEDID +  PGITMHKK PLCL+AKK 
Sbjct  443  ASYELALANLLYYFDWELPSGLRKEDIDIDPLPGITMHKKNPLCLLAKKT  492



>ref|XP_011091687.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=484

 Score =   298 bits (763),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 177/234 (76%), Gaps = 17/234 (7%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+SM GDILD+LI L+ + SSSV + WDHIK VLM VFVAG++TSAA I WAMTAL+K+P
Sbjct  265  PESMKGDILDLLIQLREDRSSSVQIDWDHIKGVLMNVFVAGTETSAATITWAMTALIKKP  324

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            +++  VQ EIR  V KKG ++E+DI +LPYFKAVVKETLRLYPPVP+ + R T   C +D
Sbjct  325  KVLKKVQQEIRTLVEKKGSVDEDDIHKLPYFKAVVKETLRLYPPVPLSLPRLTTKACVVD  384

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            G                 RDP+ WENP EF PERFL++ VD+KGQDF F+PFG GRRVCP
Sbjct  385  G-----------------RDPDFWENPDEFLPERFLNSSVDFKGQDFGFLPFGSGRRVCP  427

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GIALG+A  E+ALANLLY+F+WELP+ + ++D+D + SPGI  HKK PLCL+A+
Sbjct  428  GIALGIAEVEVALANLLYSFNWELPAGMMEDDVDMDSSPGIVTHKKNPLCLMAR  481



>ref|XP_006443326.1| hypothetical protein CICLE_v10023966mg [Citrus clementina]
 gb|ESR56566.1| hypothetical protein CICLE_v10023966mg [Citrus clementina]
Length=490

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 172/229 (75%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ ++ +     +LT DHIKAVLM VFVAG+DTSAA +VWAMT LMK PR M   
Sbjct  255  DIIDILLQIRKDRGFKADLTLDHIKAVLMNVFVAGTDTSAATVVWAMTYLMKNPRAMKKA  314

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KA+VKET+RL P  P+L+ RE++  C I+GYEI 
Sbjct  315  QLEIRSLIGGNKGFVNEDDVQELHYLKAIVKETMRLQPTGPLLIPRESIQKCVIEGYEIP  374

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LVFVN+WAI RDPE WENP EFYPERF D+ +D KGQ FE IPFG GRR+CPG+ +G
Sbjct  375  AKTLVFVNAWAIGRDPEVWENPEEFYPERFADSSIDLKGQHFELIPFGAGRRICPGLHMG  434

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +K  D+D +V PGI MHKK  L L+ K
Sbjct  435  IATVDLALANLLYNFDWEMPLGMKSHDLDFDVLPGIAMHKKNALSLLPK  483



>gb|KDP36955.1| hypothetical protein JCGZ_08246 [Jatropha curcas]
Length=417

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            +ILDVL+ +  + S  V L++DHIKA+LM VFVAG+DTSAA ++WAM  LM+ P  M   
Sbjct  186  NILDVLLQIWNDRSFKVQLSFDHIKAILMNVFVAGTDTSAATVIWAMGFLMRNPEAMRKA  245

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+ +G+KG +NE+D+Q++PY KAVVKET+RL P VP+LV RET+ +CT+ G+ I  
Sbjct  246  QKEIRNTIGEKGFVNEDDVQQMPYLKAVVKETMRLQPTVPLLVPRETVQDCTLGGFHIPA  305

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV VN+WAI RDPE WE P EFYP+RFL++ VD KGQD+E IPFGGGRR+CPGI +G+
Sbjct  306  KSLVHVNAWAIGRDPEVWEKPLEFYPDRFLNSNVDMKGQDYELIPFGGGRRICPGIFMGI  365

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDT-NVSPGITMHKKIPLCLVAK  163
            A+ EL+LANLLY FDWE+P+ +K+EDID  +V PGI + K+  L LVAK
Sbjct  366  ANVELSLANLLYKFDWEMPAGMKREDIDIDDVLPGIAVRKRDHLLLVAK  414



>ref|XP_007017732.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14957.1| Cytochrome P450, putative [Theobroma cacao]
Length=537

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 172/230 (75%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ +  +   +++LT DHIKAVLM VFVAG+DTSAA ++W MT LMK PR +   
Sbjct  269  DIIDVLLQIWKDREFAIDLTIDHIKAVLMNVFVAGTDTSAASVIWVMTFLMKNPRCLKKA  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  +GKK  +NE+D Q L Y KAV+KET RL   VP+LV RET+    I GYEI  
Sbjct  329  QEEVRSLMGKKDFVNEDDTQALTYLKAVIKETFRLQAIVPLLVPRETMRKSNISGYEIPA  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDPE WENP EFYPERF+ + +DYKG DFE IPFG GRR CPGI +GV
Sbjct  389  KTLVYVNAWAIGRDPEAWENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGIHMGV  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
             + ELALANLLY FDWE+P+ + KED+D +V PGIT HKK  LCLVAK++
Sbjct  449  VTVELALANLLYKFDWEMPTGMNKEDLDFDVIPGITTHKKNALCLVAKEI  498



>ref|XP_010670930.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 171/229 (75%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ L+ E     +LT DHIKAVLM +FVAG+DT+AA ++WAMT L+K P  M  V
Sbjct  283  DIIDVLLQLREERKLPFDLTLDHIKAVLMNIFVAGTDTTAATVIWAMTELIKNPNAMKKV  342

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  V     I E+ +  L Y KAVVKET RL+P  P+L+ R+T+  CT+ GY+IK 
Sbjct  343  QEEVRSMVKNSTFIQEQQLHHLKYLKAVVKETFRLHPVSPLLLPRQTMQKCTLGGYQIKR  402

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
              LV++N+WAI RDPE WENP +F+PERFL + +D+KGQDFE IPFG GRR CPG+ LG 
Sbjct  403  GTLVYINAWAIGRDPESWENPEKFFPERFLGSTIDFKGQDFELIPFGAGRRGCPGLQLGA  462

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ ELALANL+  FDWELP+++ KEDID +V PG+T HKKIPLCL AKK
Sbjct  463  ATVELALANLVCCFDWELPAYMNKEDIDMDVLPGVTAHKKIPLCLSAKK  511



>ref|XP_012073846.1| PREDICTED: cytochrome P450 83B1-like [Jatropha curcas]
 gb|KDP36954.1| hypothetical protein JCGZ_08245 [Jatropha curcas]
Length=503

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 171/229 (75%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DILDVL+ +  + SS  +LT DHIKA+LM VFV G+DTSAA +VWAMT LMK P  M   
Sbjct  273  DILDVLLQIWKDRSSKTDLTLDHIKALLMNVFVGGTDTSAATVVWAMTFLMKNPLAMKKA  332

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  VG KG +NEED Q L Y KAV+KET+RL P VP+L+ RE+   C +DG++I  
Sbjct  333  QEEVRSVVGNKGFVNEEDTQHLSYMKAVIKETMRLQPTVPLLIARESSQYCCLDGHDIPA  392

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  V+VN+WAI RDPE WENP EF PERF+ N +D KGQD+E IPFG GRR+CPG+ +G+
Sbjct  393  KTAVYVNAWAIGRDPEVWENPEEFCPERFVGNSIDLKGQDYELIPFGAGRRICPGMFMGL  452

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ EL+LANLLY FDWE+P  +KKED+D    PGITMHK+  L L+A+K
Sbjct  453  ANVELSLANLLYKFDWEMPVGMKKEDLDMEAQPGITMHKRNALSLMARK  501



>gb|KDO47250.1| hypothetical protein CISIN_1g010479mg [Citrus sinensis]
Length=509

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 175/229 (76%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ ++      V+LT DHIKAVLM +FVAG+DTSAA +VW MT LMK PR+M  V
Sbjct  275  DLIDVLLQIRKHRGFKVDLTLDHIKAVLMDIFVAGTDTSAATMVWTMTYLMKYPRVMKKV  334

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  VG  K  ++E+D+QEL Y KAVVKE +RL PPVP+LV RET   C +DGYEI 
Sbjct  335  QEEIRSLVGGNKSFVDEDDVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIP  394

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K +V+VN+WAI RDPE WENP EF PERF+D  +D+KGQ+FEFIPFG GRR+CPG+ LG
Sbjct  395  AKTIVYVNAWAIGRDPEAWENPEEFNPERFIDRSIDFKGQNFEFIPFGAGRRICPGMHLG  454

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +KK+D++ +   G T+HKK  L L+AK
Sbjct  455  IATVDLALANLLYKFDWEMPPGMKKQDLNFDSLSGTTVHKKNFLVLLAK  503



>ref|XP_004490657.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=501

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 172/229 (75%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++D LI LK +   S++LT DHIK ++M +  A +DT AA++VW MTALMK PR+M  V
Sbjct  268  DVIDSLIQLKNDPYWSMDLTSDHIKPLIMNMLFAATDTIAAVVVWTMTALMKNPRVMQKV  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR     KG I EED ++LPY  AV+KE++RLYP +PIL+ RET+  C IDGYEI  
Sbjct  328  QDEIRKAYKGKGFIEEEDAKKLPYLNAVIKESMRLYPILPILLPRETMKKCNIDGYEIPD  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LVFVN+WAI RDPE W+NP EFYPERFLD+ +D+KGQDFE IPFG GRR+CPG+ + V
Sbjct  388  KTLVFVNAWAIHRDPETWKNPEEFYPERFLDSHIDFKGQDFELIPFGSGRRICPGLNMAV  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ EL LANLLY FDWE+P  +K EDID +  PG+  HKK PL LVAKK
Sbjct  448  ATVELVLANLLYLFDWEMPEGVKSEDIDIDGLPGLIKHKKHPLYLVAKK  496



>gb|EYU31746.1| hypothetical protein MIMGU_mgv1a022569mg [Erythranthe guttata]
Length=503

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 191/240 (80%), Gaps = 6/240 (3%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GD LD+LI L+ + S+SV + W++IKA+LM +FV G+DTSA+ IVWA+TALMK P
Sbjct  262  PKSMEGDFLDLLIRLREDTSASVKIDWNNIKAILMNIFVGGTDTSASTIVWALTALMKNP  321

Query  684  RIMNIVQSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
              M   Q EI+  +  KK  INE+DI++LPY KAV+KET+RLYPP+P+L+ +ET+  CTI
Sbjct  322  SAMKKAQQEIKTLISNKKSSINEDDIEKLPYLKAVIKETMRLYPPLPLLIPKETMEKCTI  381

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNK-----VDYKGQDFEFIPFGG  343
            +GYEI+PK + FVN WAI RDPE WE+P+EF PERFL+N      +D+KG+DF +IPFG 
Sbjct  382  NGYEIEPKTITFVNVWAIGRDPEYWESPNEFLPERFLNNNNDEKIIDFKGRDFGYIPFGS  441

Query  342  GRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GRR CPG++LGVA+ E+ALANLLY+FD+ELP  + +ED+DT+ S G+T+HKK PLC+V K
Sbjct  442  GRRSCPGLSLGVAAVEMALANLLYSFDFELPRGMSEEDVDTDASQGLTVHKKNPLCVVVK  501



>gb|KJB17922.1| hypothetical protein B456_003G024500, partial [Gossypium raimondii]
Length=481

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DILDVL+    ++  S +LT D IKA+LM +F+AG+DTSAA I+W M+ LMK P+
Sbjct  245  KPQQEDILDVLLQTWKDHDFSFDLTIDQIKAILMNLFIAGTDTSAATIIWVMSFLMKNPK  304

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             +   Q+E+R+ +GKKG +NE+D ++L Y KAV+KET RL P  P+LV RETL  C I G
Sbjct  305  CLKKTQAEVRNLIGKKGFVNEDDTRDLTYLKAVIKETFRLQPIAPLLVPRETLRKCNIGG  364

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I  K LV VN+WAI +DPE WENP EFYPERF+ + +DYKGQ FE IPFG GRRVCPG
Sbjct  365  YDIPAKTLVHVNAWAIGKDPETWENPEEFYPERFIGSPIDYKGQHFELIPFGAGRRVCPG  424

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + +GVA  ELALANLLY FDWE+P  + KEDID +V PGIT  KK PL LVA+K+
Sbjct  425  MHMGVAVVELALANLLYKFDWEMPIAMTKEDIDFDVKPGITARKKYPLILVARKI  479



>ref|XP_006443222.1| hypothetical protein CICLE_v10019775mg [Citrus clementina]
 ref|XP_006478925.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR56462.1| hypothetical protein CICLE_v10019775mg [Citrus clementina]
Length=509

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 174/229 (76%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ ++      V+LT DHIKAVLM +FVAG+DTSAA +VW MT LM  PR+M  V
Sbjct  275  DLIDVLLQIRKHRGFKVDLTLDHIKAVLMDIFVAGTDTSAATMVWTMTYLMMHPRVMKKV  334

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  VG  K  ++E+D+QEL Y KAVVKE +RL PPVP+LV RET   C +DGYEI 
Sbjct  335  QEEIRSLVGGNKSFVDEDDVQELHYLKAVVKEAMRLQPPVPLLVPRETTEKCIVDGYEIP  394

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K +V+VN+WAI RDPE WENP EF PERF+D  +D+KGQ+FEFIPFG GRR+CPG+ LG
Sbjct  395  AKTIVYVNAWAIGRDPEAWENPEEFNPERFIDRSIDFKGQNFEFIPFGAGRRICPGMHLG  454

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +A+ +LALANLLY FDWE+P  +KK+D++ +   G T+HKK  L L+AK
Sbjct  455  IATVDLALANLLYKFDWEMPPGMKKQDLNFDSLSGTTVHKKNFLVLLAK  503



>gb|KEH29148.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=497

 Score =   296 bits (757),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK  + SS++LT++HIKAVL+   VA +DT++A  VWAMTALMK PR+++ V
Sbjct  267  DIVDVLLHLKKHHLSSIDLTFNHIKAVLVDTIVAATDTTSAASVWAMTALMKNPRVLDKV  326

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+  G K  ++E D+Q LPY  AV+KETLRL+ P P+L+ RE+  NCTI+GY I  
Sbjct  327  QEEIRNLGGAKDYLDEGDLQNLPYLNAVIKETLRLHLPAPLLLSRESRENCTINGYNIPA  386

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            + +++VN+WAI RD   WEN  EFYPERFL++ +++ GQDFE IPFG GRR+CPG+ + V
Sbjct  387  RTILYVNAWAIQRDHNVWENAEEFYPERFLESSINFTGQDFELIPFGAGRRICPGLPMAV  446

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS +L LANLLY+FDW+LP  L KEDIDT++ PGIT HKK PLCLVAK
Sbjct  447  ASLKLILANLLYSFDWKLPDGLVKEDIDTSMLPGITQHKKNPLCLVAK  494



>gb|KJB17921.1| hypothetical protein B456_003G024400 [Gossypium raimondii]
Length=412

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DI+DVL+    ++  S +LT D IKA+LM +F+AG+DT+AA I+W M  LMK P+
Sbjct  176  KPQQEDIVDVLLQTWKDHDFSFDLTIDQIKAILMNLFIAGTDTAAATIIWVMDFLMKNPK  235

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             +   Q+E+R  +GK+G +NE+D ++L Y KAV+KET RL P  P+LV RETL  C I G
Sbjct  236  CLKETQAEVRSLIGKRGFVNEDDTRDLTYLKAVIKETFRLQPIAPLLVPRETLRKCNIGG  295

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I  K LV+VN+WAI +DPE WENP EFYPERF+ + +DYKGQ FE IPFG GRRVCPG
Sbjct  296  YDIPAKTLVYVNAWAIGKDPETWENPEEFYPERFIGSPIDYKGQHFELIPFGAGRRVCPG  355

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + +GVA  ELALANLLY FDWE+P  + KEDID +V PGIT  KK PL LVA+K+
Sbjct  356  MHMGVAVVELALANLLYKFDWEMPIAMTKEDIDFDVKPGITARKKYPLILVARKI  410



>ref|XP_012073889.1| PREDICTED: cytochrome P450 83B1-like [Jatropha curcas]
Length=500

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 179/229 (78%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            +ILDVL+ +  + S  V L++DHIKA+LM VFVAG+DTSAA ++WAM  LM+ P  M   
Sbjct  269  NILDVLLQIWNDRSFKVQLSFDHIKAILMNVFVAGTDTSAATVIWAMGFLMRNPEAMRKA  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+ +G+KG +NE+D+Q++PY KAVVKET+RL P VP+LV RET+ +CT+ G+ I  
Sbjct  329  QKEIRNTIGEKGFVNEDDVQQMPYLKAVVKETMRLQPTVPLLVPRETVQDCTLGGFHIPA  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV VN+WAI RDPE WE P EFYP+RFL++ VD KGQD+E IPFGGGRR+CPGI +G+
Sbjct  389  KSLVHVNAWAIGRDPEVWEKPLEFYPDRFLNSNVDMKGQDYELIPFGGGRRICPGIFMGI  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDT-NVSPGITMHKKIPLCLVAK  163
            A+ EL+LANLLY FDWE+P+ +K+EDID  +V PGI + K+  L LVAK
Sbjct  449  ANVELSLANLLYKFDWEMPAGMKREDIDIDDVLPGIAVRKRDHLLLVAK  497



>ref|XP_010670941.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=370

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 178/232 (77%), Gaps = 2/232 (1%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL+ LK + SS  +LT +HIKAVLM +F+AG++ S+A++VWAMT LMK P 
Sbjct  137  KSDREDIIDVLLKLKQQPSS--DLTLEHIKAVLMDIFLAGTERSSAMVVWAMTELMKHPI  194

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            IM  VQ EIR+ V  K  I+  D++EL YFKAVVKET RL+P  P+L+  ET+   TI+G
Sbjct  195  IMKRVQDEIRNAVQNKEYISNNDLKELEYFKAVVKETFRLHPATPLLIVHETIHKSTIEG  254

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I PK LV+VN+W+I RD   W++P +F PERFL++ +D+KG DFE IPFG GRR+CPG
Sbjct  255  YDILPKTLVYVNAWSIGRDSVSWKDPEKFMPERFLESSIDFKGCDFELIPFGAGRRICPG  314

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            I LG+A+ ELALANLL+ FDWELP  LK EDIDT+V PGI MHKK PLCLVA
Sbjct  315  IHLGLANMELALANLLHFFDWELPCDLKMEDIDTDVLPGIVMHKKNPLCLVA  366



>ref|XP_006435134.1| hypothetical protein CICLE_v10000924mg [Citrus clementina]
 gb|ESR48374.1| hypothetical protein CICLE_v10000924mg [Citrus clementina]
Length=504

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 174/233 (75%), Gaps = 0/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL+ L  +  S V+LTWDHIKAVLM V +AG+DTSAA ++WA+T LMK  R
Sbjct  267  KSEQEDIVDVLLQLWKQGGSKVDLTWDHIKAVLMDVLIAGTDTSAATLIWALTYLMKNCR  326

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ EIR  +  K  ++E+D+++L Y +AVVKETLR+ P  P+L+ RET   C ID 
Sbjct  327  VMKKVQEEIRSLIRNKDFVDEDDVEKLSYLRAVVKETLRMQPVAPLLIPRETTEKCKIDR  386

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K  VFVN+WAI RDPE WENP+EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG
Sbjct  387  YEIPQKTRVFVNAWAIGRDPETWENPNEFYPERFIDSPIDFKGQHFELIPFGAGRRICPG  446

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            I +G+ + +LALANLLY FDWE+P  +  +D+D +  PG+ +HKK PLCLV +
Sbjct  447  IQMGITTVDLALANLLYKFDWEMPFGMHNDDLDFDALPGLAVHKKNPLCLVPR  499



>ref|XP_010670987.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 175/236 (74%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKS   DI+D+L++LK E S +  LT DHIKA LM +FVAG+DT  A+IVW MT L + P
Sbjct  259  PKSAQEDIIDILLNLKNEGSFAFELTMDHIKATLMDMFVAGTDTMTAMIVWVMTELARNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M  VQ E+R+ +  KG + E+D+  L YFKAVVKET RL+PP PIL+ RE+L   TI+
Sbjct  319  DVMEKVQQELRNAIQNKGYVEEDDLSNLEYFKAVVKETFRLHPPGPILIPRESLEKNTIE  378

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I P  ++ +N WAI RDPE W++P  + PERFL + V++ G DF+FIPFG G+RVCP
Sbjct  379  GYDILPNTIISLNLWAIGRDPEFWDDPDSYKPERFLGSSVNFLGHDFQFIPFGSGKRVCP  438

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            G+ LGVA  EL +ANL+Y+FDWELP  LKKEDIDT+V  G+ MHKK PLCLVAK +
Sbjct  439  GLNLGVAVLELLVANLIYSFDWELPKGLKKEDIDTDVQHGVVMHKKNPLCLVAKPI  494



>ref|XP_003615846.1| Cytochrome P450 71B35 [Medicago truncatula]
Length=502

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++D LI LK +   S++L+ +HIK ++M + +AG+DT AA +VWAMTALMK PR+M  V
Sbjct  269  DVIDALIELKNDPYCSMDLSAEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKV  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR     KG I EED+Q+LPYFKAV+KE++RLYP +P+L+ RET+  C I+GYEI  
Sbjct  329  QEEIRKAYEGKGFIEEEDVQKLPYFKAVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPD  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV++N+WAI RDPE W++P EFYPERF+ + +D KGQDFE IPFG GRRVCPG+ + +
Sbjct  389  KTLVYINAWAIHRDPEAWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRVCPGLNMAI  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ +L LANLLY FDWE+P  +K E+ID +  PG+  HKK PLCL+AKK
Sbjct  449  ATVDLVLANLLYLFDWEMPEGVKWENIDIDGLPGLVQHKKNPLCLIAKK  497



>gb|KJB73271.1| hypothetical protein B456_011G224900 [Gossypium raimondii]
Length=505

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 174/230 (76%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DILDVL+ ++ +     +L  DHIKA+LM VF+AG+DT+AA ++WAM  LMK P+ +   
Sbjct  274  DILDVLLRIQKDRDFPFDLIIDHIKAILMDVFIAGTDTTAATVIWAMCFLMKNPKCLKKT  333

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q+E+RD +G KG +NEEDIQ L Y KAV+KET RL   VP+LV RETL  C++ GY++  
Sbjct  334  QAEVRDLIGTKGFVNEEDIQGLTYLKAVIKETFRLQTTVPLLVPRETLRKCSVGGYQVPA  393

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDPE WENP EF PERF+ + +DYKG +FE IPFG GRRVCPG+ +GV
Sbjct  394  KTLVYVNAWAIGRDPEAWENPEEFCPERFIGSSIDYKGLNFELIPFGAGRRVCPGMHMGV  453

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            A+ ELALANLLY FDWE+ + + K+DID ++ PG+T HKK  L LVA+K+
Sbjct  454  AAVELALANLLYKFDWEMSTGMNKKDIDFDIVPGLTTHKKNALILVARKI  503



>gb|AES98804.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 176/229 (77%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++D LI LK +   S++L+ +HIK ++M + +AG+DT AA +VWAMTALMK PR+M  V
Sbjct  273  DVIDALIELKNDPYCSMDLSAEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKV  332

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR     KG I EED+Q+LPYFKAV+KE++RLYP +P+L+ RET+  C I+GYEI  
Sbjct  333  QEEIRKAYEGKGFIEEEDVQKLPYFKAVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPD  392

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV++N+WAI RDPE W++P EFYPERF+ + +D KGQDFE IPFG GRRVCPG+ + +
Sbjct  393  KTLVYINAWAIHRDPEAWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRVCPGLNMAI  452

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ +L LANLLY FDWE+P  +K E+ID +  PG+  HKK PLCL+AKK
Sbjct  453  ATVDLVLANLLYLFDWEMPEGVKWENIDIDGLPGLVQHKKNPLCLIAKK  501



>gb|KHN35607.1| Cytochrome P450 83B1 [Glycine soja]
Length=501

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 176/229 (77%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK + S  V+L+ DHIKAVLM + V  +DT+ A+ VWAMTAL+K PR+M  V
Sbjct  270  DIVDVLLQLKKQRSFFVDLSNDHIKAVLMDMLVGATDTATAMTVWAMTALLKNPRVMKKV  329

Query  666  QSEIRDRVGKKGRINEED-IQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR+  GKK  + EED IQ+ PYFKAV+KE +RL+ P P+L  RET   C IDGYEI 
Sbjct  330  QEEIRNLGGKKDFLGEEDDIQKFPYFKAVLKEVMRLHLPAPLLSPRETNEACIIDGYEIP  389

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K +V+VN+WAI RDP+ W++P EF PERFLDN +D++GQDFE IPFG GRR+CPG+++ 
Sbjct  390  AKTIVYVNAWAIHRDPKAWKDPEEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGVSMA  449

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             A+ +L LANLL +FDW+LP+ +KKEDIDT V PG+  HKK PLC++AK
Sbjct  450  TATLDLILANLLNSFDWDLPAGMKKEDIDTEVLPGLAQHKKNPLCVLAK  498



>gb|KEH29139.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=345

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 174/228 (76%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK + S S ++ +DHIK +LM + VA +DT++A  VWAMTAL+K PR+M+ V
Sbjct  115  DIVDVLLELKKKRSFSFDINFDHIKGILMDMLVAATDTTSAASVWAMTALIKNPRVMSKV  174

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            + EIR+   KK  + E+DIQ  PY KA+VKETLRL+ P P+LV RE++ NCTI GY I  
Sbjct  175  KEEIRNLGVKKDFLYEDDIQNCPYLKAIVKETLRLHLPAPLLVPRESIENCTISGYNIPA  234

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K +++VN+WAI RDP+ W NP EFYPERFL++ +++ GQDFE IPFG GRR+CPGI + +
Sbjct  235  KTILYVNAWAIQRDPDIWINPEEFYPERFLESSINFIGQDFELIPFGAGRRICPGIPMAI  294

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS EL LANLLY+FDW LP  L KED+DT + PGIT HKK PL L+AK
Sbjct  295  ASLELILANLLYSFDWSLPDGLVKEDVDTEMLPGITQHKKNPLYLIAK  342



>ref|XP_006577403.1| PREDICTED: cytochrome P450 71A1-like, partial [Glycine max]
Length=309

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 174/229 (76%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK + S  V+L+ DHIKAVLM + V  +DT+ A+ VWAMTAL+K PR+M  V
Sbjct  78   DIVDVLLQLKKQRSFFVDLSNDHIKAVLMDMLVGATDTATAMTVWAMTALLKNPRVMKKV  137

Query  666  QSEIRDRVGKKGRINEED-IQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR+  GKK  + EED IQ+ PYFKAV+KE +RL+ P P+L  RE    C IDGYEI 
Sbjct  138  QEEIRNLGGKKDFLGEEDDIQKFPYFKAVLKEVMRLHLPAPLLAPREINEACIIDGYEIP  197

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K +V+VN+WAI RDP+ W++P EF PERFLDN +D++GQDFE IPFG GRR+CPG+++ 
Sbjct  198  AKTIVYVNAWAIHRDPKAWKDPEEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGVSMA  257

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             A+ +L LANLL +FDW+L + +KKEDIDT V PG+  HKK PLC++AK
Sbjct  258  TATLDLILANLLNSFDWDLLAGMKKEDIDTEVLPGLAQHKKNPLCVLAK  306



>gb|ACJ86287.1| unknown [Medicago truncatula]
Length=295

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 174/227 (77%), Gaps = 0/227 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            I+DVL+ LK  + SS++LT++HIKAVL+   VA +DT++A  VWAMTALMK PR+++  Q
Sbjct  66   IVDVLLHLKKHHLSSIDLTFNHIKAVLVDTIVAATDTTSAASVWAMTALMKNPRVLDKAQ  125

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             EIR+  G K  ++E D+Q LPY  AV+KETLRL+ P P+L+ RE+  NCTI+GY I  +
Sbjct  126  EEIRNLGGAKDYLDEGDLQNLPYLNAVIKETLRLHLPAPLLLFRESRENCTINGYNIPAR  185

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             +++VN+WAI RD   WEN  EFYPERFL++ +++ GQDFE I FG GRR+CPG+ + VA
Sbjct  186  TILYVNAWAIQRDHNVWENAEEFYPERFLESSINFTGQDFELILFGAGRRICPGLPMAVA  245

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            S +L LANLLY+FDW+LP  L KEDIDT++ PGIT HKK PLCLVAK
Sbjct  246  SLKLILANLLYSFDWKLPDGLVKEDIDTSMLPGITQHKKNPLCLVAK  292



>ref|XP_003522006.2| PREDICTED: cytochrome P450 83B1-like isoform X1 [Glycine max]
 gb|KHN38816.1| Cytochrome P450 83B1 [Glycine soja]
Length=503

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 172/230 (75%), Gaps = 0/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++DVL+ LK + S S++LT+DHIK VLM + VAG+DT+AA  VWAMTAL+K PR+M 
Sbjct  269  EHDMVDVLLQLKNDRSLSIDLTYDHIKGVLMDILVAGTDTTAATSVWAMTALIKNPRVMK  328

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ EIR+  G K  ++E+D+Q+L YFKA++KET RLYPP  +LV RE+   C I GY I
Sbjct  329  KVQEEIRNVGGTKDFLDEDDVQKLSYFKAMIKETFRLYPPATLLVPRESNEECIIHGYRI  388

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K +++VN+W I RDPE W+NP EF PERFLD+ VD++GQDF+ IPFG GRR CPG+ +
Sbjct  389  PAKTILYVNAWVIHRDPESWKNPQEFIPERFLDSDVDFRGQDFQLIPFGTGRRSCPGLPM  448

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             V   EL LANLL++FDWELP  + KEDID  V PG+T HKK  LCL AK
Sbjct  449  AVVILELVLANLLHSFDWELPQGMIKEDIDVQVLPGLTQHKKNDLCLCAK  498



>ref|XP_007134003.1| hypothetical protein PHAVU_010G010900g [Phaseolus vulgaris]
 gb|ESW05997.1| hypothetical protein PHAVU_010G010900g [Phaseolus vulgaris]
Length=497

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 178/233 (76%), Gaps = 0/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K  + D++DVL+ LK + S SV+L  DHIKAV M + +  +DT++A  VWAMTAL+K PR
Sbjct  262  KPENEDLIDVLLQLKKQRSFSVDLQNDHIKAVFMNMLIGATDTTSATTVWAMTALLKNPR  321

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ E+R+   +K  ++E+DIQ+LPY KAV+KETLRL+ P P+LV+RET   C ++G
Sbjct  322  VMKKVQEELRNLGNEKDFLHEDDIQKLPYLKAVIKETLRLHLPAPLLVQRETNEPCILEG  381

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K +V+VN+WAI RDP  W++P EF PERFLD+  D++GQDFEFIPFG GRR+CPG
Sbjct  382  YEIPAKTIVYVNAWAIHRDPNTWKDPEEFLPERFLDSTTDFRGQDFEFIPFGAGRRICPG  441

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            I + +AS +L LANLL +FDWELP  ++KEDIDT V PGIT HKK PL ++AK
Sbjct  442  ILMAIASLDLILANLLRSFDWELPPGIRKEDIDTEVLPGITQHKKNPLYVLAK  494



>ref|XP_002301993.2| Cytochrome P450 83A1 family protein [Populus trichocarpa]
 gb|EEE81266.2| Cytochrome P450 83A1 family protein [Populus trichocarpa]
Length=504

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 172/235 (73%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DILDVL+ +  + +  V LT DHIKA+LM +FV G+DT+AA ++WAM+ LMK+P
Sbjct  261  PKPDHEDILDVLLQIYKDRTFKVQLTLDHIKAILMNIFVGGTDTAAATVIWAMSLLMKKP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q E+R  +G KG + E+D+Q+LPY KAVVKET+RL P  P+LV RET + C I 
Sbjct  321  EAMRKAQEEVRKVIGDKGFVYEDDVQQLPYLKAVVKETMRLQPTAPLLVPRETTTECNIG  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K LV+VN+WAI RD E WENP+ F P+RFL + +D KGQDFE IPFG GRR+CP
Sbjct  381  GYEIPAKTLVYVNAWAIGRDTEVWENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDT-NVSPGITMHKKIPLCLVAK  163
            GI +G+A+ EL+L+NLLY FDWE+P  +K+EDID  +  PG+ MH +  LCLV K
Sbjct  441  GIYMGIATVELSLSNLLYKFDWEMPGGMKREDIDVDHTQPGLAMHTRDALCLVPK  495



>ref|XP_006473617.1| PREDICTED: cytochrome P450 71B35-like isoform X2 [Citrus sinensis]
Length=431

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 175/233 (75%), Gaps = 0/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K+   DI+DVL+ +  +  S V++TWDHIKAVLM V +AG+DT+AA ++WA+T LMK  R
Sbjct  194  KTDQEDIVDVLLQIWKQRGSKVDITWDHIKAVLMDVLIAGTDTTAATLIWALTYLMKNCR  253

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ EIR  +  K  ++E+D+++L Y +AVVKETLR+ P  P+L+ RET   C ID 
Sbjct  254  VMKKVQEEIRSLIRNKDFVDEDDVEKLSYLRAVVKETLRMQPVAPLLIPRETTEKCKIDR  313

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K  V VN+WAI RDPE WENP+EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG
Sbjct  314  YEIPQKTRVLVNAWAIGRDPEAWENPNEFYPERFIDSPIDFKGQHFELIPFGAGRRICPG  373

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + +G+A+ +LALANLLY FDWE+P  + K+D+D +  PG+ +HKK PLCLV +
Sbjct  374  LQMGIATVDLALANLLYKFDWEMPFGMHKDDLDFDALPGLAVHKKNPLCLVPR  426



>ref|XP_006445534.1| hypothetical protein CICLE_v10004105mg [Citrus clementina]
 gb|ESR58774.1| hypothetical protein CICLE_v10004105mg [Citrus clementina]
Length=506

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 172/229 (75%), Gaps = 3/229 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++ +    V+LT D+IKAVLM VFVAG+DTSAA +VWAMT L K PR M  V
Sbjct  276  DIIDVLLQIRKDRGFKVDLTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKV  335

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RE +  C ++GYEI 
Sbjct  336  QLEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIP  395

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K  VFVN+WAI RDPE W+NP EFYPERF+D+ +D+KGQ+FE IPFG GRR+CPG+ +G
Sbjct  396  AKTRVFVNAWAIGRDPEAWQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGLNMG  455

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + + ELALANLLY FDWE+P  LK  D D  V PG+ MHKK  L L AK
Sbjct  456  IVTVELALANLLYKFDWEMPPGLKSHDFD--VLPGLAMHKKNVLSLRAK  502



>ref|XP_006479316.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
Length=506

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 172/229 (75%), Gaps = 3/229 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++ +    V+LT D+IKAVLM VFVAG+DTSAA +VWAMT L K PR M  V
Sbjct  276  DIIDVLLQIRKDRGFKVDLTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKV  335

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RE +  C ++GYEI 
Sbjct  336  QLEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIP  395

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K  VFVN+WAI RDPE W+NP EFYPERF+D+ +D+KGQ+FE IPFG GRR+CPG+ +G
Sbjct  396  AKTRVFVNAWAIGRDPEAWQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGLNMG  455

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + + ELALANLLY FDWE+P  LK  D D  V PG+ MHKK  L L AK
Sbjct  456  IVTVELALANLLYKFDWEMPPGLKSHDFD--VLPGLAMHKKNVLSLRAK  502



>ref|XP_002510498.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52685.1| cytochrome P450, putative [Ricinus communis]
Length=496

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 176/229 (77%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            + LDVL+ ++ + S  + LT+DHIKA+LM +FVAG+DTSAA ++WA++ LMK P  M   
Sbjct  265  NFLDVLLQIQKDRSIKIQLTFDHIKAILMNIFVAGTDTSAAAVIWALSFLMKNPEAMRRA  324

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR   GKKG +NE++IQ+LPY KAVVKET+RL P VP+LV RET+  C + GY+I P
Sbjct  325  QDEIRKLTGKKGFVNEDNIQQLPYLKAVVKETMRLQPAVPLLVPRETIGKCNLGGYDIIP  384

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
              LV+VN+WAI RD E WE P EF PERFL++ +D KGQD+E IPFG GRR+CPGI +GV
Sbjct  385  STLVYVNAWAIGRDTEVWEKPLEFCPERFLESDIDMKGQDYELIPFGAGRRICPGIYIGV  444

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDT-NVSPGITMHKKIPLCLVAK  163
            A+ EL+LANLLY FDW++P  +K+EDIDT NV  GI++HK+  L LVA+
Sbjct  445  ANIELSLANLLYKFDWKMPDGMKREDIDTDNVLAGISVHKRDHLLLVAE  493



>gb|KDO38362.1| hypothetical protein CISIN_1g009872mg [Citrus sinensis]
Length=523

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 172/229 (75%), Gaps = 3/229 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++ +    V+LT D+IKAVLM VFVAG+DTSAA +VWAMT L K PR M  V
Sbjct  293  DIIDVLLQIRKDRGFKVDLTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKV  352

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RE +  C ++GYEI 
Sbjct  353  QLEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIP  412

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K  VFVN+WAI RDPE W+NP EFYPERF+D+ +D+KGQ+FE IPFG GRR+CPG+ +G
Sbjct  413  AKTRVFVNAWAIGRDPEAWQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGLNMG  472

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + + ELALANLLY FDWE+P  LK  D D  V PG+ MHKK  L L AK
Sbjct  473  IVTVELALANLLYKFDWEMPPGLKSHDFD--VLPGLAMHKKNVLSLRAK  519



>ref|XP_006443319.1| hypothetical protein CICLE_v10019709mg [Citrus clementina]
 gb|ESR56559.1| hypothetical protein CICLE_v10019709mg [Citrus clementina]
Length=525

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 172/229 (75%), Gaps = 3/229 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++ +    V+LT D+IKAVLM VFVAG+DTSAA +VWAMT L K PR M  V
Sbjct  293  DIIDVLLQIRKDRGFKVDLTLDNIKAVLMNVFVAGTDTSAATVVWAMTYLTKNPRAMKKV  352

Query  666  QSEIRDRVG-KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            Q EIR  +G  KG +NE+D+QEL Y KAVVKET+RL P VP+L+ RE +  C ++GYEI 
Sbjct  353  QLEIRSLIGGNKGFVNEDDVQELHYLKAVVKETMRLQPTVPLLLPREAIQKCIVEGYEIP  412

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K  VFVN+WAI RDPE W+NP EFYPERF+D+ +D+KGQ+FE IPFG GRR+CPG+ +G
Sbjct  413  AKTRVFVNAWAIGRDPEAWQNPEEFYPERFVDSCIDFKGQNFELIPFGAGRRICPGLNMG  472

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + + ELALANLLY FDWE+P  LK  D D  V PG+ MHKK  L L AK
Sbjct  473  IVTVELALANLLYKFDWEMPPGLKSHDFD--VLPGLAMHKKNVLSLRAK  519



>gb|KJB73931.1| hypothetical protein B456_011G262400 [Gossypium raimondii]
Length=497

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    DILDVL+    ++  S +LT D IKA+LM +F+AG+DTSAA I+W M+ LMK P+
Sbjct  261  KPQQEDILDVLLQTWKDHDFSFDLTIDQIKAILMNLFIAGTDTSAATIIWVMSFLMKNPK  320

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             +   Q+E+R+ +GKKG +NE+D ++L Y KAV+KET RL P  P+LV  ETL  C I G
Sbjct  321  CLKKTQAEVRNLIGKKGFVNEDDTRDLTYLKAVIKETFRLQPIAPLLVPLETLRKCKIGG  380

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I  K LV+VN+WAI +DPE WENP EFYPERF+ + +DYKGQ FE IPFG GRRVCPG
Sbjct  381  YDIPAKTLVYVNAWAIGKDPETWENPEEFYPERFICSPIDYKGQHFELIPFGAGRRVCPG  440

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + +GVA  ELALANLLY FDWE+P  + KEDID +  PGIT HKK  L LVA+K+
Sbjct  441  MHMGVAVVELALANLLYKFDWEMPIAMTKEDIDFDALPGITTHKKNALILVARKI  495



>ref|XP_006473616.1| PREDICTED: cytochrome P450 71B35-like isoform X1 [Citrus sinensis]
Length=504

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 175/233 (75%), Gaps = 0/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K+   DI+DVL+ +  +  S V++TWDHIKAVLM V +AG+DT+AA ++WA+T LMK  R
Sbjct  267  KTDQEDIVDVLLQIWKQRGSKVDITWDHIKAVLMDVLIAGTDTTAATLIWALTYLMKNCR  326

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ EIR  +  K  ++E+D+++L Y +AVVKETLR+ P  P+L+ RET   C ID 
Sbjct  327  VMKKVQEEIRSLIRNKDFVDEDDVEKLSYLRAVVKETLRMQPVAPLLIPRETTEKCKIDR  386

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K  V VN+WAI RDPE WENP+EFYPERF+D+ +D+KGQ FE IPFG GRR+CPG
Sbjct  387  YEIPQKTRVLVNAWAIGRDPEAWENPNEFYPERFIDSPIDFKGQHFELIPFGAGRRICPG  446

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + +G+A+ +LALANLLY FDWE+P  + K+D+D +  PG+ +HKK PLCLV +
Sbjct  447  LQMGIATVDLALANLLYKFDWEMPFGMHKDDLDFDALPGLAVHKKNPLCLVPR  499



>ref|XP_004491826.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=499

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 174/233 (75%), Gaps = 1/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K  + DI+DVL+ LK +   S++LT DHIKAV+M + VA +DTSAA  VW MT LMK PR
Sbjct  265  KEEEKDIVDVLLELKKQGRLSIDLTNDHIKAVVMDLLVAATDTSAATSVWVMTGLMKNPR  324

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M   Q EIR+  G K  I+E+DIQ+L YFKA++KETLR Y P P LV RET  N  ++G
Sbjct  325  VMKKAQEEIRNLCGNKEFIDEDDIQKLVYFKAIIKETLRFYAPAP-LVPRETNKNLNLNG  383

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I+PK LV+VN WAI RDPE W++P EFYPERFL+N VD+KGQDFEFIPFG GRR+CPG
Sbjct  384  YKIEPKTLVYVNVWAIHRDPETWKDPEEFYPERFLNNDVDFKGQDFEFIPFGAGRRICPG  443

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            I+LG+A+ E+  ANLL +FDWE+P  + +EDID    PG+  HKK  L LVAK
Sbjct  444  ISLGIATVEIITANLLNSFDWEMPKGMTREDIDIEGLPGLARHKKNHLFLVAK  496



>ref|XP_007010975.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY19785.1| Cytochrome P450, putative [Theobroma cacao]
Length=509

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 174/244 (71%), Gaps = 14/244 (6%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMI--------------VFVAGSDTSAALIVWA  709
            DI+DVL+ ++ + +  V+LT+DHIKAVLM               +FV G+DTSA +++WA
Sbjct  264  DIIDVLLQIRKDRAFQVDLTFDHIKAVLMTKSITLCNFFPFMQNMFVGGTDTSAVMVIWA  323

Query  708  MTALMKEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERE  529
            MT L+K PR M  VQ E+R+ +G  G +N +DIQ LPY KAV+KET RL P  P+L+ RE
Sbjct  324  MTFLLKNPRSMKKVQEEVRNLIGNNGFVNADDIQGLPYLKAVIKETFRLQPAAPLLLSRE  383

Query  528  TLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPF  349
            T+  C I G+EI  K LV VN+WAI RDPE  ENP EFYP RF+ + +DYKG DFE IPF
Sbjct  384  TIRKCDIGGHEIPAKTLVIVNAWAIGRDPEARENPKEFYPARFIGSSIDYKGLDFELIPF  443

Query  348  GGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G GRR CPG+ +G+A+ ELALANLLY FDWE+P  + K+D+D +V PG+ MHKK  LCLV
Sbjct  444  GAGRRGCPGLHMGIATVELALANLLYKFDWEMPVGMNKDDLDFDVIPGVVMHKKNALCLV  503

Query  168  AKKV  157
            A+K+
Sbjct  504  ARKI  507



>ref|XP_002510500.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52687.1| cytochrome P450, putative [Ricinus communis]
Length=497

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 173/235 (74%), Gaps = 0/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DILDVL+ +  + S   +LT DHIKA+LM VFV G+DTSAA +VWAMT LMK  
Sbjct  261  PKPEQEDILDVLLQIWKDRSFKAHLTPDHIKAILMNVFVGGTDTSAAAVVWAMTFLMKNS  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q E+R   GKKG ++E+D Q+L Y KAV+KET+RL P VP+L+ RE+  +C + 
Sbjct  321  IAMKKAQEEVRHIFGKKGFVDEDDTQQLVYLKAVIKETMRLQPTVPLLIPRESTQDCNLS  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K +V+VN+ AI RDPE WENP EF PERF+   VD KGQDFE +PFG GRR+CP
Sbjct  381  GYEIPAKTVVYVNALAIGRDPEVWENPEEFCPERFIGKSVDLKGQDFELVPFGAGRRICP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            GI +G+ + EL+LANLLY FDWE+P+ +KKED+D +V+PGI +HKK  LCL A++
Sbjct  441  GIFIGLVTVELSLANLLYKFDWEMPAGMKKEDLDMDVNPGIAVHKKNALCLEARE  495



>ref|XP_007017731.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14956.1| Cytochrome P450 [Theobroma cacao]
Length=500

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 166/231 (72%), Gaps = 0/231 (0%)
 Frame = -1

Query  849  GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNI  670
             DI+DVL+ +  +  S ++LT DHIKAVLM VF+AG+DTSAA ++W MT L++ PR +  
Sbjct  268  NDIIDVLLQISKDRDSGIDLTMDHIKAVLMNVFIAGTDTSAATVIWVMTFLIRNPRCLKK  327

Query  669  VQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            VQ EIR   GK   +NE+D+Q L Y KAV+KET RL P  P+L+ RET   C I  YEI 
Sbjct  328  VQEEIRSLTGKTSFVNEDDVQGLIYLKAVIKETFRLQPVTPLLLPRETKRKCNIGEYEIP  387

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
             K LV VN+WAI RDPE WENP EFYPERF+ + +DYKG DFE IPFG GRR CPGI + 
Sbjct  388  SKTLVHVNAWAIGRDPEAWENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGIHMA  447

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            V + ELALANLLY F+WE+P+ + KED+D +  PGI +HKK  LCLVA  +
Sbjct  448  VMTVELALANLLYKFNWEMPAGMNKEDLDFDALPGIVVHKKNALCLVASTI  498



>gb|AJD25155.1| cytochrome P450 CYP71AT91 [Salvia miltiorrhiza]
Length=506

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 185/232 (80%), Gaps = 0/232 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKS + +IL++LI LK ENSSS+ LTWDH+KA+LM +FVAG+DT AA ++WAMTAL+K P
Sbjct  261  PKSKNPNILELLIQLKNENSSSLALTWDHVKAILMDIFVAGTDTGAATVIWAMTALIKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  +Q E+ + VG++ +++E+D+ +LPY  AVVKE LRL+PP P+L+ RE++ +C I+
Sbjct  321  ETMKRLQKEMSELVGERRQVDEDDLAKLPYLSAVVKEALRLFPPAPLLLPRESIQSCNIN  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY I  K LVFVN+WAIARDP  WENP EF PERFL++ +D  G DFE IPFG GRR CP
Sbjct  381  GYAIPAKTLVFVNAWAIARDPNSWENPDEFVPERFLNSGIDVIGTDFEVIPFGAGRRGCP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            GIA+G+A+ ELALANL+++F WELP  + KEDIDT VSPG+TMHKK PLCL+
Sbjct  441  GIAMGLATVELALANLVHSFHWELPPGITKEDIDTQVSPGLTMHKKNPLCLM  492



>ref|XP_003521971.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=498

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI DVL+ LKM+   S++LT DHIKAVLM + VA +DT++   VWAM AL+K PR+M  V
Sbjct  268  DITDVLLQLKMQRLYSIDLTNDHIKAVLMDMLVAATDTTSTTTVWAMVALLKNPRVMKKV  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR   GKK  ++E+DIQ+ PYFKAV+KETLRLY P P+LV+RET   C IDGYEI  
Sbjct  328  QEEIRTLGGKKDFLDEDDIQKFPYFKAVIKETLRLYLPAPLLVQRETNEACIIDGYEIPA  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K +V+VN+WAI RDP+ W++P EF PERFLDN +D++GQDFE IPFG GRR+CPG+ + +
Sbjct  388  KTIVYVNAWAIHRDPKVWKDPDEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGMPMAI  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS +L LANLL +F+WELP+ + KEDIDT + PG++ HKK PL ++AK
Sbjct  448  ASLDLILANLLNSFNWELPAGMTKEDIDTEMLPGLSQHKKNPLYVLAK  495



>gb|KEH29140.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=497

 Score =   288 bits (736),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 174/228 (76%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK  + SS++LT+DHIKAVL  + VA +DT+AA  VWA+T+L+K PR+M  V
Sbjct  267  DIVDVLLQLKKHHLSSIDLTFDHIKAVLADMLVAATDTTAATSVWAITSLIKNPRVMKKV  326

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+   KK  I+E DIQ  PY KAV+KETLRL+ P P+LV RE+   C I GY+I  
Sbjct  327  QEEIRNLGSKKEFIDENDIQNFPYLKAVIKETLRLHLPTPLLVPRESREKCIISGYKIPA  386

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
              +V+VN+WAI RDP  W+NP EFYPERFL+   ++ GQDFEFIPFG GRR+CPGI++GV
Sbjct  387  NTIVYVNAWAIQRDPSNWKNPEEFYPERFLECSTNFLGQDFEFIPFGAGRRICPGISMGV  446

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS EL LANLLY+FDW+LP  L KEDIDT   PGIT HKK PLCLVAK
Sbjct  447  ASVELILANLLYSFDWKLPHGLVKEDIDTETLPGITQHKKNPLCLVAK  494



>ref|XP_006386182.1| hypothetical protein POPTR_0002s02700g [Populus trichocarpa]
 gb|ERP63979.1| hypothetical protein POPTR_0002s02700g [Populus trichocarpa]
Length=470

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 170/236 (72%), Gaps = 1/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DILDVL+ +  + +  V LT DHIKA+LM +FV G+DT+AA ++WAM+ LMK P
Sbjct  232  PKPDHEDILDVLLQIYKDRTFKVQLTLDHIKAILMNIFVGGTDTAAATVIWAMSLLMKNP  291

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q E+R  +  KG + E+D+Q+LPY KAVVKET+RL P  P+LV RET + C I 
Sbjct  292  EAMRKAQEEVRKVIADKGFVYEDDVQQLPYLKAVVKETMRLQPTAPLLVPRETTTECNIG  351

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K LV+VN+WAI RD E WENP+ F P+RFL + +D KGQDFE IPFG GRR+CP
Sbjct  352  GYEIPAKTLVYVNAWAIGRDTEVWENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICP  411

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDID-TNVSPGITMHKKIPLCLVAKK  160
            GI +G+A+ EL+L+NLLY FDWE+P  +K+EDID  +  PG+ MH +  LCL  ++
Sbjct  412  GIYMGIATVELSLSNLLYKFDWEMPGGMKREDIDVVHTQPGLAMHTRDALCLNKRR  467



>gb|KJB73272.1| hypothetical protein B456_011G225000 [Gossypium raimondii]
Length=503

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 172/235 (73%), Gaps = 0/235 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL+ +K       +LT DHIKA+LM VF+AG+DTSAA ++W M  LMK P+
Sbjct  267  KSEQEDIVDVLLRIKTNLDLPFDLTIDHIKAILMDVFIAGTDTSAATVIWVMNFLMKNPK  326

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             +   Q+E+RD + +KG ++E+++Q L Y KAV+KET RL   VP+LV RETL  C+I G
Sbjct  327  CLKKTQAEVRDLIREKGFVSEDEVQNLTYLKAVIKETFRLQATVPLLVPRETLRKCSIGG  386

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YE+  K LVFVN+WAI RDPE WENP EF PERF+ + +DYKG +FE IPFG GRRVCPG
Sbjct  387  YEVPTKTLVFVNAWAIGRDPEAWENPEEFCPERFIGSSIDYKGLNFELIPFGAGRRVCPG  446

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + +G+A  ELALANLLY FDWE+   + KEDID +V PG+T HKK  L L AKK+
Sbjct  447  MRMGIAVVELALANLLYKFDWEMLPEMNKEDIDFDVVPGLTTHKKNDLILTAKKI  501



>ref|XP_003615837.1| Cytochrome P450 71B37 [Medicago truncatula]
 ref|XP_003615842.1| Cytochrome P450 71B37 [Medicago truncatula]
Length=502

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++D LI LK +   S++LT +HIK ++M +  A ++T AA +VWAMTALMK PR M 
Sbjct  267  EDDVIDALIELKNDPYCSMDLTAEHIKPLIMNMSFAVTETIAAAVVWAMTALMKNPRAMQ  326

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ EIR     KG I EED+++LPYFKAV+KE++RLYP +PIL+ RET++NC I GY+I
Sbjct  327  KVQEEIRKVCAGKGFIEEEDVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDI  386

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K LV+VN+ AI RDPE W++P EFYPERF+ + +D KGQDFE IPFG GRR+CPG+ +
Sbjct  387  PDKTLVYVNALAIHRDPEVWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGLNM  446

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             +A+ +L L+NLLY+FDWE+P   K+EDIDT+   G+  HKK PLCLVAKK
Sbjct  447  AIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKK  497



>gb|KHN09046.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 174/231 (75%), Gaps = 1/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++D+L+ LK +   S++LT D IKA+++ + +AG+DT+AA  VW MT L+K PR M 
Sbjct  268  EKDLVDLLLELKKQGRLSIDLTDDQIKAIILDILIAGTDTTAATSVWVMTGLIKNPRAMG  327

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EIR+  G K  I EED+Q+L Y KAV+KETLR+Y P P LV RE + + TI+GYEI
Sbjct  328  KAQEEIRNLSGNKELIEEEDVQKLVYLKAVIKETLRVYAPTP-LVPREAIRSFTIEGYEI  386

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            +PK +V+VN W+I RDPE W++P EFYPERFL+N++D+KGQDFEFIPFG GRR+CPGI+L
Sbjct  387  QPKTIVYVNGWSIQRDPEAWKDPEEFYPERFLNNEIDFKGQDFEFIPFGAGRRICPGISL  446

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+A+ EL  ANLL +F WE+P  +K E IDT   PG+  HKK  LCLVAKK
Sbjct  447  GIATVELITANLLNSFHWEMPQGMKPEHIDTEGLPGLARHKKNHLCLVAKK  497



>ref|XP_003538072.1| PREDICTED: cytochrome P450 83B1 [Glycine max]
Length=499

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 174/231 (75%), Gaps = 1/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++D+L+ LK +   S++LT D IKA+++ + +AG+DT+AA  VW MT L+K PR M 
Sbjct  268  EKDLVDLLLELKKQGRLSIDLTDDQIKAIILDILIAGTDTTAATSVWVMTGLIKNPRAMG  327

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EIR+  G K  I EED+Q+L Y KAV+KETLR+Y P P LV RE + + TI+GYEI
Sbjct  328  KAQEEIRNLSGNKELIEEEDVQKLVYLKAVIKETLRVYAPTP-LVPREAIRSFTIEGYEI  386

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            +PK +V+VN W+I RDPE W++P EFYPERFL+N++D+KGQDFEFIPFG GRR+CPGI+L
Sbjct  387  QPKTIVYVNGWSIQRDPEAWKDPEEFYPERFLNNEIDFKGQDFEFIPFGAGRRICPGISL  446

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+A+ EL  ANLL +F WE+P  +K E IDT   PG+  HKK  LCLVAKK
Sbjct  447  GIATVELITANLLNSFHWEMPQGMKPEHIDTEGLPGLARHKKNHLCLVAKK  497



>gb|ABC59084.1| cytochrome P450 monooxygenase CYP83G1 [Medicago truncatula]
 gb|AES98795.2| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98800.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 175/231 (76%), Gaps = 0/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++D LI LK +   S++LT +HIK ++M +  A ++T AA +VWAMTALMK PR M 
Sbjct  271  EDDVIDALIELKNDPYCSMDLTAEHIKPLIMNMSFAVTETIAAAVVWAMTALMKNPRAMQ  330

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ EIR     KG I EED+++LPYFKAV+KE++RLYP +PIL+ RET++NC I GY+I
Sbjct  331  KVQEEIRKVCAGKGFIEEEDVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDI  390

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K LV+VN+ AI RDPE W++P EFYPERF+ + +D KGQDFE IPFG GRR+CPG+ +
Sbjct  391  PDKTLVYVNALAIHRDPEVWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGLNM  450

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             +A+ +L L+NLLY+FDWE+P   K+EDIDT+   G+  HKK PLCLVAKK
Sbjct  451  AIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKK  501



>ref|XP_006386181.1| hypothetical protein POPTR_0002s02690g [Populus trichocarpa]
 gb|ERP63978.1| hypothetical protein POPTR_0002s02690g [Populus trichocarpa]
Length=504

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 170/235 (72%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DILDVL+ +  + +  V LT DHIKA+LM +FV G+DT+AA ++WAM+ LMK P
Sbjct  261  PKPDHEDILDVLLQIYKDPTFKVQLTLDHIKAILMNIFVGGTDTAAATVIWAMSLLMKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q E+R  +G KG + E+D+Q+LPY KAVVKET+RL P  P+L+ RET + C I 
Sbjct  321  EAMRKAQEEVRKVIGDKGFVYEDDVQQLPYLKAVVKETMRLQPTAPLLIPRETTTECNIG  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K LV+VN+WAI RD E WENP+ F P+RFL + +D KGQDFE IPFG GRR+CP
Sbjct  381  GYEIPAKTLVYVNAWAIGRDTEVWENPYVFIPDRFLGSSIDLKGQDFELIPFGAGRRICP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDID-TNVSPGITMHKKIPLCLVAK  163
            GI +G+A+ EL+L+NLLY FDWE+P  +K+EDID  +  PG+ M  +  LCLV K
Sbjct  441  GIYMGIATVELSLSNLLYKFDWEMPGGMKREDIDVVHTQPGLAMRTRDALCLVPK  495



>ref|XP_011028970.1| PREDICTED: cytochrome P450 83B1-like [Populus euphratica]
Length=504

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 170/235 (72%), Gaps = 1/235 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DILDVL+ +  + +  V LT DHIKA+LM +FV G+DT+AA ++WAM+ LMK P
Sbjct  261  PKPDHEDILDVLLQIYKDRTFKVQLTLDHIKAILMNIFVGGTDTAAAAVIWAMSLLMKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M   Q E+R  +G KG + E+D+++LPY KAVVKET+RL P  P+L+ RET   C I 
Sbjct  321  EAMRKAQEEVRKVIGDKGFVYEDDVKQLPYLKAVVKETMRLQPTAPLLIPRETTKECYIG  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI  K LV+VN+WAI RD E WENP+ F P+RFL + +D KG DFE IPFG GRR+CP
Sbjct  381  GYEIPAKTLVYVNAWAIGRDTEVWENPYVFIPDRFLGSSIDLKGNDFELIPFGAGRRICP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDT-NVSPGITMHKKIPLCLVAK  163
            GI +G+A+ ELAL+NLLY FDWE+PS +K+EDID  +  PG+ +H +  LCLV K
Sbjct  441  GIFMGIATVELALSNLLYKFDWEMPSGMKREDIDVDHTQPGLALHTRDALCLVPK  495



>ref|XP_010670964.1| PREDICTED: cytochrome P450 71B9-like [Beta vulgaris subsp. vulgaris]
Length=496

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 172/235 (73%), Gaps = 2/235 (1%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL++L+ E S    LT DHIKA+LM +F+ G+DTS+ ++VWAMT L+K P 
Sbjct  264  KSEQEDIIDVLLNLRKERS--FELTLDHIKALLMNIFIGGTDTSSVMVVWAMTELVKNPH  321

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             M  VQ EIR+ +  KG +   D+ +  YFKAVVKET RL+P  P+LV  E +   TI G
Sbjct  322  AMKKVQDEIRNAIQNKGFVERYDLPKFKYFKAVVKETFRLHPAAPLLVPHEAVKRTTIYG  381

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I PK LV++N WAI RDP+ W++P +F PERF +  +D+KG DFE +PFG GRR+CPG
Sbjct  382  YDILPKTLVYINVWAIGRDPKLWKDPEKFMPERFFETSIDFKGNDFELLPFGAGRRMCPG  441

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + LG+ + ELALANLLY+FDWE+P  L  EDIDT+V PGI MHKK PLCLVAK++
Sbjct  442  LNLGIVNMELALANLLYSFDWEIPDGLAMEDIDTDVLPGIAMHKKNPLCLVAKEI  496



>ref|XP_010670952.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 175/236 (74%), Gaps = 3/236 (1%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL++L+ E S    LT DHIKA+LM +F+ G+DTS+ ++VWAMT L+K P 
Sbjct  265  KSEQEDIIDVLLNLRKERS--FELTLDHIKALLMNIFIGGTDTSSVMVVWAMTELVKNPH  322

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             M  VQ EIR+ +  K  + + D+ +  YFKAVVKET RL+P  P+LV  E +   TIDG
Sbjct  323  AMKKVQEEIRNGIQNKDFVEKHDLSKFKYFKAVVKETFRLHPAAPLLVSHEAVKRTTIDG  382

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I PK LV++N WAI RDP+ W++P +F PERF +  +D+KG DFE +PFG GRR+CPG
Sbjct  383  YDILPKTLVYINVWAIGRDPKLWKDPEKFMPERFFETLIDFKGNDFELLPFGAGRRMCPG  442

Query  321  IALGVASAELALANLLYAFDWELP-SWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + LG+ + ELALANLLY+FDWE+P + L KEDIDT+V PGI MHKK PLCL+AK++
Sbjct  443  LNLGIVNMELALANLLYSFDWEIPDNGLTKEDIDTDVLPGIVMHKKNPLCLLAKEI  498



>gb|ABD97102.1| cytochrome P450 monooxygenase CYP83G2 [Medicago truncatula]
Length=502

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 173/229 (76%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++D LI LK +   S++L+ +HIK ++M + +AG+DT AA +VWAMTALMK PR+M  V
Sbjct  269  DVIDALIELKNDPYCSMDLSAEHIKPLIMNMLLAGTDTIAAAVVWAMTALMKNPRVMQKV  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR     KG I EED+Q+LPYFKAV+KE++RLYP +P+L+ RET+  C I+GYEI  
Sbjct  329  QEEIRKAYEGKGFIEEEDVQKLPYFKAVIKESMRLYPSLPVLLPRETMKKCDIEGYEIPD  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K +   N+WAI RDPE W++P EFYPERF+ + +D KGQDFE IPFG GRRVCPG+ + +
Sbjct  389  KNIGVHNAWAIHRDPEAWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRVCPGLNMAI  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ +L LANLLY FDWE+P  +K E+ID +  PG+  HKK PLCL+AKK
Sbjct  449  ATVDLVLANLLYLFDWEMPEGVKWENIDIDGLPGLVQHKKNPLCLIAKK  497



>ref|XP_007134823.1| hypothetical protein PHAVU_010G079100g [Phaseolus vulgaris]
 gb|ESW06817.1| hypothetical protein PHAVU_010G079100g [Phaseolus vulgaris]
Length=496

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 175/233 (75%), Gaps = 0/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K+ + D++DVL+ LK +NS S++LT D IKAVLM + V  +DT+A   VW MT+L+K PR
Sbjct  261  KTAEEDLVDVLLQLKKDNSLSMDLTNDSIKAVLMNILVGATDTTAVTSVWVMTSLLKHPR  320

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ EIR   GKK  + E+D+Q+ PY +AV+KETLRL+ P P+LV RE+     IDG
Sbjct  321  VMKKVQEEIRSLSGKKPFLEEDDVQKFPYLQAVIKETLRLHLPAPLLVPRESSKKYMIDG  380

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K +++VN+WAI RDPE WE+  EF PERFL++ +D++GQDF FIPFG GR++CPG
Sbjct  381  YEIPAKTIIYVNAWAIHRDPEAWEDAEEFKPERFLNSTIDHRGQDFCFIPFGAGRKICPG  440

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + +  A+ ++ LANLLY+FDW LP  +K EDIDT V PG+TMHKK PLC++AK
Sbjct  441  MHMAFAALDVILANLLYSFDWALPDGMKSEDIDTEVLPGLTMHKKNPLCVLAK  493



>ref|XP_007017735.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14960.1| Cytochrome P450, putative [Theobroma cacao]
Length=526

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 172/230 (75%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ +  +   +++L+ DHIKA+L  VF+AG+D+SAA+++W MT LMK PR +  +
Sbjct  295  DIIDVLLRIWKDRDFAIDLSMDHIKAILKDVFIAGTDSSAAVVIWVMTYLMKNPRCLKKI  354

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+   +GKKG +NE+DIQ L Y KAV+KET RL P  P+L+ RET+  C I G+EI  
Sbjct  355  QEEVISLIGKKGFVNEDDIQNLTYLKAVIKETFRLQPIAPLLIPRETIRKCNIGGFEIPT  414

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDPE WENP EFYPERF+ + +DYKG DFE IPFG GRR CPGI +GV
Sbjct  415  KTLVYVNAWAIGRDPEAWENPKEFYPERFIGSSIDYKGLDFELIPFGAGRRGCPGIHMGV  474

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            A+ EL LANLLY F WE+P+ +  +D+D +V  G+++HKK  LCLVA ++
Sbjct  475  ATVELVLANLLYKFKWEMPAGMSNDDLDFDVKLGLSVHKKNALCLVANEI  524


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -1

Query  315  LGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPG  205
            +GVA+ ELALANLLY FDWE+P+ + KED+D +V P 
Sbjct  1    MGVATVELALANLLYKFDWEMPTGMNKEDLDFDVIPA  37



>ref|XP_010670976.1| PREDICTED: cytochrome P450 83B1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 172/235 (73%), Gaps = 2/235 (1%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL++LK +      LT DHIKA+LM +FVAG+DTS+ ++VWAMT L+K P 
Sbjct  263  KSPQEDIIDVLLNLKKQRC--FELTLDHIKALLMNIFVAGTDTSSVMVVWAMTELVKNPH  320

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             M  VQ EIR+ V  K  +++ D+ +  YFKAVVKET RL+P  P+LV  E++   TIDG
Sbjct  321  TMKKVQEEIRNVVQNKDFVDKNDLPKFKYFKAVVKETFRLHPAAPLLVAHESVKKTTIDG  380

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I PK LV +N WAI RDP+ W++P +F PERF +  +D KG DFE +PFG G R+CPG
Sbjct  381  YDILPKTLVHINIWAIGRDPKLWKDPEKFMPERFFETSIDLKGSDFELLPFGAGTRMCPG  440

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + LG+ + ELALANLLY+FDWE+P  L KEDIDT+V PGI MHKK PLCLVAK+ 
Sbjct  441  LNLGIVNMELALANLLYSFDWEIPDGLTKEDIDTDVLPGIAMHKKNPLCLVAKET  495



>ref|XP_003589393.1| Cytochrome P450 [Medicago truncatula]
 gb|AES59644.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=514

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 183/230 (80%), Gaps = 1/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+L+ +  ++S S +LT DHIKAVLM +F+AG+DTS+A +VWAMTALM  PR+MN V
Sbjct  282  DIIDILLQMMNDHSLSFDLTLDHIKAVLMNIFIAGTDTSSAAVVWAMTALMNNPRVMNKV  341

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+    K  INE+DI++LPY K+VVKETLRL+PP P+L+ RET+ +C IDGYEIKP
Sbjct  342  QMEIRNLYEDKDFINEDDIEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIKP  401

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAIARDPE W +P EFYPERF+ + VD+KG++FE IPFG GRR+CP + +GV
Sbjct  402  KTLVYVNAWAIARDPENWNDPEEFYPERFIISSVDFKGKNFELIPFGSGRRMCPAMNMGV  461

Query  306  ASAELALANLLYAFDWELPSWLKKEDI-DTNVSPGITMHKKIPLCLVAKK  160
             + EL LANLL++FDW+LP    KE + DT V PGITMHKKI L LV KK
Sbjct  462  VTVELTLANLLHSFDWKLPHGFDKEQVLDTQVKPGITMHKKIDLYLVPKK  511



>ref|XP_007134796.1| hypothetical protein PHAVU_010G077000g [Phaseolus vulgaris]
 gb|ESW06790.1| hypothetical protein PHAVU_010G077000g [Phaseolus vulgaris]
Length=500

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 177/232 (76%), Gaps = 0/232 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D+ D+++ L+ + SSS+ +T D +KA+LM + +A +D+S+A +VW MTAL+K PR+M 
Sbjct  268  NQDVTDIILKLQKQGSSSIEMTDDVVKAILMDLLLASTDSSSASLVWNMTALLKNPRVMK  327

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ EIR   G+K  ++E+D+Q+ PY KAV+KET R YPP PILV+RET   C I GYEI
Sbjct  328  KVQEEIRSVGGRKEFLDEDDVQKFPYLKAVIKETFRYYPPGPILVQRETNEACVIGGYEI  387

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K  ++VN+WAI +DP+ W+NP E+YPERFLD+ V Y+GQD+EF+PFG GRRVCPG+ +
Sbjct  388  PAKTTLYVNAWAIHKDPDNWKNPFEYYPERFLDSSVTYRGQDYEFLPFGSGRRVCPGMPM  447

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
             +AS +L LANLL AFDWELP+ +K +D+D    PG+T+HK+ PL L+AK+V
Sbjct  448  AIASLDLILANLLNAFDWELPAGMKPDDLDVLTDPGLTVHKRNPLHLLAKRV  499



>gb|EYU31745.1| hypothetical protein MIMGU_mgv1a017772mg [Erythranthe guttata]
Length=510

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 188/243 (77%), Gaps = 8/243 (3%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P SMDGD LD+LI L+ ++S+SV + W++IKA+LM + VAG +TSA+ IVWA+TAL K+P
Sbjct  266  PVSMDGDFLDLLIRLREDDSASVKIDWNNIKAILMNIVVAGMETSASAIVWALTALTKKP  325

Query  684  RIMNIVQSEIRDRVG--KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCT  511
              M   Q EIR  +   KK  ++E+DI++L Y KAV+KETLRLYPP+P+LV +ET+  C 
Sbjct  326  CAMKKAQQEIRSLMADSKKSFVDEDDIEKLTYLKAVIKETLRLYPPLPLLVPKETMEKCI  385

Query  510  IDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNK------VDYKGQDFEFIPF  349
            I+GY+I+PK   FVN WAI RDPE W+NP+EF PERFL+N       +D+KGQDF FIPF
Sbjct  386  INGYDIEPKTFAFVNVWAIGRDPEYWKNPNEFLPERFLNNNNSYDKSIDFKGQDFGFIPF  445

Query  348  GGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G GRR CPG++LGVA+ E+ALANLLY+FDWELP  +K+EDIDT+ S G TM KK PLCL+
Sbjct  446  GSGRRRCPGLSLGVAAVEMALANLLYSFDWELPPGVKEEDIDTDASEGFTMRKKNPLCLI  505

Query  168  AKK  160
            AK+
Sbjct  506  AKR  508



>gb|AFK34313.1| unknown [Medicago truncatula]
Length=506

 Score =   283 bits (723),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 174/231 (75%), Gaps = 0/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++D LI LK +   S++LT +HIK ++M +  A ++T AA +V AMTALMK PR M 
Sbjct  271  EDDVIDALIELKNDPYCSMDLTAEHIKPLIMNMSFAVTETIAAAVVRAMTALMKNPRAMQ  330

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ EIR     KG I EED+++LPYFKAV+KE++RLYP +PIL+ RET++NC I GY+I
Sbjct  331  KVQEEIRKVCAGKGFIEEEDVEKLPYFKAVIKESMRLYPILPILLPRETMTNCNIAGYDI  390

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K LV+VN+ AI RDPE W++P EFYPERF+ + +D KGQDFE IPFG GRR+CPG+ +
Sbjct  391  PDKTLVYVNALAIHRDPEVWKDPEEFYPERFIGSDIDLKGQDFELIPFGSGRRICPGLNM  450

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             +A+ +L L+NLLY+FDWE+P   K+EDIDT+   G+  HKK PLCLVAKK
Sbjct  451  AIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKK  501



>gb|KJB73277.1| hypothetical protein B456_011G225500 [Gossypium raimondii]
Length=510

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 174/235 (74%), Gaps = 0/235 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL+ ++ +++ S + T DHIKA+LM +F+AG+DT+AA ++W M+ LMK P+
Sbjct  274  KSEQDDIVDVLLRIRTDHNFSFDPTIDHIKAILMDIFIAGTDTAAATMIWVMSFLMKNPK  333

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             +   Q E+RD VG+KG +NE+D+Q L Y KAV+KET RL P  P+L+ RET   C+I G
Sbjct  334  CLKKAQVEVRDLVGEKGFVNEDDVQGLIYLKAVIKETFRLQPVAPLLLPRETRRKCSIGG  393

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YE+  K LV+VN+WAI R+PE WENP +F PERF+ + +DYKG +FE IPFG GRRVCPG
Sbjct  394  YEVPAKTLVYVNAWAIGREPEAWENPQDFRPERFIGSSIDYKGLNFELIPFGAGRRVCPG  453

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + +GVA  EL LANLLY FDWE+P+ + +ED+D +   G+T HKK  L L AK++
Sbjct  454  MHMGVAEVELGLANLLYKFDWEMPNGMNREDLDFDAVRGLTTHKKNALILQAKEI  508



>gb|AES59642.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=515

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = -1

Query  849  GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNI  670
             DI+D+ + +  +NS S +LT DH+KAVLM +F+AG+DTS+A++VWAMTALM  PR+MN 
Sbjct  282  ADIIDIFLQMMNDNSLSFDLTLDHVKAVLMNIFIAGTDTSSAVVVWAMTALMNNPRVMNK  341

Query  669  VQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            VQ EIR+    K  INE+DI++LPY K+VVKETLRL+PP P+L+ RET+ +C IDGYEIK
Sbjct  342  VQMEIRNLYEDKDFINEDDIEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIK  401

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
            PK LV+VN+WAIARDPE W +P EFYPERF+ + VD+KG++FE IPFG GRR+CP + +G
Sbjct  402  PKTLVYVNAWAIARDPENWNDPEEFYPERFIISSVDFKGKNFELIPFGSGRRMCPAMNMG  461

Query  309  VASAELALANLLYAFDWELPSWLKKEDI-DTNVSPGITMHKKIPLCLVAKK  160
            V + EL LANLL +FDW LP    KE + DT V PGITMHKKI L LV  K
Sbjct  462  VVTVELTLANLLQSFDWNLPHGFDKEQVLDTQVKPGITMHKKIDLHLVPMK  512



>ref|XP_003521997.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=502

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 175/230 (76%), Gaps = 0/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++DVL+ LK + S S++LT+DHIK VLM +  AG+DT+AA  VWAMTAL+K PR+M 
Sbjct  268  EQDMVDVLLQLKNDRSLSIDLTYDHIKGVLMNILAAGTDTTAATSVWAMTALVKNPRVMK  327

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R+  G K  ++E+DIQ+LPYFKA++KETLRL+ P P+LV RE+   C +DGY I
Sbjct  328  KVQEEVRNVGGTKDFLDEDDIQKLPYFKAMIKETLRLHLPGPLLVPRESTEECIVDGYRI  387

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K +V+VN+W I RDPE W+NP EF PERFLD+ +DY+GQDFE IPFG GRR+CPGI +
Sbjct  388  PAKTIVYVNAWVIQRDPEVWKNPEEFCPERFLDSAIDYRGQDFELIPFGAGRRICPGILM  447

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
               + EL LANLL++FDWELP  + KEDID  V PGIT HKK  LCL AK
Sbjct  448  AAVTLELVLANLLHSFDWELPQGIVKEDIDFEVLPGITQHKKNHLCLCAK  497



>ref|XP_003614173.1| Cytochrome P450 71B10 [Medicago truncatula]
 gb|AES97131.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=497

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 170/227 (75%), Gaps = 0/227 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            I+DVL+ LK E    ++LT+DHIK VLM + VA +DT++A  VWAMTAL+K PR+M  VQ
Sbjct  268  IVDVLLQLKKERLFPIDLTFDHIKGVLMNMLVAATDTTSATTVWAMTALIKNPRVMKKVQ  327

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             EIR+   KK  I+E+DIQ   Y KAV+KETLRLY P P+LV RET   CTI GY+I  K
Sbjct  328  QEIRNSKVKKEFIDEDDIQNFSYLKAVIKETLRLYLPAPLLVPRETREKCTIGGYQIPAK  387

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             +VFVN+WAI  DP  W+NP EFYPERFL++ +++ GQDFE IPFG GRR+CPG+++ VA
Sbjct  388  AVVFVNAWAIHTDPNVWKNPEEFYPERFLESSINFHGQDFELIPFGAGRRICPGMSMAVA  447

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            S EL LANLLY+FDWELP  L KEDIDT   PG+T HKK  LCL AK
Sbjct  448  SLELILANLLYSFDWELPDGLVKEDIDTERLPGLTQHKKNELCLAAK  494



>gb|ACU18750.1| unknown [Glycine max]
Length=502

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 175/230 (76%), Gaps = 0/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++DVL+ LK + S S++LT+DHIK VLM +  AG+DT+AA  VWAMTAL+K PR+M 
Sbjct  268  EQDMVDVLLQLKNDRSLSIDLTYDHIKGVLMNILAAGTDTTAATSVWAMTALVKNPRVMK  327

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R+  G K  ++E+DIQ+LPYFKA++KETLRL+ P P+LV RE+   C +DGY I
Sbjct  328  KVQEEVRNVGGTKDFLDEDDIQKLPYFKAMIKETLRLHLPGPLLVPRESTEECIVDGYRI  387

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K +V+VN+W I RDPE W+NP EF PERFLD+ +DY+GQDFE IPFG GRR+CPGI +
Sbjct  388  PAKTIVYVNAWVIQRDPEVWKNPEEFCPERFLDSAIDYRGQDFELIPFGAGRRICPGILM  447

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
               + EL LANLL++FDWELP  + KEDID  V PGIT HKK  LCL AK
Sbjct  448  AAVTLELVLANLLHSFDWELPQGIVKEDIDFEVLPGITQHKKNHLCLCAK  497



>gb|KHN38814.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 175/230 (76%), Gaps = 0/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + D++DVL+ LK + S S++LT+DHIK VLM +  AG+DT+AA  VWAMTAL+K PR+M 
Sbjct  265  EQDMVDVLLQLKNDRSLSIDLTYDHIKGVLMNILAAGTDTTAATSVWAMTALVKNPRVMK  324

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R+  G K  ++E+DIQ+LPYFKA++KETLRL+ P P+LV RE+   C +DGY I
Sbjct  325  KVQEEVRNVGGTKDFLDEDDIQKLPYFKAMIKETLRLHLPGPLLVPRESTEECIVDGYRI  384

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K +V+VN+W I RDPE W+NP EF PERFLD+ +DY+GQDFE IPFG GRR+CPGI +
Sbjct  385  PAKTIVYVNAWVIQRDPEVWKNPEEFCPERFLDSAIDYRGQDFELIPFGAGRRICPGILM  444

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
               + EL LANLL++FDWELP  + KEDID  V PGIT HKK  LCL AK
Sbjct  445  AAVTLELVLANLLHSFDWELPQGIVKEDIDFEVLPGITQHKKNHLCLCAK  494



>gb|KEH16181.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES77612.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=501

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 172/230 (75%), Gaps = 1/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + DI+DVL+ LK +   S++LT DHIK+VLM + VA +DT++A  VWAMT LMK PR M 
Sbjct  270  EKDIVDVLLELKNQGRLSIDLTNDHIKSVLMNLLVAATDTTSATSVWAMTGLMKNPRAMK  329

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EIR+  GKK  I+E+DIQ+L Y KAV+KETLR Y P P L  RET  +  ++G++I
Sbjct  330  KAQEEIRNICGKKEFIDEDDIQKLVYLKAVIKETLRFYAPAP-LAPRETSKSFILNGHKI  388

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            +PK  VFVN WAI RDPE W++P EFYPERFL+N +D+KG+DFE IPFG GRR+CPG+ L
Sbjct  389  EPKTSVFVNIWAIHRDPEAWKDPDEFYPERFLNNDIDFKGRDFELIPFGAGRRICPGMPL  448

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+A+ E+ +ANLL +FDWE P  + KEDIDT   PG++ HKK  LCLVAK
Sbjct  449  GIATVEMIIANLLNSFDWETPEGMTKEDIDTEGLPGLSRHKKNHLCLVAK  498



>ref|XP_007134004.1| hypothetical protein PHAVU_010G011000g [Phaseolus vulgaris]
 gb|ESW05998.1| hypothetical protein PHAVU_010G011000g [Phaseolus vulgaris]
Length=502

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 180/233 (77%), Gaps = 0/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K  + D++DVL+ LK + S SV+L  DHIKAV M + VA +DT++A  +WAMTAL+K PR
Sbjct  267  KPENEDLIDVLLQLKNQRSFSVDLENDHIKAVFMNMLVAATDTTSATTIWAMTALLKNPR  326

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ E+R+  G+K  ++E+DIQ+ PYFKA++KETLRL+ P P+LV RET   C ++G
Sbjct  327  VMKKVQEELRNLGGEKDFLHEDDIQKFPYFKAMIKETLRLHLPAPLLVPRETNEPCILEG  386

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K +V+VN+WAI RDP  W++P EF PERFLD+  D++GQDFEFIPFG GRR+CPG
Sbjct  387  YEIPAKTIVYVNAWAIHRDPNTWKDPEEFLPERFLDSTTDFRGQDFEFIPFGAGRRICPG  446

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + + +AS +L LANLL +FDWELPS ++KEDIDT V PGIT HKK PL ++AK
Sbjct  447  MLMAIASLDLILANLLRSFDWELPSGMRKEDIDTEVLPGITQHKKNPLYVLAK  499



>ref|XP_010677521.1| PREDICTED: cytochrome P450 71A1-like [Beta vulgaris subsp. vulgaris]
Length=495

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 170/235 (72%), Gaps = 2/235 (1%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            KS   DI+DVL++LK E S    LT DHIKA+LM +FVAG+DTS+ ++VWAM  L+K P 
Sbjct  263  KSSQEDIIDVLLNLKKERS--FELTLDHIKALLMNIFVAGTDTSSVMVVWAMMELVKNPH  320

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             M  VQ EIR+ V  K  + + D+ +  YFKAVVKET RL+P  P+L+  E +   TIDG
Sbjct  321  TMTKVQEEIRNVVRNKDFVEKNDLPKFKYFKAVVKETFRLHPAAPLLIPHEAVKRTTIDG  380

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I PK LV++N WAI RD + W++P +F PERF +  +D KG DFE +PFG GRR+CPG
Sbjct  381  YDILPKTLVYINIWAIGRDSKLWKDPEKFMPERFFETSIDLKGNDFELLPFGAGRRMCPG  440

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + LG+ + ELALANLLY+FDWE+P  L KEDIDT+V  G+ MHKK PLCLVAK+ 
Sbjct  441  LNLGIVNMELALANLLYSFDWEIPDGLTKEDIDTDVLSGLAMHKKNPLCLVAKET  495



>ref|XP_006358826.1| PREDICTED: cytochrome P450 71B37-like [Solanum tuberosum]
Length=187

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  708  MTALMKEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERE  529
            MTAL+K P++M  VQ EIR  +G KG +NE+D+Q +PY KAV+KET RLYPP P+LV RE
Sbjct  1    MTALIKNPKVMKKVQEEIRKSIGTKGFVNEDDVQNMPYLKAVIKETFRLYPPAPLLVPRE  60

Query  528  TLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPF  349
            T+   T++GYEI+P  ++ VNSWAIARDPE WENP EF PERFL++ +D+KGQDFE +PF
Sbjct  61   TMKKSTLEGYEIQPGTIIHVNSWAIARDPEIWENPKEFMPERFLNSDIDFKGQDFELLPF  120

Query  348  GGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G GRR CPGIALGVA+ +L L+NLLYAFDWELP  +KKEDIDT+V PGI MHKK  LCLV
Sbjct  121  GAGRRGCPGIALGVATVDLMLSNLLYAFDWELPYGMKKEDIDTDVMPGILMHKKNDLCLV  180

Query  168  AKKV  157
             KK+
Sbjct  181  PKKI  184



>ref|XP_012075259.1| PREDICTED: cytochrome P450 83B1-like [Jatropha curcas]
 gb|KDP35270.1| hypothetical protein JCGZ_09429 [Jatropha curcas]
Length=497

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 170/229 (74%), Gaps = 1/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ +  + SS V+L+ +HIK V+M +FV  SDT  A ++WAMT LMK P  M  +
Sbjct  268  DIVDVLLQIWKDGSSKVDLSLNHIKGVIMNIFVGASDTITATVIWAMTYLMKNPIAMKKI  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  VG KG +NE+DI  L Y K VVKETLR+ PP+PI + RE+  +C IDGY+I  
Sbjct  328  QEEVRGIVGNKGLVNEDDIPNLSYLKLVVKETLRMQPPIPI-IPRESTQDCRIDGYQIPA  386

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K ++ VN +AI RDP+ WENP EF PERF+   +D+KGQ+ E IPFG GRR+CPGI++G+
Sbjct  387  KTVIHVNLFAIGRDPQAWENPEEFCPERFIGKFIDFKGQNCELIPFGAGRRLCPGISIGL  446

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            A+ EL LANLLY FDWELP+ +KKED+D +  PGITMHKK  LCL+A++
Sbjct  447  ATVELCLANLLYKFDWELPNGMKKEDLDMDTQPGITMHKKNALCLMARR  495



>ref|XP_003589391.1| Cytochrome P450 [Medicago truncatula]
Length=538

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = -1

Query  849  GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNI  670
             DI+D+ + +  +NS S +LT DH+KAVLM +F+AG+DTS+A++VWAMTALM  PR+MN 
Sbjct  305  ADIIDIFLQMMNDNSLSFDLTLDHVKAVLMNIFIAGTDTSSAVVVWAMTALMNNPRVMNK  364

Query  669  VQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
            VQ EIR+    K  INE+DI++LPY K+VVKETLRL+PP P+L+ RET+ +C IDGYEIK
Sbjct  365  VQMEIRNLYEDKDFINEDDIEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIK  424

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
            PK LV+VN+WAIARDPE W +P EFYPERF+ + VD+KG++FE IPFG GRR+CP + +G
Sbjct  425  PKTLVYVNAWAIARDPENWNDPEEFYPERFIISSVDFKGKNFELIPFGSGRRMCPAMNMG  484

Query  309  VASAELALANLLYAFDWELPSWLKKEDI-DTNVSPGITMHKKIPLCLVAKK  160
            V + EL LANLL +FDW LP    KE + DT V PGITMHKKI L LV  K
Sbjct  485  VVTVELTLANLLQSFDWNLPHGFDKEQVLDTQVKPGITMHKKIDLHLVPMK  535



>ref|XP_011074242.1| PREDICTED: cytochrome P450 71B36-like [Sesamum indicum]
Length=502

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 172/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  822  LKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRV  643
            LK +N  S NLTWDH+KA+LM +F+AG DTS A I+W MTALMK P +M  VQ EIR+ V
Sbjct  281  LKEQNVLSSNLTWDHVKAMLMDIFIAGIDTSTASIIWTMTALMKAPDVMKKVQIEIRELV  340

Query  642  GKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNS  463
            G+KG+++E  IQ LPY +AV+ E+LRLYPP+P L+ RET+ +C ++ Y+I+ K +V+VN+
Sbjct  341  GRKGKVDEVYIQNLPYLRAVINESLRLYPPIP-LIPRETMEDCILEDYKIQAKSMVYVNA  399

Query  462  WAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALA  283
            WAIARDPE WE+P  F+P+RFL+  VD KG  F  +PFG GRR+CPGI +G+A+ EL +A
Sbjct  400  WAIARDPEYWEDPDTFFPDRFLNCDVDIKGHHFGVLPFGSGRRICPGIYMGLANVELTVA  459

Query  282  NLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            NLLY+FDWEL S ++++DIDT+  PGIT+ KK PL LV KK
Sbjct  460  NLLYSFDWELQSGMQEQDIDTDSLPGITVLKKNPLLLVPKK  500



>ref|XP_010270695.1| PREDICTED: cytochrome P450 71A9-like [Nelumbo nucifera]
 ref|XP_010246210.1| PREDICTED: cytochrome P450 71A9-like [Nelumbo nucifera]
Length=509

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 162/226 (72%), Gaps = 0/226 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+ VL+ ++ +    ++LT DHIKA LM +FVAG+DTS A +VW MT LMK PR+M   
Sbjct  276  DIIHVLLQIRKDAIGGIDLTIDHIKAALMDIFVAGTDTSTAALVWGMTELMKNPRVMRKA  335

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR+ + KK  + E D+++L Y +AVVKE LR++PP P+L  RET+  C I GY I P
Sbjct  336  QDEIRNAIRKKRMVEESDLEQLQYLRAVVKEILRMHPPGPLLAPRETMEECKISGYNIFP  395

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  V V+ WAI RDP+CWENP EFYPERF+D  +D+KG  FE +PFG GRR CPGI LG 
Sbjct  396  KTRVIVSPWAIGRDPKCWENPEEFYPERFMDGSIDFKGLHFELVPFGAGRRHCPGINLGA  455

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            A   LAL+N+LY+FDW+LP  + KEDID   +PG+T HKK+ L LV
Sbjct  456  AIVTLALSNILYSFDWKLPCGMNKEDIDMEETPGLTTHKKLALHLV  501



>ref|NP_001240228.1| cytochrome P450 83B1-like precursor [Glycine max]
 gb|ABC68397.1| cytochrome P450 monooxygenase CYP83E8 [Glycine max]
 gb|KHN35611.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ LK  N+  ++LT D+IKAVL+ + V  + T+    +WAMT L+K P IM  V
Sbjct  269  DLVDVLLQLKENNTFPIDLTNDNIKAVLLNLLVGATGTTEVTTIWAMTELIKNPSIMKKV  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR   GKK  ++E+DIQ+  Y +AV+KETLRL+ P P+L+ RET   C +DGYEI  
Sbjct  329  QEEIRGLSGKKDFLDEDDIQKFSYLRAVIKETLRLHLPAPLLIPRETNKKCMLDGYEIPA  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K L++VN+WAI RDP+ W++P EF PERFL+  +D  GQDFEFIPFG GRR+CPG+ +  
Sbjct  389  KTLLYVNAWAIHRDPKAWKDPEEFIPERFLNCDIDLYGQDFEFIPFGAGRRLCPGMNMAF  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            A+ +L LANLLY+FDWELP  +KKEDIDT V PG+T HKK PLC+VAK
Sbjct  449  AALDLILANLLYSFDWELPQGMKKEDIDTEVLPGVTQHKKNPLCVVAK  496



>ref|XP_010064675.1| PREDICTED: cytochrome P450 71A1-like [Eucalyptus grandis]
Length=513

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 176/228 (77%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D +DVL+ +  + S SV+++ DHIKA+L  +F+  +DT+AA + WAMT+L K PR+M+  
Sbjct  281  DFIDVLLRMGEDRSGSVHVSRDHIKAMLTDIFIGATDTNAATLAWAMTSLKKNPRVMDKA  340

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR  VG KG ++E+D+  LPY KAVVKETLRLYPP P+L+ RET   C + GYEI+P
Sbjct  341  QREIRSLVGSKGFVDEDDLLSLPYLKAVVKETLRLYPPAPLLLPRETTGRCILSGYEIRP  400

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV++N+WAI RD E WE+  EF PERFLD+ VD++GQ FE +PFG GRRVCPG +LGV
Sbjct  401  KTLVYINAWAIGRDSEYWESAEEFCPERFLDSDVDFRGQSFELVPFGCGRRVCPGASLGV  460

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             + ELALANLLY+FDWELP  +K+ED+DT  +PG T+HKKIPLCL AK
Sbjct  461  VTLELALANLLYSFDWELPEGMKEEDVDTEATPGNTIHKKIPLCLRAK  508



>dbj|BAF98468.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=499

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 171/232 (74%), Gaps = 1/232 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSS-SVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            K+   DI+DVL+ L+  + S +  LT   +K +LM VF+ G +TSA  +VW MT L + P
Sbjct  261  KAEKEDIVDVLLGLQTHDQSGATRLTISQVKGILMNVFIGGVETSALTMVWTMTELARNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            ++M  VQ EIR+ VGKKGR+ E  I +LPYFK VVKETLRL+PP P+LV RE +S+C I+
Sbjct  321  KVMKKVQEEIRNCVGKKGRVEEIYINQLPYFKMVVKETLRLHPPGPLLVPRECMSHCKIN  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY++ PK  V VN+W IAR  E WE P EF PERF ++ VD+KGQDFE++PFG GRR CP
Sbjct  381  GYDVYPKTRVLVNAWGIARSSEYWEKPDEFIPERFQNSSVDFKGQDFEYLPFGSGRRACP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G+ +GVA+ E+ALANLLY F+WELPS +K ED++ +   GIT+HKK+PL LV
Sbjct  441  GMNMGVATMEVALANLLYCFNWELPSGMKSEDVNIDEKAGITIHKKVPLHLV  492



>ref|XP_011087278.1| PREDICTED: cytochrome P450 71A9-like [Sesamum indicum]
Length=495

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/238 (59%), Positives = 181/238 (76%), Gaps = 2/238 (1%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK+M+GDILD+L+ L  + SSS+  T DHIKA+LM + +AG+D +  L +WAMT LMK P
Sbjct  260  PKAMEGDILDILLGLMRDGSSSI-ATMDHIKAILMNILIAGTDANITLTIWAMTILMKNP  318

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  VQ+EIR+ +GKK  I+E +I  LPY +AV+KE LRL+PP P+L  RETL  CT++
Sbjct  319  IPMKKVQTEIRN-LGKKDLIDENEIASLPYLRAVIKEVLRLFPPAPLLAPRETLQECTVN  377

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+PK LV++N+WAI RDPE W++  EF PERFL++++D KG D E IPFG GRR CP
Sbjct  378  GYEIQPKTLVYINAWAIGRDPEVWKDAEEFVPERFLNSEIDVKGHDPELIPFGIGRRGCP  437

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV*F  151
            G+ + +A AELALANLLYAFDWELP  +K ED+D +V PG+ M KK PLCL+AK V F
Sbjct  438  GMMMAMAMAELALANLLYAFDWELPPGMKDEDLDFDVEPGLAMPKKNPLCLLAKPVQF  495



>ref|XP_010272816.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=501

 Score =   278 bits (710),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 164/229 (72%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D L+ ++ + +S+++ T D IKA+LM + +AG+DT+ + +VWAMT L K P +M   
Sbjct  268  DIVDTLLRMQKDKTSTIDFTLDTIKAILMDILIAGADTTTSTLVWAMTLLAKNPTVMKKA  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q+E+R  +G KG+I E+D+ +  Y K V+KETLRL PP P+LV RET+ +C IDGY I P
Sbjct  328  QNEVRSLIGNKGKITEDDLHQFHYLKCVIKETLRLQPPAPLLVPRETMKHCIIDGYHIYP  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  + VN+W I RDPE WENP EF PERF  + +D++GQ FEFIPFG GRR+CPG+ LGV
Sbjct  388  KTQLLVNAWTIGRDPEYWENPEEFIPERFTKSSIDFRGQHFEFIPFGSGRRICPGMQLGV  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
               EL LANLLY+F+WELP  +K+EDID      I MHKK  L LVA K
Sbjct  448  VIVELILANLLYSFNWELPEGIKEEDIDMEALFAIIMHKKNNLHLVATK  496



>ref|XP_011074244.1| PREDICTED: cytochrome P450 83B1-like [Sesamum indicum]
Length=374

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 180/234 (77%), Gaps = 0/234 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K+M+ DILDVLI LK +   S +LTWDHIKA+LM +F+AG+DT+    +W MTALMK P 
Sbjct  139  KTMEEDILDVLIRLKEQKVLSSDLTWDHIKAMLMNIFIAGTDTAITSTIWTMTALMKAPD  198

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            +M  VQ+EIR+ +G K +++E DIQ L Y +A++ ETLRLYPP P+L+ RET+  C +DG
Sbjct  199  VMKKVQAEIRELIGIKCKVDEADIQNLSYMRAIISETLRLYPPGPLLLPRETIEKCILDG  258

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI+PK +V+VN+WAI+RDPE WE+P  F PERFL+N V+ KG DF+ +PFG GRR CPG
Sbjct  259  YEIQPKTMVYVNAWAISRDPEYWEDPLAFLPERFLNNGVNMKGNDFKVVPFGSGRRSCPG  318

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + +G+A+ ELA+ANLLY FDWELP  ++ +DIDT+   GI M KK PLCLV K+
Sbjct  319  MHMGLANVELAVANLLYFFDWELPPGMQAQDIDTDSMLGIIMLKKNPLCLVPKQ  372



>ref|XP_004499226.1| PREDICTED: cytochrome P450 71B37-like [Cicer arietinum]
Length=513

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 187/231 (81%), Gaps = 2/231 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D+ + +K ++S S +LT DHIKAVLM +F+AG+DTS+A++VWAMTALM  PR+M  V
Sbjct  278  DIIDIFLKMKNDHSLSFDLTLDHIKAVLMNIFIAGTDTSSAIVVWAMTALMNNPRVMEKV  337

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q+EIR+    K  INE+DI++LPY K+V+KETLRL+PP P+L+ RET+ +C I+GYEI+P
Sbjct  338  QAEIRNLYKDKDFINEDDIEKLPYLKSVIKETLRLFPPSPLLLPRETIESCNIEGYEIQP  397

Query  486  KMLVFVNSWAIARDPECWENPHEFYPER-FLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
            K LV+VN+WAIARDPE W++P EFYPER F+++ VD+KG++FE IPFG GRR+CP + +G
Sbjct  398  KTLVYVNAWAIARDPENWKDPEEFYPERFFMNSSVDFKGKNFELIPFGSGRRMCPAMNMG  457

Query  309  VASAELALANLLYAFDWELPSWLKKEDI-DTNVSPGITMHKKIPLCLVAKK  160
            V + EL+LANL+++FDW+LP    KE + DT V PGITMHKKI L LV +K
Sbjct  458  VVTIELSLANLIHSFDWKLPCGFDKEKVLDTQVKPGITMHKKIDLYLVPRK  508



>ref|XP_003621357.1| Cytochrome P450 71B37 [Medicago truncatula]
 gb|ABC59083.1| cytochrome P450 monooxygenase CYP83E9 [Medicago truncatula]
 gb|AES77575.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 171/230 (74%), Gaps = 3/230 (1%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + DI+DVL+ LK +   S++LT +HIKAV+M + VA +DTSAA  VW MT L+K PR M 
Sbjct  271  EKDIVDVLLELKNQGRLSIDLTNNHIKAVVMNLLVAATDTSAATSVWVMTGLIKNPRAMK  330

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EIR+   KK  I+E+DIQ+  YFKAV+KETLR Y P P L  RET  + T++GY+I
Sbjct  331  KAQEEIRNI--KKEFIDEDDIQKFVYFKAVIKETLRFYSPAP-LAPRETSKSFTLNGYKI  387

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            +PK  VFV+ W+I RDPE W++P EFYPERFL+N +D+KGQ+FEFIPFG GRR+CPGI L
Sbjct  388  EPKTSVFVSIWSIHRDPETWKDPDEFYPERFLNNDIDFKGQNFEFIPFGAGRRICPGIPL  447

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+A+ E+  ANLL +FDWE+P  + KEDIDT   PG+  HKK  LCLVAK
Sbjct  448  GIATVEMITANLLNSFDWEMPEGMTKEDIDTEGLPGLARHKKNHLCLVAK  497



>gb|KDO50377.1| hypothetical protein CISIN_1g010151mg [Citrus sinensis]
Length=516

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 177/236 (75%), Gaps = 7/236 (3%)
 Frame = -1

Query  849  GDILDVLISLKMENSSSV--NLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIM  676
            GDI+DVL+ ++ +         TWD+IKAVLM VFV  +DTSAAL+ WAMT ++K PR+M
Sbjct  280  GDIVDVLLQVQKDRGEDQVHGFTWDNIKAVLMNVFVGATDTSAALMTWAMTNVVKNPRVM  339

Query  675  NIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
               Q E+RD +G KG ++E+D+++LPY KA++KET RLYPPVPI + RET  +C IDGY+
Sbjct  340  EKAQKEVRDLIGDKGFVDEDDLEKLPYIKAILKETFRLYPPVPI-IPRETTKSCVIDGYQ  398

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFL---DNKVDYKGQ-DFEFIPFGGGRRVC  328
            +  K LV++N WAI+RDPE WE P +F P+RF+    + ++  GQ ++E IPFGGGRR C
Sbjct  399  VPAKTLVYLNGWAISRDPEVWERPDDFDPDRFIIGDKSNIELTGQNNYELIPFGGGRRFC  458

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            PGI +G+A+ ELA+ANLLY FDWE+P+ +K +D+D +++PGI MHKK PL LVA K
Sbjct  459  PGIHMGIANLELAIANLLYKFDWEMPARMKIQDLDFDIAPGIIMHKKHPLYLVAIK  514



>ref|XP_007140954.1| hypothetical protein PHAVU_008G155000g [Phaseolus vulgaris]
 gb|ESW12948.1| hypothetical protein PHAVU_008G155000g [Phaseolus vulgaris]
Length=499

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 168/231 (73%), Gaps = 1/231 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            + DI+DVL+ LK     S+NLT D IKA+++ + VAG+DT+AA  VW MT LMK PR M 
Sbjct  268  EKDIVDVLLELKKHGRLSINLTHDQIKAIILDILVAGTDTTAATSVWVMTGLMKNPRAMA  327

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q EI++  G K  I EED+++L Y +AV+KETLR YPP P LV RE +    IDGYEI
Sbjct  328  KAQEEIKNVCGNKEFIEEEDVEKLVYLQAVIKETLRFYPPAP-LVPREAIRGFRIDGYEI  386

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            +PK +V+VN WAI RDPE W++P E+ PERFL N++D+ GQDF+FIPFG GRR+CPGI+L
Sbjct  387  EPKTIVYVNGWAIQRDPEAWKDPEEYLPERFLKNEIDFNGQDFKFIPFGAGRRICPGISL  446

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            G+AS  L +ANLL +F WELP+ +K E IDT   PG+  HKK  L +VAKK
Sbjct  447  GMASVVLIIANLLNSFHWELPAGMKPEHIDTEGLPGLARHKKNHLFVVAKK  497



>ref|XP_006432552.1| hypothetical protein CICLE_v10000886mg [Citrus clementina]
 ref|XP_006471349.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
 gb|ESR45792.1| hypothetical protein CICLE_v10000886mg [Citrus clementina]
Length=516

 Score =   276 bits (706),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 176/236 (75%), Gaps = 7/236 (3%)
 Frame = -1

Query  849  GDILDVLISLKMENSSSV--NLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIM  676
            GDI+DVL+ ++ +         TWD+IKAVLM VFV  +DTSAAL+ WAMT ++K PR+M
Sbjct  280  GDIVDVLLQVQKDRGEDQVHGFTWDNIKAVLMNVFVGATDTSAALMTWAMTNVVKNPRVM  339

Query  675  NIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
               Q E+RD +G KG ++E+D+++LPY KA++KET RLYPPVPI + RET  +C IDGY+
Sbjct  340  EKAQKEVRDLIGDKGFVDEDDLEKLPYIKAILKETFRLYPPVPI-IPRETTKSCVIDGYQ  398

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFL---DNKVDYKGQ-DFEFIPFGGGRRVC  328
            +  K LV++N WAI+RDPE WE P +F P+RF+    + ++  GQ ++E IPFGGGRR C
Sbjct  399  VPAKTLVYLNGWAISRDPEVWERPDDFDPDRFIIGDKSNIELTGQNNYELIPFGGGRRFC  458

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            PGI +G+A+ ELA+ANLLY FDWE+P+ +K +D+D +++PGI MHKK PL L A K
Sbjct  459  PGIHMGIANLELAIANLLYKFDWEMPAEMKIQDLDFDIAPGIVMHKKHPLYLAATK  514



>ref|XP_011085392.1| PREDICTED: cytochrome P450 83B1-like [Sesamum indicum]
Length=505

 Score =   275 bits (704),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 173/237 (73%), Gaps = 10/237 (4%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+D++I LK +N+SS++L+WDHIKA+LM +FVAG+DT AA ++WAMT LM  P +M   
Sbjct  265  DIIDLMIQLKDQNTSSLDLSWDHIKALLMNLFVAGTDTVAAAVIWAMTGLMLNPAVMKKA  324

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETL-SNCTIDGYEIK  490
            Q+EIR  +G+KG+++E+DI+ LPY KAVV ETLRLYPP P+L   + L  +C +DGY+IK
Sbjct  325  QTEIRQFIGEKGKVDEDDIKNLPYLKAVVLETLRLYPPAPLLFRTQILDEDCVVDGYKIK  384

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNK-----VDYKGQDFEFIPFGGGRRVCP  325
            P   V +N WAI RDPE W++P EF PERF+ +      V  K  +FE IPFGGGRR CP
Sbjct  385  PGTSVIINGWAIGRDPETWQDPEEFQPERFMTSNGGVVDVSDKTGEFEMIPFGGGRRGCP  444

Query  324  GIALGVASAELALANLLYAFDWELPSWL----KKEDIDTNVSPGITMHKKIPLCLVA  166
            G+ +G+ SAELALANLLY+FDW LP+       ++ IDT   PG+T HKK PL LVA
Sbjct  445  GMGMGLISAELALANLLYSFDWALPAVAPGSNAQDVIDTVALPGLTTHKKSPLLLVA  501



>ref|XP_007017733.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14958.1| Cytochrome P450, putative [Theobroma cacao]
Length=406

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ +  +   +V+LT DHIKAVLM VFVAG+DTSAA ++W MT LMK PR +   
Sbjct  146  DIIDVLLQIWKDREFAVDLTIDHIKAVLMNVFVAGTDTSAASVIWVMTFLMKNPRCLKKA  205

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  +GKK  +NE+D Q L Y KAV+KET RL   VP+LV RET+    I GYEI  
Sbjct  206  QEEVRSLMGKKDFVNEDDTQALTYLKAVIKETFRLQAIVPLLVPRETMRKSNISGYEIPA  265

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K LV+VN+WAI RDPE WENP EFYPERF+ + +DYKG DFE IPFG GRR C GI +GV
Sbjct  266  KTLVYVNAWAIGRDPEAWENPEEFYPERFIGSSIDYKGLDFELIPFGAGRRGCLGIHMGV  325

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPG  205
             + ELALANLLY FDWE+P+ + KED+D +V PG
Sbjct  326  VTVELALANLLYKFDWEMPTGMNKEDLDFDVIPG  359



>ref|XP_010272814.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=522

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 163/228 (71%), Gaps = 0/228 (0%)
 Frame = -1

Query  849  GDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNI  670
            GDI D+L+ +  +++S ++LT DHIKAV+  + +AG+DT+ A +VWAMT L K PR+M  
Sbjct  284  GDITDLLLQMHKDHTSEIDLTLDHIKAVMTDILLAGTDTTTATLVWAMTFLAKHPRVMEK  343

Query  669  VQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIK  490
             Q E+R+ +  K  I+E D+ +L Y K VVKETLRL P  P+LV RE+   C +DGY+I 
Sbjct  344  AQEEVRNLIRNKQNISEYDLHQLHYLKCVVKETLRLQPAAPLLVPRESRKQCNLDGYKIH  403

Query  489  PKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
            PK  + VN+W I RDPE WENP EF PERF+++ +D+KGQ FE+IPFG GRR+CPGI  G
Sbjct  404  PKTQILVNAWTIGRDPEFWENPEEFRPERFINSSIDFKGQCFEYIPFGSGRRICPGINFG  463

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            +   EL LANLLY+FDWELP  +K  DID     G+T+HKK  LCL+A
Sbjct  464  MVIVELVLANLLYSFDWELPPGIKTADIDMEELSGLTVHKKNALCLLA  511



>ref|XP_004516029.1| PREDICTED: cytochrome P450 83B1-like [Cicer arietinum]
Length=496

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 173/228 (76%), Gaps = 3/228 (1%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            I+DVL+ LK +   S++LT+DHIK VLM + VAG+DT++A +V+AMTAL+K PR+M  VQ
Sbjct  268  IVDVLLQLKKQRLFSIDLTFDHIKGVLMNMLVAGTDTTSATVVFAMTALIKNPRVMKKVQ  327

Query  663  SEIRD-RVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
             E+R  RV  K  ++E+DIQ   Y KAV+KETLRL+ P P+LV RE+   CTI GYEI  
Sbjct  328  EEVRSSRV--KDFLDEDDIQNFSYLKAVIKETLRLHLPAPLLVPRESREKCTIAGYEIPA  385

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            + ++FVN+WAI RDP+ W++P EFYPERFL+N +++ G+DFE +PFG GRR+C G+++ V
Sbjct  386  RTILFVNAWAIHRDPDIWKDPEEFYPERFLENSINFLGKDFELMPFGAGRRICAGLSMAV  445

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS EL LANL+Y+FDWELP  L++EDID    PG+T HKK  LCL  K
Sbjct  446  ASLELILANLIYSFDWELPHGLREEDIDFERWPGLTQHKKDDLCLCPK  493



>gb|AET50435.1| putative cytochrome P450 [Citrus sinensis]
Length=209

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -1

Query  756  VFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRVG-KKGRINEEDIQELPYFKAVV  580
            +FVAG+DTSAA +VW MT LM  PR+M  VQ EIR  VG  K  ++E+D+QEL Y KAVV
Sbjct  2    IFVAGTDTSAATMVWTMTYLMMHPRVMKKVQEEIRSLVGGNKSFVDEDDVQELHYLKAVV  61

Query  579  KETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERF  400
            KE +RL PPVP+LV RET   C +DGYEI  K +V+VN+WAI RDPE WENP EF PERF
Sbjct  62   KEAMRLQPPVPLLVPRETTEKCIVDGYEIPAKTIVYVNAWAIGRDPEAWENPEEFNPERF  121

Query  399  LDNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDT  220
            +D  +D+KGQ+FEFIPFG GRR+CPG+ LG+A+ +LALANLLY FDWE+P  +KK+D++ 
Sbjct  122  IDRSIDFKGQNFEFIPFGAGRRICPGMHLGIATVDLALANLLYKFDWEMPPGMKKQDLNF  181

Query  219  NVSPGITMHKKIPLCLVAK  163
            +   G T+HKK  L L+AK
Sbjct  182  DSLSGTTVHKKNFLVLLAK  200



>gb|KEH29137.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 169/227 (74%), Gaps = 0/227 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            I+DVL+ LK E    ++LT+DHIK VLM + VA + T++A  VWAMTAL+K PR+M  VQ
Sbjct  269  IVDVLLQLKKERLFPIDLTFDHIKGVLMNMLVAATGTTSATAVWAMTALIKNPRVMKKVQ  328

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             EIR+   KK  I+E+DI+ L Y KAV+KETLRLY P P+L  RET   CTI+G++I  K
Sbjct  329  QEIRNSRVKKEFIDEDDIRNLSYLKAVIKETLRLYLPAPLLAPRETTEKCTINGFQIPAK  388

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             +VFVN+WAI  D   W+NP EFYPERFL++ +++ GQDFE IPFG GRR+CPG+++ VA
Sbjct  389  AIVFVNAWAIHTDSNVWKNPEEFYPERFLESSLNFHGQDFELIPFGAGRRICPGMSMAVA  448

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            S EL L+NLLY+FDWELP  L KEDIDT   PG+T HKK  LCL AK
Sbjct  449  SLELILSNLLYSFDWELPDGLIKEDIDTERWPGLTQHKKNELCLAAK  495



>ref|XP_002512136.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50805.1| cytochrome P450, putative [Ricinus communis]
Length=441

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = -1

Query  756  VFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVK  577
            +FVAG+DTSAA ++WAM  L+K PR M   Q E+R+ VGKKG ++E+DIQ+LPY KAVVK
Sbjct  240  MFVAGTDTSAASVIWAMCFLLKNPREMEKAQEEVRNLVGKKGFVDEDDIQKLPYLKAVVK  299

Query  576  ETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFL  397
            E +RL PPVP+L+ RET+  C + GY+I PK LV+VN++A+ RDPE W+NP EF+PERFL
Sbjct  300  EMMRLQPPVPLLIPRETVHRCKLGGYDIPPKTLVYVNAFAVGRDPEAWDNPLEFHPERFL  359

Query  396  DNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTN  217
            ++ +D KG ++E IPFG GRRVCPGI +G+A+ E+ALANLLY FDWE+P+ +K+EDID +
Sbjct  360  NSDIDMKGNNYELIPFGAGRRVCPGIFMGIANVEIALANLLYRFDWEMPAGMKREDIDID  419

Query  216  -VSPGITMHKKIPLCLVAKK  160
             V+PGI +HKK  LCL+AKK
Sbjct  420  GVNPGIVVHKKGDLCLMAKK  439



>ref|XP_006493394.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
Length=378

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 166/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++  + + ++LTW HIKAVLM VFVAG+DTS A +VW+MT LM+ P  M   
Sbjct  148  DIIDVLLRIRKNSETKIDLTWKHIKAVLMDVFVAGTDTSVATLVWSMTNLMRNPATMKKA  207

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R     KG ++E+D++ L Y KAV+KET RL PPVP L+ R T   C +DGY+I+ 
Sbjct  208  QEEVRSVAKNKGFVDEDDLETLQYLKAVLKETFRLQPPVP-LIPRSTAEECVVDGYKIEA  266

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNK-VDYKGQDFEFIPFGGGRRVCPGIALG  310
            K L +VN+ AI RD E W+ P EF PERF+    VD++GQ FE +PFG GRR+CPGI++ 
Sbjct  267  KTLAYVNTLAIGRDSEVWDKPDEFIPERFMGTDCVDFQGQHFELLPFGSGRRICPGISMA  326

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + + ELALANLLY FDW++P  +K ED+D ++ PG+ MHKKIPL L+A K
Sbjct  327  MRTLELALANLLYKFDWKMPDGMKNEDLDYDIPPGVAMHKKIPLKLMATK  376



>ref|XP_006473076.1| PREDICTED: cytochrome P450 83B1-like [Citrus sinensis]
Length=511

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 174/236 (74%), Gaps = 7/236 (3%)
 Frame = -1

Query  849  GDILDVLISLKMENSSS--VNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIM  676
            GDI+DVL+ ++ + +       + D+IKAVLM VFV  +DTSAA + WAMT +MK PR+M
Sbjct  275  GDIIDVLLQVQKDRAEDEVHGFSRDNIKAVLMNVFVGATDTSAATMTWAMTNVMKNPRVM  334

Query  675  NIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
               Q E+RD +G KG ++E+D+Q+LPY KA++KET RL PP PI + RET  +C IDGYE
Sbjct  335  EKAQKEVRDLIGNKGFVDEDDLQKLPYIKAILKETFRLNPPGPI-IPRETTKSCMIDGYE  393

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFL---DNKVDYKGQ-DFEFIPFGGGRRVC  328
            I  K LV++N WAI+RDPE WE P EF P+RF+    + ++  GQ ++E IPFGGGRR C
Sbjct  394  IPAKTLVYLNGWAISRDPEVWERPDEFDPDRFIIGDKSYIELTGQNNYELIPFGGGRRFC  453

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            PG  +G+A+ ELA+ANLLY FDWE+P+ +K +D+D +++PGI MHKK PLCLVA K
Sbjct  454  PGTHMGIATLELAIANLLYKFDWEMPAGMKIQDLDFDIAPGIVMHKKNPLCLVATK  509



>ref|XP_011028965.1| PREDICTED: cytochrome P450 83B1-like [Populus euphratica]
Length=511

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 166/229 (72%), Gaps = 1/229 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            ILD L+ +  + S  V LT DHIKA+L  +FVAG+DT A  ++WAMT LMK P+ M   Q
Sbjct  271  ILDFLLQIYKDGSFKVQLTLDHIKAILTDIFVAGTDTGAVTVIWAMTFLMKNPKAMRKAQ  330

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             E+R+  G KG ++E+D+Q+LPY KAVVKET+RL P  P+L+ RET   C + GYEI  K
Sbjct  331  EEVRNLFGNKGFVHEDDVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECYVAGYEIPTK  390

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             LV+VN+WA+ RDPE WENP+EF P+RFL + +D KG DFE IPFG GRR+CPGI + +A
Sbjct  391  TLVYVNAWAVGRDPEAWENPYEFDPDRFLGSSIDLKGNDFELIPFGAGRRICPGIFIALA  450

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + EL+LANLL+ FDWE+PS ++  D+D +V PG+  H +  LCLV K V
Sbjct  451  TVELSLANLLHKFDWEMPSGVEDIDMD-DVLPGLVPHMRDALCLVPKLV  498



>ref|XP_003521973.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=502

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 177/228 (78%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI DVL+ LK +   S++LT DHIKAVLM + VA +DT+AA  VWAMTAL+K PR+M  V
Sbjct  268  DITDVLLQLKKQRLYSIDLTNDHIKAVLMDMLVAATDTTAATTVWAMTALLKNPRVMKKV  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR   GKK  ++E+DIQ+ PYFKAV+KETLRLY P P+L +RET   C IDGYEI  
Sbjct  328  QEEIRTLGGKKDFLDEDDIQKFPYFKAVIKETLRLYLPAPLLAQRETNEACIIDGYEIPA  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K +V+VN+WAI RDP+ W++P EF PERFLDN +D++GQDFE IPFG GRR+CPG+ + +
Sbjct  388  KTIVYVNAWAIHRDPKAWKDPDEFLPERFLDNTIDFRGQDFELIPFGAGRRICPGMPMAI  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS +L LANLL +FDWELP+ + KEDIDT + PG+T HKK PL ++AK
Sbjct  448  ASLDLILANLLNSFDWELPAGMTKEDIDTEMLPGLTQHKKNPLYVLAK  495



>ref|XP_002300723.2| hypothetical protein POPTR_0002s02800g [Populus trichocarpa]
 gb|EEE79996.2| hypothetical protein POPTR_0002s02800g [Populus trichocarpa]
Length=513

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            ILD L+ +  + S  V LT DHIKA+LM +F+AG+DTSA  + WAMT LMK P+ M   Q
Sbjct  271  ILDFLLQIYKDGSFKVQLTLDHIKAILMDIFLAGTDTSAVTMNWAMTFLMKNPKAMRKAQ  330

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             E+R+  G KG ++E+D+Q+LPY KAVVKET+RL P  P+L+ RET   C + GYEI  K
Sbjct  331  EEVRNLFGNKGFVDEDDVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECCVGGYEIPAK  390

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             LV+V++WA+ RDPE WENP+EF P+RFL + +D KG DFE IPFG GRR+CPGI + +A
Sbjct  391  TLVYVSAWAVGRDPEAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGIFIALA  450

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + EL+LANLL+ FDWE+PS ++  D+D +V PG+  H +  LCLV K V
Sbjct  451  TVELSLANLLHKFDWEMPSGVEDIDMD-DVLPGLVPHMRDALCLVPKFV  498



>ref|XP_010912890.1| PREDICTED: cytochrome P450 71A9-like [Elaeis guineensis]
Length=496

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 168/227 (74%), Gaps = 4/227 (2%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ L+ +     +LT DHIKAVLM +F+AG+DT++A + WAM  L + PR+M   
Sbjct  267  DIIDVLLRLQRDG----HLTKDHIKAVLMDIFIAGTDTASATLEWAMAELARHPRLMKKA  322

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR  +G KG++ E D+ +L Y K+VVKET RL+ PVP+L+ RE++ +  I GY+I P
Sbjct  323  QEEIRASLGTKGKVEEGDLHQLQYLKSVVKETWRLHSPVPLLLPRESIRHSRIHGYDILP  382

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
               V+VN+W IA+DP+ W++P EF PERF+D+ +DYKG +FEFIPFG GRR+CPG+ LG 
Sbjct  383  NTRVYVNAWGIAKDPKSWDDPEEFIPERFMDSSIDYKGHNFEFIPFGSGRRICPGMNLGT  442

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
             + ELALA++LY FDWELP  + +EDID N +PGIT+HK   L LVA
Sbjct  443  LTVELALASMLYHFDWELPVGMTREDIDMNEAPGITVHKSSALHLVA  489



>ref|XP_002300724.2| hypothetical protein POPTR_0002s02740g [Populus trichocarpa]
 gb|EEE79997.2| hypothetical protein POPTR_0002s02740g [Populus trichocarpa]
Length=503

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 166/227 (73%), Gaps = 1/227 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            ILD L+ +  + S  V LT DHIKA+LM +F+AG+DTSA  + WAMT LMK P+ M   Q
Sbjct  271  ILDFLLQIYKDGSFKVQLTLDHIKAILMDIFLAGTDTSAVTMNWAMTFLMKNPKAMRKAQ  330

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             E+R+  G KG ++E+D+Q+LPY KAVVKET+RL P  P+L+ RET   C + GYEI  K
Sbjct  331  EEVRNLFGNKGFVHEDDVQQLPYLKAVVKETMRLQPTAPLLIPRETTKECCVGGYEIPAK  390

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             LV+V++WA+ RDPE WENP+EF P+RFL + +D KG DFE IPFG GRR+CPGI + +A
Sbjct  391  TLVYVSAWAVGRDPEAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGIFIALA  450

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            + EL+LANLL+ FDWE+PS ++  D+D +V PG+  H +  LCLV K
Sbjct  451  TVELSLANLLHKFDWEMPSGVEDIDMD-DVLPGLVPHMRDALCLVPK  496



>ref|XP_010256342.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=506

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 168/226 (74%), Gaps = 0/226 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI D+L+ ++ +  SS++L  + IKA++M +F AG+DTS+A+++WAMT L K P++M   
Sbjct  274  DITDILLRMQKDGLSSIDLNMNDIKAMIMNIFFAGTDTSSAVVIWAMTELSKNPKVMQKA  333

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR  +G KG ++E+D+ +  Y K V+KETLRL+PP P+LV+RE  ++CTIDG++I P
Sbjct  334  QDEIRGLIGNKGYVDEDDLHQFHYLKCVIKETLRLHPPGPLLVQREARNHCTIDGFDIYP  393

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  V +N+WAI  DPE WENP EF PERF D  VD+KGQ +E+IPFG GRR+CPG+ LG+
Sbjct  394  KTRVIINAWAIGMDPETWENPEEFLPERFSDGSVDFKGQHYEYIPFGSGRRMCPGMNLGM  453

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
             + E  L+NLLY+FDW+LP  +K EDID +  PG+ +HKK  L L+
Sbjct  454  VTVEHTLSNLLYSFDWDLPVGIKMEDIDMDELPGVAVHKKNDLRLL  499



>ref|XP_010271424.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=512

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 177/233 (76%), Gaps = 0/233 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK  + DI DVL+ +  ++SSS++L  +HIKA+ M +F+AG+DT+AA +VWAM+ L K+P
Sbjct  273  PKPQEEDIADVLLRMHKDHSSSLHLKMEHIKALFMNIFIAGTDTTAATVVWAMSELAKKP  332

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  VQ E+R  VG KG I+E+D+ +L Y K VVKETLRL+PP P+L+ RET+++C ID
Sbjct  333  IAMKKVQDELRSLVGNKGHIDEDDVNQLHYLKYVVKETLRLHPPTPLLLPRETINHCKID  392

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY+I PK  VFVN WAI  +PE W+NP EF PERF+D  VD+KGQ FEFIPFG GRR+CP
Sbjct  393  GYDIYPKTQVFVNGWAIGMEPEIWKNPEEFIPERFIDGSVDFKGQHFEFIPFGSGRRICP  452

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            G+ +GVA+ EL LANLLY+F+WELP  +K EDI  +  PGIT+ KK PL L+A
Sbjct  453  GMHVGVATVELILANLLYSFNWELPDGMKNEDIHMDELPGITVKKKTPLLLLA  505



>ref|XP_011094079.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=501

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 175/243 (72%), Gaps = 10/243 (4%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSMDGD++D+L+ L+ + S  + L  DHIKAVLM V+ A +DT A  IVWAMTAL+K P
Sbjct  259  PKSMDGDVVDILLQLRKDGSFDIPL--DHIKAVLMNVYFASTDTIATTIVWAMTALIKNP  316

Query  684  RIMNIVQSEIRDRVGKKGR--INEEDIQ--ELPYFKAVVKETLRLYPPVPILVERETLSN  517
             ++  VQ+E+R     + +  + EEDI   +LPYF AV+KE LRLY  +P+L+ RE + +
Sbjct  317  SVLKKVQAELRALPMPQNKPLVEEEDIAMAQLPYFNAVIKEVLRLYSTIPLLLPREAIKD  376

Query  516  CTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNK----VDYKGQDFEFIPF  349
            CTIDGYEI  K LV VN+WAI++DPE W++P EF PERF+ ++    +D KG DF  IPF
Sbjct  377  CTIDGYEIPAKTLVHVNAWAISKDPELWKDPFEFKPERFMGDERKFTLDLKGTDFGLIPF  436

Query  348  GGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G GRR CPGI + +A+ E+ + NLLY FDW LP  +KKEDID ++ PG+TMHKK PL LV
Sbjct  437  GSGRRGCPGITMALATLEIVMVNLLYLFDWRLPDGMKKEDIDNDIEPGLTMHKKNPLFLV  496

Query  168  AKK  160
            AKK
Sbjct  497  AKK  499



>ref|XP_007017738.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14963.1| Cytochrome P450, putative [Theobroma cacao]
Length=431

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 150/200 (75%), Gaps = 0/200 (0%)
 Frame = -1

Query  756  VFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVK  577
            VF+ G+DTSAA ++W MT LMK PR +  +Q E++  VGKK  +NE+DIQ L YFKAV+K
Sbjct  229  VFIGGTDTSAATVIWVMTFLMKNPRCLKKIQEEVKSLVGKKCFVNEDDIQSLTYFKAVIK  288

Query  576  ETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFL  397
            E  RL P  P+LV RET+  C I G EI  K L+ VN+WAI RDP+ W+NP EFY ERF+
Sbjct  289  EAFRLQPIAPLLVPRETMRKCNIGGNEIPAKTLIHVNAWAIGRDPQAWKNPKEFYSERFI  348

Query  396  DNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTN  217
             + +DYKG DFE IPFG GRR CPGI +GVA+ ELALANLLY FDWE+P+ + KED+D +
Sbjct  349  GSSIDYKGLDFELIPFGAGRRGCPGIHMGVATLELALANLLYKFDWEMPAGMNKEDLDFD  408

Query  216  VSPGITMHKKIPLCLVAKKV  157
            V PGITMHKK  LCLVA ++
Sbjct  409  VIPGITMHKKNALCLVAHEI  428



>gb|KDO55355.1| hypothetical protein CISIN_1g010727mg [Citrus sinensis]
Length=502

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 166/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++  + + ++LTW HIKAVLM VFVAG+DTS A +VW+MT LM+ P  M   
Sbjct  272  DIIDVLLRIRKNSETKIDLTWKHIKAVLMDVFVAGTDTSVATLVWSMTNLMRNPATMKKA  331

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R     KG ++E+D++ L Y KAV+KET RL PPVP L+ R T   C +DGY+I+ 
Sbjct  332  QEEVRSVAKNKGFVDEDDLETLQYLKAVLKETFRLQPPVP-LIPRSTAEECVVDGYKIEA  390

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNK-VDYKGQDFEFIPFGGGRRVCPGIALG  310
            K L +VN+ AI RD E W+ P EF PERF+    VD++GQ FE +PFG GRR+CPGI++ 
Sbjct  391  KTLAYVNTLAIGRDSEVWDKPDEFIPERFMGTDCVDFQGQHFELLPFGSGRRICPGISMA  450

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + + ELALANLLY FDW++P  +K ED+D ++ PG+ MHKKIPL L+A K
Sbjct  451  MRTLELALANLLYKFDWKMPDGMKNEDLDYDILPGVAMHKKIPLKLMATK  500



>ref|XP_006427663.1| hypothetical protein CICLE_v10025429mg [Citrus clementina]
 gb|ESR40903.1| hypothetical protein CICLE_v10025429mg [Citrus clementina]
Length=502

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 166/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++  + + ++LTW HIKAVLM VFVAG+DTS A +VW+MT LM+ P  M   
Sbjct  272  DIIDVLLRIRKNSETKIDLTWKHIKAVLMDVFVAGTDTSVATLVWSMTNLMRNPATMKKA  331

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R     KG ++E+D++ L Y KAV+KET RL PPVP L+ R T   C +DGY+I+ 
Sbjct  332  QEEVRSVAKNKGFVDEDDLETLQYLKAVLKETFRLQPPVP-LIPRSTAEECVVDGYKIEA  390

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNK-VDYKGQDFEFIPFGGGRRVCPGIALG  310
            K L +VN+ AI RD E W+ P EF PERF+    VD++GQ FE +PFG GRR+CPGI++ 
Sbjct  391  KTLAYVNTLAIGRDSEVWDKPDEFIPERFMGTDCVDFQGQHFELLPFGSGRRICPGISMA  450

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + + ELALANLLY FDW++P  +K ED+D ++ PG+ MHKKIPL L+A K
Sbjct  451  MRTLELALANLLYKFDWKMPDGMKNEDLDYDILPGVAMHKKIPLKLMATK  500



>ref|XP_007022289.1| Cytochrome P450, family 71, subfamily B, polypeptide 36, putative 
[Theobroma cacao]
 gb|EOY13814.1| Cytochrome P450, family 71, subfamily B, polypeptide 36, putative 
[Theobroma cacao]
Length=508

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 167/233 (72%), Gaps = 2/233 (1%)
 Frame = -1

Query  852  DGDILDVLISLK--MENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRI  679
            D DI+DVL+ +K    +SS+  +T DHIKA+LM +F AG +T AA++ WAM  L + PR+
Sbjct  274  DEDIIDVLLKIKKNQADSSAFQITHDHIKAILMNIFFAGVETGAAVVGWAMVELARNPRV  333

Query  678  MNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGY  499
            M   Q EIR+ VG+KG+I+E DI +L Y K VVKE LR +PP   L+ RE+ S  TI+GY
Sbjct  334  MKKAQEEIRNYVGEKGKISESDIDQLQYLKLVVKEALRFHPPGAFLIPRESRSQFTINGY  393

Query  498  EIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGI  319
             + PK  ++VN WAI RDPE WENP +FYPERF+D+ +DYKG  FEF+PFG GRR CPG+
Sbjct  394  NVYPKTRIYVNIWAIGRDPESWENPGQFYPERFIDSPLDYKGHHFEFLPFGAGRRGCPGM  453

Query  318  ALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
             +G+ + ELALANLLY FDW+LP+ +K+ED++   + G++ H K  L LV  K
Sbjct  454  NMGMFTVELALANLLYHFDWKLPNGMKEEDLNMEEAAGLSNHVKQALVLVPTK  506



>ref|XP_002300725.2| hypothetical protein POPTR_0002s02730g [Populus trichocarpa]
 gb|EEE79998.2| hypothetical protein POPTR_0002s02730g [Populus trichocarpa]
Length=513

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 166/229 (72%), Gaps = 1/229 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            ILD L+ +  E S  V LT DHIKA+L  +F+AG+DT A  ++WAMT LMK P+ M   Q
Sbjct  271  ILDFLLQIHKEGSFKVQLTLDHIKAILTDIFLAGTDTGAVTVIWAMTFLMKNPKAMRKAQ  330

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             E+R+  G KG ++++D+Q+LPY KAVVKET+RL P  P+L+ RET   C + GYEI  K
Sbjct  331  EEVRNLFGNKGFVDDDDVQQLPYLKAVVKETMRLQPTAPLLLPRETTKECYLGGYEIPAK  390

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             LV+V++WA+ RDP+ WENP+EF P+RFL + +D KG DFE IPFG GRR+CPGI + +A
Sbjct  391  TLVYVSAWAVGRDPKAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGIFIALA  450

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + EL+LANLL+ FDWE+PS ++  D+D +V PG+  H +  LCLV K V
Sbjct  451  TVELSLANLLHKFDWEMPSGVEDIDMD-DVLPGLIPHMRDALCLVPKFV  498



>ref|XP_006576430.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=499

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 178/228 (78%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ LK + S S++LT DHIKAVLM + VA +DT+AA  VWAMTAL+K PR+M  V
Sbjct  269  DIVDVLLRLKKQGSLSIDLTNDHIKAVLMNMLVAATDTTAATTVWAMTALLKNPRVMKKV  328

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR   GKK  ++E+DIQ+ PYFKAV+KETLRLY P P+LV+RET   C IDGYEI  
Sbjct  329  QEEIRTLGGKKDFLDEDDIQKFPYFKAVIKETLRLYLPAPLLVQRETNEACIIDGYEIPA  388

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K +++VN+WAI RDP+ W++P EF PERFLD  +D +G+DFE IPFG GRR+CPG+ + +
Sbjct  389  KTIIYVNAWAIHRDPKAWKDPEEFSPERFLDITIDLRGKDFELIPFGAGRRICPGMHMAI  448

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS +L +ANLL +FDWELP  +++EDIDT + PGIT HKK PL ++AK
Sbjct  449  ASLDLIVANLLNSFDWELPERMREEDIDTEMLPGITQHKKNPLYVLAK  496



>sp|P24465.2|C71A1_PERAE RecName: Full=Cytochrome P450 71A1; AltName: Full=ARP-2; AltName: 
Full=CYPLXXIA1 [Persea americana]
 gb|AAA32913.1| cytochrome P-450LXXIA1 (cyp71A1) [Persea americana]
Length=502

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 167/229 (73%), Gaps = 0/229 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++DVL+ L+ ++S  V+L  +++KAV++ +F  G+DT+A  + WAM  L+K P +M   
Sbjct  271  DLVDVLLHLQKDSSLGVHLNRNNLKAVILDMFSGGTDTTAVTLEWAMAELIKHPDVMEKA  330

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  VGKK ++ EED+ +L Y K ++KETLRL+P  P+LV RE+  +  I GY I  
Sbjct  331  QQEVRRVVGKKAKVEEEDLHQLHYLKLIIKETLRLHPVAPLLVPRESTRDVVIRGYHIPA  390

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  VF+N+WAI RDP+ WEN  EF PERF++N VD+KGQDF+ IPFG GRR CPGIA G+
Sbjct  391  KTRVFINAWAIGRDPKSWENAEEFLPERFVNNSVDFKGQDFQLIPFGAGRRGCPGIAFGI  450

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            +S E++LANLLY F+WELP  L KED+D + + GIT+H K PL LVAK+
Sbjct  451  SSVEISLANLLYWFNWELPGDLTKEDLDMSEAVGITVHMKFPLQLVAKR  499



>ref|XP_011072187.1| PREDICTED: cytochrome P450 71A9-like [Sesamum indicum]
Length=498

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 162/236 (69%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+S   DI+DVL+ ++ + + ++NL+ + +K VLM +FVAG+DTSAA I+W M  LM+ P
Sbjct  260  PESDSEDIIDVLLRIQKDPNQTINLSDEQLKGVLMDIFVAGTDTSAATIIWTMAELMRNP  319

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +    Q E+R     K +I E D+  LPY K V+KE+ RL+PP P+LV RET  +CTI 
Sbjct  320  HVKQKAQQELRQAAKGKTKIQESDLPNLPYLKQVIKESFRLHPPAPLLVPRETTKSCTIA  379

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
             Y++  K  VF N  A++ DP  WE+P +F+PERF+D +VD++GQ FE +PFG GRR CP
Sbjct  380  SYDVPAKTRVFFNCKAMSADPAYWEDPEKFWPERFMDRQVDFRGQHFELLPFGAGRRGCP  439

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI   V   ELALANLL+ FDWELP  +  ED+D   +PGITMHKK PLCLVA  V
Sbjct  440  GINFAVPLVELALANLLFCFDWELPEGMSAEDVDMEEAPGITMHKKTPLCLVASPV  495



>gb|AJD25157.1| cytochrome P450 CYP71AT93 [Salvia miltiorrhiza]
Length=491

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 170/229 (74%), Gaps = 7/229 (3%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+ + I L++ +       WD +KA+LM +F+ G+D+SAA IVW MTALMK P IM  V
Sbjct  265  DIISMQIKLELHSPKP---NWDRVKALLMNLFIGGTDSSAAAIVWNMTALMKAPHIMKKV  321

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q+EIR+ VG KG+++++D+ +LPY KA++ ET RLY PVP+LV R+T   C +DGYEI+P
Sbjct  322  QTEIRNVVGNKGKVDDDDLPKLPYLKAILNETFRLYTPVPLLVPRQTTEKCVLDGYEIQP  381

Query  486  KMLVFVNSWAIARDPECWE-NPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALG  310
               V+VN WAIARD E W+ +P EF PERF+ + +D KGQDF  IPFG GRR+CPG+ +G
Sbjct  382  NTTVYVNVWAIARDSEYWKISPEEFLPERFIGSNMDVKGQDFGVIPFGSGRRICPGMFMG  441

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            VA+ ELA+ANLLY+FDWELP  ++   +DT+V PG+ MHKK PL L+ K
Sbjct  442  VANVELAVANLLYSFDWELPQGIQ---LDTHVLPGLIMHKKNPLFLLPK  487



>ref|XP_006427664.1| hypothetical protein CICLE_v10027422mg [Citrus clementina]
 gb|ESR40904.1| hypothetical protein CICLE_v10027422mg [Citrus clementina]
Length=440

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 165/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++  + + ++LT  HIKAVLM VFVAG+DTS A +VW+MT LM+ P  M   
Sbjct  210  DIIDVLLRIRKNSETKIDLTLKHIKAVLMDVFVAGTDTSVATLVWSMTNLMRNPATMKKA  269

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R     KG ++E+D++ L Y KAV+KET RL PPVP L+ R T   C +DGY+I+ 
Sbjct  270  QEEVRSVAKNKGFVDEDDLETLQYLKAVLKETFRLQPPVP-LIPRSTAEECVVDGYKIEA  328

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNK-VDYKGQDFEFIPFGGGRRVCPGIALG  310
            K L +VN+ AI RD E W+ P EF PERF+    VD++GQ FE +PFG GRR+CPGI++ 
Sbjct  329  KTLAYVNTLAIGRDSEVWDKPDEFIPERFMGTDCVDFQGQHFELLPFGSGRRICPGISMA  388

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + + ELALANLLY FDW++P  +K ED+D ++ PG+ MHKKIPL L+A K
Sbjct  389  MRTLELALANLLYKFDWKMPDGMKNEDLDYDILPGVAMHKKIPLKLMATK  438



>ref|XP_008779115.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=274

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 162/233 (70%), Gaps = 0/233 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D + VL+ L+ + S    LT DHIK + M VFV GSDTSA+++   MT LM+   +M   
Sbjct  41   DFISVLVGLQKDLSLGFPLTRDHIKGIAMDVFVGGSDTSASILESGMTELMRNSIVMKKA  100

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  +G KG++ E DIQ+L Y K V+KE LRL+PP P+L  RE + +C I+GY I  
Sbjct  101  QDEVRGLLGNKGKVEEGDIQQLHYLKLVIKEILRLHPPAPLLAPRECMQDCKINGYNIPK  160

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K+ V++N+WAI+RDP  W++P  F PERF +N +++KGQ F+FIPFG GRR+CPG++LGV
Sbjct  161  KVRVYINAWAISRDPRHWQDPEAFIPERFENNDINFKGQHFQFIPFGSGRRMCPGMSLGV  220

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV*FV  148
             SAELALANLLY FDW+LP  + KEDID     G+ + ++ PL LVA    FV
Sbjct  221  VSAELALANLLYRFDWDLPGGMNKEDIDMEEQFGLVVRRRSPLILVATPTSFV  273



>gb|KHN38812.1| Cytochrome P450 83B1 [Glycine soja]
Length=498

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 176/228 (77%), Gaps = 0/228 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI DVL+ LK +   S++LT DHIKAVLM + VA +DT+AA  VWAMTAL+K PR+M  V
Sbjct  268  DITDVLLQLKKQRLYSIDLTNDHIKAVLMNMLVAATDTTAATTVWAMTALLKNPRVMKKV  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR   GKK  ++E+DIQ+ PYFKAV+KETLRLY P P+LV+RET   C IDGYEI  
Sbjct  328  QEEIRTLGGKKDFLDEDDIQKFPYFKAVIKETLRLYLPAPLLVQRETNEACIIDGYEIPA  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K +++VN+WAI RDP+ W++P EF PERFLD  +D +G+DFE IPFG GRR+CPG+ + +
Sbjct  388  KTIIYVNAWAIHRDPKAWKDPEEFSPERFLDITIDLRGKDFELIPFGAGRRICPGMHMAI  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            AS +L LANLL +FDWELP  +++EDIDT + PGIT HKK PL ++AK
Sbjct  448  ASLDLILANLLNSFDWELPERMREEDIDTEMLPGITQHKKNPLYVLAK  495



>ref|XP_006427665.1| hypothetical protein CICLE_v10025431mg [Citrus clementina]
 gb|ESR40905.1| hypothetical protein CICLE_v10025431mg [Citrus clementina]
Length=502

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 166/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ ++  + + ++LTW HIKAVLM VFVAG+DTS A +VW+MT LM+ P  M   
Sbjct  272  DIIDVLLRIRKNSETKIDLTWKHIKAVLMDVFVAGTDTSVATLVWSMTNLMRNPATMKKA  331

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R     KG ++E+D++ L Y KAV+KET RL PPVP L+ R T   C +DG++I+ 
Sbjct  332  QEEVRSVAKNKGFVDEDDLETLQYLKAVLKETFRLQPPVP-LIPRSTTEECVVDGHKIEA  390

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNK-VDYKGQDFEFIPFGGGRRVCPGIALG  310
            K L +VN+ AI RD E W+ P EF PERF+    VD++GQ F+ +PFG GRR+CPGI++ 
Sbjct  391  KTLAYVNTLAIGRDSEVWDKPDEFIPERFIGTDCVDFQGQHFQLLPFGSGRRICPGISMA  450

Query  309  VASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            + + ELALANLLY FDW++P  +K ED+D ++ PG+ MHKKIPL L+A K
Sbjct  451  MRTLELALANLLYKFDWKMPEGMKNEDLDYDILPGVAMHKKIPLKLMATK  500



>ref|XP_007134795.1| hypothetical protein PHAVU_010G076900g, partial [Phaseolus vulgaris]
 gb|ESW06789.1| hypothetical protein PHAVU_010G076900g, partial [Phaseolus vulgaris]
Length=202

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 154/200 (77%), Gaps = 0/200 (0%)
 Frame = -1

Query  756  VFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVK  577
            + +A +D+S+A +VW MTAL+K PR+M  VQ EIR   G+K  ++E+D+Q+ PY KAV+K
Sbjct  2    LLLASTDSSSASLVWNMTALLKNPRVMKKVQEEIRSVGGRKEFLDEDDVQKFPYLKAVIK  61

Query  576  ETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFL  397
            ET R YPP PILV+RET   C I GYEI  K  ++VN+WAI +DP+ W+NP E+YPERFL
Sbjct  62   ETFRYYPPGPILVQRETNEACVIGGYEIPAKTTLYVNAWAIHKDPDNWKNPFEYYPERFL  121

Query  396  DNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTN  217
            D+ V Y+GQD+EF+PFG GRRVCPG+ + +AS +L LANLL AFDWELP+ +K +D+D  
Sbjct  122  DSSVTYRGQDYEFLPFGSGRRVCPGMPMAIASLDLILANLLNAFDWELPAGMKPDDLDVL  181

Query  216  VSPGITMHKKIPLCLVAKKV  157
              PG+T+HK+ PL L+AK+V
Sbjct  182  TDPGLTVHKRNPLHLLAKRV  201



>ref|XP_003521980.1| PREDICTED: cytochrome P450 83B1-like [Glycine max]
Length=499

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 176/232 (76%), Gaps = 0/232 (0%)
 Frame = -1

Query  858  SMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRI  679
            S + DI+DVL+ LK + S S +LT DHIKAV M + +A +D +AA  VWAMT L++ PR+
Sbjct  265  SKEEDIIDVLLQLKKQRSFSTDLTIDHIKAVFMDLLIAATDPTAATTVWAMTELVRHPRV  324

Query  678  MNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGY  499
            M  VQ EIR+  GKK  + E DIQ+ PYFKAV+KETLRLYPPVP+L+ +ET  NC IDGY
Sbjct  325  MKKVQEEIRNLGGKKDFLEENDIQKFPYFKAVIKETLRLYPPVPLLLPKETNENCIIDGY  384

Query  498  EIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGI  319
            EI  K LV+VN+ AI RDPE WE+P EF PERFL + +D++GQDFE IPFG GRR CPG+
Sbjct  385  EIAAKTLVYVNALAIQRDPEIWEDPEEFLPERFLYSTIDFRGQDFELIPFGAGRRSCPGM  444

Query  318  ALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             +  AS +L LANLLY FDWELP+ +KKEDIDT V PG+  +KK PLC++AK
Sbjct  445  LMATASLDLILANLLYLFDWELPAGMKKEDIDTEVLPGLVQYKKNPLCILAK  496



>ref|XP_002523238.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39159.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 169/229 (74%), Gaps = 3/229 (1%)
 Frame = -1

Query  846  DILDVLISLK---MENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIM  676
            DI+DVL+ L+    E   +   + DHIKA+LM +F+AG DT A  +VWAMT L++ PR+M
Sbjct  271  DIIDVLLELEKSHREEFGAFQFSKDHIKAILMNIFLAGVDTGAITLVWAMTELIRNPRVM  330

Query  675  NIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
               Q EIR  +G K +++E DI++L Y K V+KETLR++PP  +L+ RET++  +I+GY+
Sbjct  331  KKAQEEIRSCIGDKRKVSEIDIEKLGYLKIVLKETLRIHPPGVLLIPRETMAQFSINGYD  390

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIA  316
            I PK  + VN WA+ RDP+ W+NP EFYPERFLD+ +DYKG ++E +PFGGGRR CPGI 
Sbjct  391  IYPKTRIQVNVWAMGRDPKIWKNPQEFYPERFLDSSIDYKGMNYELLPFGGGRRGCPGIT  450

Query  315  LGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            +G+ + ELALANLL+ FDW+LP  +K EDI+   +PG+T+HKK PL LV
Sbjct  451  MGMTTVELALANLLFYFDWKLPYNMKIEDINMEEAPGLTIHKKEPLLLV  499



>gb|KHN35606.1| Cytochrome P450 83B1 [Glycine soja]
Length=499

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 176/232 (76%), Gaps = 0/232 (0%)
 Frame = -1

Query  858  SMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRI  679
            S + DI+DVL+ LK + S S +LT DHIKAV M + +A +D +AA  VWAMT L++ PR+
Sbjct  265  SKEEDIIDVLLQLKKKRSFSTDLTIDHIKAVFMDLLIAATDPTAATTVWAMTELVRHPRV  324

Query  678  MNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGY  499
            M  VQ EIR+  GKK  + E DIQ+ PYFKAV+KETLRLYPPVP+L+ +ET  NC IDGY
Sbjct  325  MKKVQEEIRNLGGKKDFLEENDIQKFPYFKAVIKETLRLYPPVPLLLPKETNENCIIDGY  384

Query  498  EIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGI  319
            EI  K LV+VN+ AI RDPE WE+P EF PERFL + +D++GQDFE IPFG GRR CPG+
Sbjct  385  EIAAKTLVYVNALAIQRDPEIWEDPEEFLPERFLYSTIDFRGQDFELIPFGAGRRSCPGM  444

Query  318  ALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
             +  AS +L LANLLY FDWELP+ +KKEDIDT V PG+  +KK PLC++AK
Sbjct  445  LMATASLDLILANLLYLFDWELPAGMKKEDIDTEVLPGLVQYKKNPLCILAK  496



>ref|XP_002523235.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39156.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/229 (53%), Positives = 168/229 (73%), Gaps = 3/229 (1%)
 Frame = -1

Query  846  DILDVLISLK---MENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIM  676
            DI+DVL+ L+    E   +   + DHIKA+LM +F+AG DT A  +VWAMT L++ PR+M
Sbjct  271  DIIDVLLELEKSHREEFGAFQFSKDHIKAILMNIFLAGVDTGAITLVWAMTELIRNPRVM  330

Query  675  NIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
               Q EIR  +G K +++E DI++  Y K V+KETLR++PP  +L+ RET++  +I+GY+
Sbjct  331  KKAQEEIRSCIGDKRKVSEIDIEKFGYLKIVLKETLRIHPPSVLLIPRETMAQFSINGYD  390

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIA  316
            I PK  + VN WA+ RDP+ W+NP EFYPERFLD+ +DYKG ++E +PFGGGRR CPGI 
Sbjct  391  IYPKTRIQVNVWAMGRDPKIWKNPQEFYPERFLDSSIDYKGMNYELLPFGGGRRGCPGIT  450

Query  315  LGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            +G+ + ELALANLL+ FDW+LP  +K EDI+   +PG+T+HKK PL LV
Sbjct  451  MGMTTVELALANLLFYFDWKLPYNMKIEDINMEEAPGLTIHKKEPLLLV  499



>gb|AFK39905.1| unknown [Lotus japonicus]
Length=506

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 163/233 (70%), Gaps = 1/233 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            ++   DI+D L+ L+ + S S++LT +HIKA +M + +  +DTS A  VW MT LMK P 
Sbjct  272  QTQQDDIVDTLLQLRDQGSLSIDLTDEHIKASMMDLLIGSTDTSVAASVWLMTGLMKNPT  331

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
             M  VQ EIR+  G K  I+E DIQ+L Y KAV+KETLR YPP P L+ RET+ +  IDG
Sbjct  332  AMKKVQDEIRNLCGNKDFIDEVDIQKLEYLKAVIKETLRFYPPAP-LIPRETMKSIIIDG  390

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            YEI  K +V+VN WAI RDPE W++PHEF P+RFL+  +++KG+DFE IPFG GRRVCPG
Sbjct  391  YEIPAKTIVYVNVWAIHRDPEAWKDPHEFNPDRFLNKDIEFKGRDFELIPFGAGRRVCPG  450

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            +  G+A+ EL  ANLL +FDWE P  + +EDID     G+  HKK  LCLVAK
Sbjct  451  MPQGIATLELITANLLNSFDWEAPLGMTREDIDEEGLQGLARHKKNHLCLVAK  503



>ref|XP_008809621.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=500

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 161/227 (71%), Gaps = 4/227 (2%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ L  +     NLT D+IKAVL  +F+AG+DT++A + WAM  L++ PR+M   
Sbjct  272  DIVDVLLRLHKDG----NLTKDNIKAVLTDIFIAGTDTASATLEWAMAELVRHPRVMKKA  327

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR  +G KG + E D+Q+L Y K VVKETLRL+ P P+LV RE++ +  I GY+I P
Sbjct  328  QEEIRASLGTKGEVEEGDLQQLQYLKLVVKETLRLHTPAPLLVPRESMRHSRIHGYDIPP  387

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
               V+VN+W IA+DP  W++P +F PERF+D  VDYKG +FEFIPFG GRR+CP + LG 
Sbjct  388  NTWVYVNAWGIAKDPRSWDDPEDFIPERFMDGSVDYKGHNFEFIPFGSGRRICPALNLGA  447

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
             + ELALA+LLY FDWELP    +EDID N +PGIT+H    L LVA
Sbjct  448  LTVELALASLLYHFDWELPVGTSREDIDMNEAPGITVHMSSALHLVA  494



>ref|XP_008777462.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=472

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 161/227 (71%), Gaps = 4/227 (2%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ L  +     NLT D+IKAVL  +F+AG+DT++A + WAM  L++ P +M   
Sbjct  244  DIVDVLLRLHKDG----NLTKDNIKAVLTDIFIAGTDTASATLEWAMAELVRHPTVMKKA  299

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR  +G +G + E D+Q+L Y K V+KETLRL+ PVP+LV RE++ +  I GY+I P
Sbjct  300  QEEIRASLGTRGEVEEGDLQQLQYLKLVLKETLRLHTPVPLLVPRESMRHSRIHGYDILP  359

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
               V+VN+W IA+DP  W++P EF PERF+D  VDYKG +FEFIPFG GRR+CP + LG 
Sbjct  360  NTRVYVNAWGIAKDPRSWDDPEEFIPERFMDGSVDYKGHNFEFIPFGSGRRICPALNLGA  419

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
             + ELALA+LLY FDWELP    +EDID N +PGIT+H    L LVA
Sbjct  420  LTVELALASLLYHFDWELPVGTSREDIDMNEAPGITVHMSSALHLVA  466



>gb|AFK47273.1| unknown [Lotus japonicus]
Length=503

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 162/230 (70%), Gaps = 1/230 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            +GD++D L+ LK +    ++LT D IKA+LM + +   DTS A  VW MT L+K PR M 
Sbjct  272  EGDVIDALLQLKKQGCPLIDLTDDQIKAILMDLLMGSIDTSVASSVWVMTGLIKNPRAMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q E+R+  G K  I+E+DIQ+L YFKAV+KE LR Y P P+L  RE   +  IDGYEI
Sbjct  332  KAQEEVRNLCGNKEFIDEDDIQKLEYFKAVIKEALRFYSPAPLL-PREVNKSFIIDGYEI  390

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
            + K LVFVN WAI R  E W++P EFYPERFLDN +D+KG+DFE IPFG GRR+CPGI +
Sbjct  391  QSKTLVFVNLWAIHRYHEAWKDPEEFYPERFLDNNIDFKGRDFELIPFGAGRRICPGIQM  450

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G+A+ E+ +ANLL +FDWE+P  + +E+ID    PG+  HKK  LCLVAK
Sbjct  451  GIATVEVIIANLLNSFDWEMPIGMIRENIDDEGLPGLARHKKNHLCLVAK  500



>ref|XP_010931872.1| PREDICTED: cytochrome P450 71A9-like [Elaeis guineensis]
Length=499

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 160/230 (70%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++  L+ L+ + +   +LT DHIKAV+M VFVAGSDTSA+++VW MT LM+ P +M   
Sbjct  266  DLMSTLLGLQNDPTQGFSLTRDHIKAVVMNVFVAGSDTSASILVWGMTELMRNPMVMKKA  325

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  +G KG++ E DIQ L Y K VVKE LRL+PP P+L+ RE   +C I+G++I  
Sbjct  326  QDEVRGLIGNKGKVEESDIQRLHYLKLVVKEVLRLHPPGPLLIPRECTQHCKINGFDIPK  385

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  V++N+WAI RD   W+    F PERF DN +DYKGQ F+F+PFG GRR+CPG++LGV
Sbjct  386  KTRVYINAWAINRDSRHWQGAEVFMPERFKDNDIDYKGQHFQFLPFGSGRRICPGMSLGV  445

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
               ELALANLLY F+W+LP+ + KEDID        MH+K  L LVA  +
Sbjct  446  VVLELALANLLYRFNWDLPAGMSKEDIDMEEQFDFVMHRKSNLVLVAAPI  495



>gb|KEH29143.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=201

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 149/196 (76%), Gaps = 0/196 (0%)
 Frame = -1

Query  756  VFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVK  577
            + VA +DT++A  VWAMTAL+K PR+M  VQ EIR+  GKK  ++E+DIQ   Y KAV+K
Sbjct  1    MLVAATDTTSATSVWAMTALIKNPRVMRKVQEEIRNLGGKKDFLDEDDIQNSLYLKAVIK  60

Query  576  ETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFL  397
            ETLRLY P P+LV RE+   C I+GY I  + +++VN WAI RDP  W+NP EFYPERF+
Sbjct  61   ETLRLYLPAPLLVPRESRETCIINGYNIPAQTILYVNVWAIQRDPNTWKNPEEFYPERFI  120

Query  396  DNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTN  217
            ++ +++ G DFE IPFG GRR+CPG+++ VAS EL LANLLY+FDW+LP  L+KEDIDT 
Sbjct  121  ESSINFIGHDFELIPFGAGRRICPGMSMAVASLELILANLLYSFDWKLPQGLEKEDIDTE  180

Query  216  VSPGITMHKKIPLCLV  169
            + PGIT HKK PL LV
Sbjct  181  MLPGITQHKKNPLYLV  196



>emb|CAN60733.1| hypothetical protein VITISV_023587 [Vitis vinifera]
Length=505

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 162/228 (71%), Gaps = 2/228 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSS--VNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            DI+DVL+ ++ E S S  V  T D  KA+LM +F+AG DT A  + WAMT L + PRIM 
Sbjct  272  DIIDVLLKIERERSESGAVQFTKDSAKAILMDLFLAGVDTGAITLTWAMTELARNPRIMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q E+R+ +G KG++ E D+ +L Y K VVKETLRL+PP P+LV RET+S+  I+GY I
Sbjct  332  KAQVEVRNSIGNKGKVTEGDVDQLHYLKMVVKETLRLHPPAPLLVPRETMSHFEINGYHI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PK  V VN WAI RDP  W+NP EF PERF+DN VD++GQ FE +PFG GRR+CPG+ +
Sbjct  392  YPKTQVXVNVWAIGRDPNLWKNPEEFLPERFMDNSVDFRGQHFELLPFGAGRRICPGMYM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
             +A+ ELALANLLY F+W LP+ +++ DI+   + G+T+ KK  L LV
Sbjct  452  AIATVELALANLLYRFNWNLPNGMREADINMEEAAGLTVRKKFALNLV  499



>ref|XP_012079912.1| PREDICTED: cytochrome P450 71A1-like [Jatropha curcas]
 gb|KDP30978.1| hypothetical protein JCGZ_11354 [Jatropha curcas]
Length=517

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 165/230 (72%), Gaps = 2/230 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNL--TWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+ ++   SSS +L  T D++KAV++ +F AG+DT+  ++ WAMT LM  PR+M 
Sbjct  280  DLVDVLLDIQKNGSSSSDLPITMDNVKAVILDMFAAGTDTTFIILDWAMTELMMNPRVME  339

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q E+R  VG +  + E D+ +L Y K V+KE  RL+PPVP+LV RE+L +  IDGY+I
Sbjct  340  KAQKEVRSIVGVRTVVQESDLHQLQYMKVVIKEVFRLHPPVPVLVPRESLEDVVIDGYDI  399

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              +  +++N WAIARD E WENP  F PERF+D+ +DYKGQDFEFIPFG GRR+CPGIA 
Sbjct  400  PARTRIYINGWAIARDQEIWENPEIFEPERFMDSTIDYKGQDFEFIPFGAGRRICPGIAF  459

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            G A  ELALA LL++FDWELP+ +K  DID   + GI++H+ + L  +AK
Sbjct  460  GSAVVELALAQLLHSFDWELPAGVKATDIDNTEAFGISVHRTVHLHGIAK  509



>ref|XP_010911404.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=498

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 168/236 (71%), Gaps = 7/236 (3%)
 Frame = -1

Query  864  PKSM---DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALM  694
            PK M     DI+DVL+ L+ + S   +LT DHIKAVLM +F+AG++T++A +VWAM  L 
Sbjct  261  PKRMRPEHEDIVDVLLRLQKDGS---HLTKDHIKAVLMDIFMAGTETASATLVWAMAELA  317

Query  693  KEPRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNC  514
            + PR+M   Q EIR  +G KG++ E D+ +L Y K+VVKETLRL+ PVP+L+ RE++ + 
Sbjct  318  RHPRLMKKAQEEIRASLGTKGKVEEGDLHQLRYLKSVVKETLRLHSPVPLLLPRESIRHS  377

Query  513  TIDGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRR  334
             I GY+I P   VFVN+W I +DP+ W++P EF PERF+D+ +DYKG +FE IPFG GRR
Sbjct  378  RIHGYDIPPNTRVFVNAWGIGKDPKSWDDPEEFIPERFMDSSIDYKGHNFELIPFGSGRR  437

Query  333  VCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            +CP + LG  + ELALA++LY FDWE+P  +  EDID N +PG+  HK   L LVA
Sbjct  438  ICPALNLGTLTVELALASMLYHFDWEVPVGMSTEDIDMNEAPGLVAHKS-SLHLVA  492



>ref|XP_011034037.1| PREDICTED: cytochrome P450 71B10-like [Populus euphratica]
Length=507

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 165/230 (72%), Gaps = 4/230 (2%)
 Frame = -1

Query  846  DILDVLISLKMENS--SSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+S++ E +   +   T D+IKA+L+ +F+AG DT +  + WAM  L++ PR+M 
Sbjct  272  DMVDVLLSIEKEQTELGASQFTKDNIKAILLNLFLAGVDTISLTVNWAMAELVRNPRVMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R  VG KGR+ E DI +L Y + V+KETLRL+PP P+LV RET+S+C + G+ I
Sbjct  332  TVQDEVRKCVGNKGRVTESDIDQLEYLRMVIKETLRLHPPGPLLVPRETMSHCKVSGHNI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PKMLV +N WAI RDP  W++P EF+PERFLD+ +DYKGQ FE++PFG GRR+CPG+ +
Sbjct  392  YPKMLVQINVWAIGRDPRYWKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGMHM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMH--KKIPLCLV  169
            G  + E+ LANLLY FDW  P  +KKEDI+     G+++   KK PL LV
Sbjct  452  GFITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTCKKTPLILV  501



>ref|XP_002285456.1| PREDICTED: cytochrome P450 71B34-like [Vitis vinifera]
Length=505

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 161/228 (71%), Gaps = 2/228 (1%)
 Frame = -1

Query  846  DILDVLISLKMENSSS--VNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            DI+DVL+ ++ E S S  V  T D  KA++M +F+AG DT A  + WAMT L + PRIM 
Sbjct  272  DIIDVLLKIERERSESGAVQFTKDSAKAIIMDLFLAGVDTGAITLTWAMTELARNPRIMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q E+R  +GKKG++ + D+ +L Y K VVKETLRL+PPVP+LV RET+S+  I+GY I
Sbjct  332  KAQVEVRSSIGKKGKVTKGDVDQLHYLKMVVKETLRLHPPVPLLVPRETMSHFEINGYHI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PK  V VN WAI RDP  W+NP EF PERF+DN VD++GQ FE +PFG GRR+CPG+ +
Sbjct  392  YPKTQVHVNVWAIGRDPNLWKNPEEFLPERFMDNSVDFRGQHFELLPFGAGRRICPGMYM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
             +A+ ELALANLLY F+W LP+ +++ DI    + G+ + KK  L LV
Sbjct  452  AIATVELALANLLYRFNWNLPNGMREADISMEEAAGLAVRKKFALNLV  499



>ref|XP_010102935.1| Cytochrome P450 71A9 [Morus notabilis]
 gb|EXB94453.1| Cytochrome P450 71A9 [Morus notabilis]
Length=427

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/237 (52%), Positives = 166/237 (70%), Gaps = 1/237 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK+   D++DVL+ ++ + S ++ +  D IK VL  +F+AGSDT+A  +VW M  L+K P
Sbjct  189  PKAEHEDVVDVLLQVQRDPSQAITINNDQIKGVLTDIFIAGSDTTATALVWIMADLIKNP  248

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             +M   Q E+R+    KG++ E D+ +L Y K V+KE LRL+PP P+LV RET  +C I+
Sbjct  249  SVMKRAQEEVREVSKGKGKVLERDLSKLNYLKLVIKEGLRLHPPAPLLVPRETTQSCIIE  308

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQD-FEFIPFGGGRRVC  328
            G ++ PK  VFVN+  I RDP+ WE+P+EF PERFLD+ VD+KGQ+ FE +PFG GRR C
Sbjct  309  GCQVPPKTRVFVNAKVIGRDPKYWEDPNEFRPERFLDSSVDFKGQNYFELLPFGAGRRGC  368

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            PGI  GV   ELALANLL  FDW+LP  +K+ED+D   + G+TMHKKIPLCL A  V
Sbjct  369  PGINFGVVLIELALANLLCRFDWQLPHGVKREDLDMEEAFGLTMHKKIPLCLDATIV  425



>emb|CBI19817.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 148/201 (74%), Gaps = 0/201 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    DI  VL+ L+ E   SV+LTWDHIKAVLM VFVAG+D  AA +VWAM  + K P
Sbjct  181  PKQEQEDIAVVLLRLQRERLFSVDLTWDHIKAVLMDVFVAGTDPGAATLVWAMAEVTKNP  240

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
                  Q E+R   G+KG ++E+D+ +LPY KA+VKETLR++PP P+L+ +ETL NCTID
Sbjct  241  GGKKKAQEELRTVFGRKGFVDEDDLHKLPYLKALVKETLRVHPPAPLLLTKETLENCTID  300

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
             Y+I PK LVFVN+WAI RDPE WENP E  PERFL + VD+KGQD+E I F  GRR CP
Sbjct  301  AYDIPPKTLVFVNAWAIGRDPEAWENPEEILPERFLSSSVDFKGQDYELISFSVGRRGCP  360

Query  324  GIALGVASAELALANLLYAFD  262
            GI LGV + ELALANLLY+FD
Sbjct  361  GIHLGVVTVELALANLLYSFD  381



>gb|ABC59082.1| cytochrome P450 monooxygenase CYP83E8 [Medicago truncatula]
 gb|KEH29138.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=497

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 173/234 (74%), Gaps = 1/234 (0%)
 Frame = -1

Query  861  KSMDGD-ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            ++ DG+ I+DVL+ L  +   S +LT+DHIK VL+ + VA +DT++A IVWAMTAL+K P
Sbjct  261  QNTDGEFIVDVLLELMKQRLFSTDLTFDHIKGVLVDMLVAATDTTSATIVWAMTALIKNP  320

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            R+M  VQ EIR    KK  ++ +D+Q   Y KAV+KETLRLY P P+L+ RET   C + 
Sbjct  321  RVMKKVQEEIRGSRVKKDFLDGDDLQNFVYLKAVIKETLRLYLPAPLLLPRETREKCIVG  380

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GY I  K +V+VN+W+I RD E W++P EFYPERFL++ +++ G DFE IPFG GRR+CP
Sbjct  381  GYHIPAKTIVYVNAWSIHRDSEIWKDPEEFYPERFLESSINFLGHDFELIPFGAGRRICP  440

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            GI++ VAS EL LANLLY+FDWELP  L KEDIDT + PGIT HKK  LCLVAK
Sbjct  441  GISVAVASLELTLANLLYSFDWELPHGLVKEDIDTEMLPGITQHKKNHLCLVAK  494



>gb|AIU56748.1| cytochrome P450 CYP71B40v3 [Populus trichocarpa]
Length=507

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 163/230 (71%), Gaps = 4/230 (2%)
 Frame = -1

Query  846  DILDVLISLKMENS--SSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+ ++ E +   +   T D+IKA+L+ +F+AG DTS+  + WAM  L++ PR+M 
Sbjct  272  DMVDVLLRIEKEQTELGASQFTKDNIKAILLNLFMAGVDTSSLTVNWAMAELVRNPRVMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R  VG KGR+ E DI +L Y + V+KETLRL+PP P+L+ RET+S+C + G+ I
Sbjct  332  KVQDEVRKCVGNKGRVTESDIDQLEYLRMVIKETLRLHPPGPLLIPRETMSHCKVSGHNI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PKMLV +N WAI RDP  W++P EF+PERFLD  +DYKGQ FE++PFG GRR+CPG+ +
Sbjct  392  YPKMLVQINVWAIGRDPRYWKDPEEFFPERFLDRSIDYKGQSFEYLPFGSGRRICPGMHM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGI--TMHKKIPLCLV  169
            G  + E+ LANLLY FDW  P  +KKEDI+     G+  T  KK PL LV
Sbjct  452  GSITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILV  501



>ref|XP_002312660.2| hypothetical protein POPTR_0008s18810g [Populus trichocarpa]
 gb|EEE90027.2| hypothetical protein POPTR_0008s18810g [Populus trichocarpa]
Length=507

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 163/230 (71%), Gaps = 4/230 (2%)
 Frame = -1

Query  846  DILDVLISLKMENS--SSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+ ++ E +   +   T D+IKA+L+ +F+AG DTS+  + WAM  L++ PR+M 
Sbjct  272  DMVDVLLRIEKEQTELGASQFTKDNIKAILLNLFMAGVDTSSLTVNWAMAELVRNPRVMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R  VG KGR+ E DI +L Y + V+KETLRL+PP P+L+ RET+S+C + G+ I
Sbjct  332  KVQDEVRKCVGNKGRVTESDIDQLEYLRMVIKETLRLHPPGPLLIPRETMSHCKVSGHNI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PKMLV +N WAI RDP  W++P EF+PERFLD  +DYKGQ FE++PFG GRR+CPG+ +
Sbjct  392  YPKMLVQINVWAIGRDPRYWKDPEEFFPERFLDRSIDYKGQSFEYLPFGSGRRICPGMHM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGI--TMHKKIPLCLV  169
            G  + E+ LANLLY FDW  P  +KKEDI+     G+  T  KK PL LV
Sbjct  452  GSITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILV  501



>gb|AJD25153.1| cytochrome P450 CYP71AT89 [Salvia miltiorrhiza]
Length=499

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 180/236 (76%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PKSM+GDI+DV++ +K + S+S ++T DHIKA+L+ + + GSD +A  + WA+TALMK+P
Sbjct  262  PKSMEGDIIDVMLRMKRDGSASFDITLDHIKALLVGIIIGGSDGTATALEWALTALMKKP  321

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
              M  VQ+EIR   GKK  I+EEDI++LPY +AVVKETLRL+PP P+L+ RET+  C+I+
Sbjct  322  SSMKKVQAEIRQLAGKKEMIDEEDIEKLPYLRAVVKETLRLFPPGPLLLPRETIKKCSIN  381

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI+   +V++N+WAIARDP  WEN  EF PERFL  ++D +GQ+ + IPFG GRR CP
Sbjct  382  GYEIEGGTMVYINAWAIARDPTTWENADEFLPERFLAAEIDVRGQNPKVIPFGFGRRGCP  441

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI +G+++ ELALAN+L+ F+WELP  +K+EDID +  PG  +HKK  L LV K V
Sbjct  442  GIGMGMSAIELALANVLHKFEWELPHGMKEEDIDFDSEPGFGLHKKNALRLVPKLV  497



>ref|XP_006386188.1| hypothetical protein POPTR_0002s02790g [Populus trichocarpa]
 gb|ERP63985.1| hypothetical protein POPTR_0002s02790g [Populus trichocarpa]
Length=513

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 167/229 (73%), Gaps = 1/229 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            ILD L+ +  E S  V LT DHIKA+L  +F+AG+DT A  ++WAMT LMK P+ M   Q
Sbjct  271  ILDFLLQIHKEGSFKVQLTLDHIKAILTDIFLAGTDTGAVTVIWAMTFLMKNPKAMRKAQ  330

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             E+R+  G KG ++E+D+Q+LPY KAVVKET+RL PP P+L+ RET   C + GYEI  K
Sbjct  331  EEVRNLFGNKGFVHEDDVQQLPYLKAVVKETMRLQPPAPLLLPRETTKQCYLGGYEIPAK  390

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             LV+V++WA+ RDPE WENP+EF P+RFL + +D KG DFE IPFG GRR+CPGI + +A
Sbjct  391  TLVYVSAWAVGRDPEAWENPYEFNPDRFLGSSIDLKGNDFELIPFGAGRRICPGIFIALA  450

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            + EL+LANLL+ FDWE+PS ++  D+D +V PGI  H +  LCLV K V
Sbjct  451  TVELSLANLLHKFDWEMPSGVEDIDMD-DVLPGIVPHMRDALCLVPKLV  498



>ref|XP_007048751.1| 4-hydroxyphenylacetaldehyde oxime monooxygenase, putative [Theobroma 
cacao]
 gb|EOX92908.1| 4-hydroxyphenylacetaldehyde oxime monooxygenase, putative [Theobroma 
cacao]
Length=536

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 159/232 (69%), Gaps = 2/232 (1%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+    D +D+L+ L  +   S  LT DH+KA+L+  FV G DTSA  ++WAM+ L+K P
Sbjct  299  PQPEHEDFVDILVQLLKD--QSFGLTKDHVKAILLDTFVGGIDTSAITMLWAMSELIKNP  356

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            R+M  VQ EIR+ VGKK +++ E +  L Y K VVKET RL+PP  +L+ RET+ +C I 
Sbjct  357  RVMKKVQIEIRNTVGKKAKVDGESVANLNYLKMVVKETFRLHPPATLLIPRETMRHCEIG  416

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            G++I P+  + VN+WAI RDP+ WENP EF+PERF D  +D+KG  FE +PFG GRR+CP
Sbjct  417  GFDIFPQTRIMVNAWAIGRDPDSWENPKEFHPERFEDKDIDFKGAHFELVPFGAGRRICP  476

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G+A+G  + E  LANLLY FDWELP  + +EDI      G+T H+K PL L+
Sbjct  477  GLAMGATNIEFTLANLLYCFDWELPCGMNREDISMEEEGGLTYHRKTPLNLI  528



>gb|ADO16183.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=491

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 164/234 (70%), Gaps = 1/234 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKM-ENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKE  688
            P     D++D+L+ L+  + S S  LT DH+KA+L  + VAG+D SAA +VWAMT L+K 
Sbjct  250  PNEEHEDLIDILLQLRNGQLSDSFELTNDHMKAMLTDILVAGTDNSAATLVWAMTTLVKY  309

Query  687  PRIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTI  508
            P+ M   Q E+R  V  K +++E+D+ +L Y KAVVKE +RLYP  P+L+ R T+ + T+
Sbjct  310  PKAMKKAQEEVRKMVQNKDKVDEDDLPKLTYLKAVVKEVMRLYPAAPLLIPRVTMKDATL  369

Query  507  DGYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVC  328
              Y+IK   LV+VN+ AI RDPE WENP EF PERFL + + +KG DFE IPFG GRR+C
Sbjct  370  LDYKIKQNTLVYVNAMAIGRDPESWENPEEFSPERFLGSDIGFKGSDFELIPFGAGRRIC  429

Query  327  PGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVA  166
            PGI++GV S EL LANL+Y+FDW LP   K EDID+ V PG+TM  K  LCL+A
Sbjct  430  PGISMGVNSVELFLANLIYSFDWGLPDGTKIEDIDSGVLPGLTMTNKKDLCLLA  483



>ref|XP_007134793.1| hypothetical protein PHAVU_010G076700g [Phaseolus vulgaris]
 gb|ESW06787.1| hypothetical protein PHAVU_010G076700g [Phaseolus vulgaris]
Length=498

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 169/227 (74%), Gaps = 0/227 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            I+DVL+ LK ++SSSV LT DHIKA+L+ + VA +DT+AA  VWAMTAL+  PR+M  VQ
Sbjct  269  IIDVLLQLKKQSSSSVELTKDHIKAMLLDMLVAATDTTAATTVWAMTALLHNPRVMKKVQ  328

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             EIR   GKK  + E+DI++ PY KAV+KE  RLYPP P+LV RET   C I  YEI  K
Sbjct  329  EEIRTLGGKKEFLEEDDIEKFPYLKAVIKEVFRLYPPAPLLVARETNKACMIGSYEIPAK  388

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             +VFVN+WAI RDPE W++P EF PERFLD+ VD+ G DFE IPFG GRR+CPGI + VA
Sbjct  389  TIVFVNAWAIHRDPESWKDPEEFLPERFLDSTVDFHGHDFELIPFGAGRRICPGIPMAVA  448

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            S  L LAN+L +FDWELP  ++KEDIDT + PG+  HKK PL ++AK
Sbjct  449  SLNLILANILNSFDWELPEGVRKEDIDTEMLPGLAQHKKNPLYVLAK  495



>gb|KDO62263.1| hypothetical protein CISIN_1g0110962mg, partial [Citrus sinensis]
Length=271

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 157/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D D++DVL+ ++        LT DHIKAV+  +F AGS+TSA  + WAM  +MK PR+M 
Sbjct  34   DEDLVDVLLKIQGHGDLDSFLTTDHIKAVISDIFAAGSETSATTVDWAMCEMMKNPRVMK  93

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q+E+R+   + G++NE  I E+ + K VVKETLRL+P  P+L+ RE    C I+G++I
Sbjct  94   KAQAEVREVFHRTGKVNETSIDEMKFLKLVVKETLRLHPAAPLLIPRECGQRCQINGFDI  153

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K  V VN+WAI RDPE W  P  F PERFLD+ VDYKG +FE+IPFG GRR+CPG++ 
Sbjct  154  PVKARVIVNAWAIGRDPEYWTEPESFIPERFLDHSVDYKGTNFEYIPFGAGRRICPGMSF  213

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G+AS EL LA LLY FDW+LP+ +K ED+D   + G+T+ +K  LC+ 
Sbjct  214  GLASVELPLAMLLYHFDWKLPNGIKHEDLDMTEAFGVTVRRKQDLCMT  261



>ref|XP_003612313.1| Cytochrome P450 71B10 [Medicago truncatula]
 gb|AES95271.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 169/227 (74%), Gaps = 0/227 (0%)
 Frame = -1

Query  843  ILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQ  664
            I+DVL+ LK + S S ++T+DHIK +LM + VA +DT++A +VWAMT L+K P +M  VQ
Sbjct  244  IVDVLLQLKEKRSFSFDITFDHIKGILMNMLVAATDTTSATLVWAMTVLIKNPAVMKKVQ  303

Query  663  SEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPK  484
             EIR    KK  ++E+DIQ   Y KAV+KETLRL+ P P+L+ RE++  CTI GY+I  K
Sbjct  304  QEIRSSRVKKDFLDEDDIQNFSYLKAVIKETLRLFLPNPLLLPRESMEMCTIGGYQIPAK  363

Query  483  MLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVA  304
             +V+VN+WAI RD   W++P EFYPERFL++ +++ GQDFEFIPFG GRR+CPGI++ VA
Sbjct  364  TIVYVNAWAIHRDSNVWKDPEEFYPERFLESSINFLGQDFEFIPFGSGRRICPGISMAVA  423

Query  303  SAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAK  163
            S EL LAN+LY+FDWELP  L KED+D    PGI  HKK  LCL AK
Sbjct  424  SLELILANILYSFDWELPHGLVKEDVDFERLPGIAQHKKNHLCLFAK  470



>ref|XP_010519644.1| PREDICTED: cytochrome P450 71B11-like [Tarenaya hassleriana]
Length=497

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 165/228 (72%), Gaps = 2/228 (1%)
 Frame = -1

Query  846  DILDVLISLKMENS--SSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            DI+D+L+ ++ E        LT DHIKA+L+ + +AG DTSA  + WAMT L++ PR+M 
Sbjct  263  DIIDLLLKMEREQVRFGEFTLTRDHIKAILVNILLAGIDTSAQTVTWAMTHLIRNPRVME  322

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ EIR+RV  K  I EED++ L Y K+V+KETLR+ P VP+L+ RE +S+  I+GYEI
Sbjct  323  KVQDEIRERVTDKDNITEEDMEHLDYLKSVIKETLRMSPVVPLLIAREAMSDMKINGYEI  382

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K  + +N+WA+ RDP+ W++P  F PERF+DNK+DYKGQ +E IPFGGGRR+CPG+ L
Sbjct  383  PKKTRIQINAWAVHRDPDVWKDPDSFIPERFMDNKIDYKGQSYELIPFGGGRRMCPGLGL  442

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G+A  +L+L NLLY FDW+LP  ++ ED+D   S GI + K++PL LV
Sbjct  443  GMALVQLSLMNLLYRFDWKLPDGMRIEDVDLEESFGIVISKRVPLQLV  490



>ref|XP_010910121.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=499

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 164/238 (69%), Gaps = 0/238 (0%)
 Frame = -1

Query  861  KSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPR  682
            K    D +DVL+ L+ + S    LT D +KA++M VF+ GSDTSA+ I WAM+ LMK P+
Sbjct  261  KGNHDDFIDVLLGLQKDPSLGFILTRDQMKAIIMNVFLGGSDTSASTIEWAMSELMKNPK  320

Query  681  IMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDG  502
            IM   Q EIR  +G KG++ E  IQ+L Y K V+KE LRL+PP P+L+ RE + +C I+G
Sbjct  321  IMKKAQDEIRGLLGNKGKVEECGIQKLHYLKLVIKEVLRLHPPAPLLIPRECMHDCKING  380

Query  501  YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPG  322
            Y+I  K +V++N+WAI RDP  W++   F PERF +N + YKGQ F+FIPFG GRR+CPG
Sbjct  381  YDIPKKTMVYINAWAIGRDPNNWQDAEAFVPERFEENDISYKGQHFDFIPFGSGRRICPG  440

Query  321  IALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV*FV  148
            ++LG+ + E+ALANLLY F+WELP+ + +ED       G+ +H++ PL LVA    F 
Sbjct  441  MSLGLVATEIALANLLYRFNWELPNGMSREDFGMEEHFGLVIHRRSPLLLVATPTSFA  498



>ref|XP_007210941.1| hypothetical protein PRUPE_ppa024670mg [Prunus persica]
 gb|EMJ12140.1| hypothetical protein PRUPE_ppa024670mg [Prunus persica]
Length=511

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 167/236 (71%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            P+    D++DVL+ ++ + S ++ L+ D IK VL  +F+AG+DTS+A +VW M  L++ P
Sbjct  266  PEPEQEDLVDVLLRVQRDASQAIPLSNDQIKGVLTDMFIAGTDTSSATLVWTMAELIRNP  325

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             ++   Q E+R  +  K ++ E D+ EL Y K V+KE+ RL+P VP+L+ RETL +CTI+
Sbjct  326  LVLRKAQDEVRGVLKGKAKVEESDLSELMYLKLVLKESFRLHPAVPLLLPRETLKSCTIE  385

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI    +VF+++  I +DPECWENP+EF+PERFLD+ +DYKG  FE +PFG GRR CP
Sbjct  386  GYEIPTTTMVFIHAKMIGKDPECWENPNEFWPERFLDSSIDYKGNHFELLPFGAGRRGCP  445

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI+  V   ELALANLLY FDWELP  +++ED+D   + G+ + KK+PL L AK V
Sbjct  446  GISFSVKLIELALANLLYRFDWELPHGVRREDLDMEDAAGLAVSKKVPLFLAAKPV  501



>gb|KJB73276.1| hypothetical protein B456_011G225400 [Gossypium raimondii]
Length=505

 Score =   259 bits (662),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 166/230 (72%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DILDVL+    +     +LT DHIKA++M V  AG++T+A  ++W M+ LMK P  +   
Sbjct  274  DILDVLLQTWKDRDFLFDLTLDHIKAIIMDVLFAGTETTAVTVIWVMSFLMKNPGCLKKA  333

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+RD +GKKG +NE+D+Q L Y KAVVKET RL P VP+L+ RETL  C I GY++  
Sbjct  334  QEEVRDLIGKKGFLNEDDVQALTYLKAVVKETFRLQPAVPLLLPRETLRKCCIGGYQVPA  393

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
              LV+VN+WAI RDPE W NP EF PERF+ + +DYKG +FE IPFG GRRVCPG+ + V
Sbjct  394  NTLVYVNAWAIGRDPEAWRNPEEFCPERFIGSSIDYKGLNFELIPFGAGRRVCPGMNMAV  453

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            A+ ELALANLLY FDWE+P+ + K +++ + +PGI +HKK  L LVA+K+
Sbjct  454  AAVELALANLLYKFDWEMPTKMNKANLNFDATPGIVIHKKDALILVARKI  503



>gb|AIU56747.1| cytochrome P450 CYP71B41v2 [Populus trichocarpa]
Length=507

 Score =   259 bits (662),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 163/230 (71%), Gaps = 4/230 (2%)
 Frame = -1

Query  846  DILDVLISLKMENS--SSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+ ++ E +   +   T D+IKA+L+ +F+ G DTS+  + WAM  L++ PR+M 
Sbjct  272  DMVDVLLRIEKEQTELGASQFTKDNIKAILLNLFLGGVDTSSLTVNWAMAELVRNPRVMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R  VG KGR+ E DI +L Y + V+KETLRL+PP P+L+ RET+S+C + G+ I
Sbjct  332  KVQDEVRKCVGNKGRVTESDIDQLEYLRMVIKETLRLHPPAPLLIPRETMSHCKVSGHNI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PKMLV +N WAI RDP  W++P EF+PERFLD+ +DYKGQ FE++PFG GRR+CPG+ +
Sbjct  392  YPKMLVQINVWAIGRDPTYWKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGMHM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGI--TMHKKIPLCLV  169
            G  + E+ LANLL+ FDW  P  +KKEDI+     G+  T  KK PL LV
Sbjct  452  GFITMEIILANLLFCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILV  501



>gb|KDP36616.1| hypothetical protein JCGZ_08432 [Jatropha curcas]
Length=373

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 163/226 (72%), Gaps = 0/226 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            DI+DVL+ L+ + SS+  L+ DHIKA+LM +F+AG DT+A ++VWAM  L+K PRIM   
Sbjct  142  DIIDVLLDLERDQSSAFQLSQDHIKAILMDIFLAGVDTAAIILVWAMAELIKNPRIMKKA  201

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q EIR  +G K   ++ +I +L Y K ++KETLRL+    +L+ RE++S   I GYE+ P
Sbjct  202  QEEIRTLIGNKREFSKSNIDKLDYLKLILKETLRLHSSGALLIPRESISKFNIGGYEVYP  261

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  + VN+WAI RDP+ W++  +F+PERF+D  +DYKGQ +EF+PFG GRR CPG+++G+
Sbjct  262  KTRIEVNAWAIGRDPKVWKDAEKFFPERFVDKDIDYKGQHYEFLPFGAGRRSCPGMSMGM  321

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            A AELALANLLY FDW LP+ +K+ED+       +  +KK+PL LV
Sbjct  322  AMAELALANLLYWFDWRLPNDMKEEDLSMEEKASLATYKKVPLVLV  367



>gb|KFK33558.1| hypothetical protein AALP_AA5G029200 [Arabis alpina]
Length=502

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 166/233 (71%), Gaps = 3/233 (1%)
 Frame = -1

Query  846  DILDVLISL--KMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            DI+D ++ +  K   + S+ L+ DHIK  L  +F+AG DT A  ++WAMT L K PR+M 
Sbjct  269  DIIDSMLDVIDKQGENDSLKLSIDHIKGFLANIFLAGIDTGAITMIWAMTELAKNPRLMK  328

Query  672  IVQSEIRDRVGK-KGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
             VQSEIRDR+G  K RINEEDI ++PY K V+KET RL+P  P+++ RET+++  + GY+
Sbjct  329  KVQSEIRDRLGNNKERINEEDIDKVPYLKMVIKETFRLHPAAPLILPRETMAHIKVQGYD  388

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIA  316
            I PK  + VN WAI RDP+ W NP EF PERF+D++VDY+GQ +E +PFG GRR+CPG+ 
Sbjct  389  IPPKRRILVNVWAIGRDPKLWTNPEEFNPERFIDSQVDYRGQHYELLPFGSGRRICPGMP  448

Query  315  LGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            +G+A+ EL L NLLY FDW+LP  +   DIDT  +  +T+ KK+PL LV  +V
Sbjct  449  MGIATVELGLLNLLYFFDWKLPDGMTHNDIDTEEAGTLTIVKKVPLNLVPVRV  501



>gb|ABK94709.1| unknown [Populus trichocarpa]
Length=507

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 162/230 (70%), Gaps = 4/230 (2%)
 Frame = -1

Query  846  DILDVLISLKMENS--SSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+ ++ + +   +   T D+IKA+L+ +F+ G DT +  + WAM  L++ PR+M 
Sbjct  272  DMVDVLLRIEKDQTELGASQFTKDNIKAILLNLFLGGVDTISLTVNWAMAELVRNPRVMK  331

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
             VQ E+R  VG KGR+ E DI +L Y + V+KETLRL+PP P+L+ RET+S+C + G+ I
Sbjct  332  KVQDEVRKCVGNKGRVTESDIDQLEYLRMVIKETLRLHPPAPLLITRETMSHCKVSGHNI  391

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PKMLV +N WAI RDP  W++P EF+PERFLD+ +DYKGQ FE++PFG GRR+CPGI +
Sbjct  392  YPKMLVQINVWAIGRDPRYWKDPEEFFPERFLDSSIDYKGQSFEYLPFGSGRRICPGIHM  451

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGI--TMHKKIPLCLV  169
            G  + E+ LANLLY FDW  P  +KKEDI+     G+  T  KK PL LV
Sbjct  452  GSITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTSKKTPLILV  501



>ref|XP_007210185.1| hypothetical protein PRUPE_ppa020002mg [Prunus persica]
 gb|EMJ11384.1| hypothetical protein PRUPE_ppa020002mg [Prunus persica]
Length=511

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 167/236 (71%), Gaps = 0/236 (0%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    D++DVL+ ++ + + ++ L+ D IK VL  +F+AG+DTS+A +VW M  L++ P
Sbjct  266  PKPEHEDLVDVLLRVQRDPNQAIPLSNDQIKGVLTDMFIAGTDTSSATLVWTMAELIRNP  325

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
             ++   Q E+R  +  K ++ E D+ EL Y K V+KE+ RL+P VP+L+ RETL +CTI+
Sbjct  326  LVLRKAQDEVRSVLKGKSKVEESDLSELMYLKLVLKESFRLHPAVPLLLPRETLKSCTIE  385

Query  504  GYEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCP  325
            GYEI    +VF+++  I +DPECWENP+EF+PERFLD+ +DYKG  FE +PFG GRR CP
Sbjct  386  GYEIPTTTMVFIHAKMIGKDPECWENPNEFWPERFLDSSIDYKGNHFELLPFGAGRRGCP  445

Query  324  GIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            GI+  V   ELALANLLY FDWELP  +++ED+D   + G+ + KK+PL L AK V
Sbjct  446  GISFSVKLIELALANLLYRFDWELPHGVRREDLDMEDAAGLVVSKKVPLFLAAKPV  501



>emb|CBI19821.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -1

Query  819  KMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIVQSEIRDRVG  640
            +++ S ++++T DHIKAV+M +FV G+DT AA++VWAMTALMK+P +M   Q EIR+  G
Sbjct  20   ELDFSFAIDITQDHIKAVVMNIFVGGTDTIAAILVWAMTALMKDPIVMKKAQEEIRNIGG  79

Query  639  KKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKPKMLVFVNSW  460
            KKG  +E+DI++LPY KA+ KET++L+PP+P L+ R T  NC+++G E+ PK LVFVN+W
Sbjct  80   KKGFRDEDDIEKLPYLKALTKETMKLHPPIP-LIPRATPENCSVNGCEVPPKTLVFVNAW  138

Query  459  AIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGVASAELALAN  280
            AI RDPE  ENPHEF PERFL   +D+KGQ +  + F  GRR CPGI L     +LAL N
Sbjct  139  AIGRDPESRENPHEFNPERFLGTFIDFKGQHYGLMAFRAGRRGCPGIYLRTVIIQLALGN  198

Query  279  LLYAFDWELPSWLKKEDIDTNVSPGITM  196
            LLY+FDWE+P+ + KEDIDT+V  G+TM
Sbjct  199  LLYSFDWEMPNGMTKEDIDTDVKHGVTM  226



>ref|XP_002279272.2| PREDICTED: 2-methylbutanal oxime monooxygenase-like [Vitis vinifera]
 emb|CBI15967.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 163/239 (68%), Gaps = 4/239 (2%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    D++DVL+ L  + + + +LT DHIKA+L+  F+ G+DT A  +VWAM+ LM  P
Sbjct  281  PKPEHEDLVDVLLGLSKDENFAFHLTNDHIKAILLNTFIGGTDTGAVTMVWAMSELMANP  340

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            R+M  VQ+E+R  VG K +++ +D+ +L Y K VVKET R++P  P+L+   T  +C I+
Sbjct  341  RVMKKVQAEVRSCVGSKPKVDRDDLAKLKYLKMVVKETFRMHPAAPLLIPHRTRQHCQIN  400

Query  504  G----YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGR  337
                 Y+I P+  + VN++AI RDP  W+NP EFYPERF D+ +D+KGQ FE +PFG GR
Sbjct  401  ANGCTYDIFPQTTILVNAFAIGRDPNSWKNPDEFYPERFEDSDIDFKGQHFELLPFGAGR  460

Query  336  RVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            R+CP IA+ V++ E  LANLLY FDWE+P  +K +D+D     GIT H+K PLCLV  K
Sbjct  461  RICPAIAMAVSTVEFTLANLLYCFDWEMPMGMKTQDMDMEEMGGITTHRKTPLCLVPIK  519



>emb|CAN80448.1| hypothetical protein VITISV_039229 [Vitis vinifera]
Length=524

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 163/239 (68%), Gaps = 4/239 (2%)
 Frame = -1

Query  864  PKSMDGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEP  685
            PK    D++DVL+ L  + + + +LT DHIKA+L+  F+ G+DT A  +VWAM+ LM  P
Sbjct  281  PKPEHEDLVDVLLGLSKDENFAFHLTNDHIKAILLNTFIGGTDTGAVTMVWAMSELMANP  340

Query  684  RIMNIVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTID  505
            R+M  VQ+E+R  VG K +++ +D+ +L Y K VVKET R++P  P+L+   T  +C I+
Sbjct  341  RVMKKVQAEVRSCVGSKPKVDRDDLAKLKYLKMVVKETFRMHPAAPLLIPHRTRQHCQIN  400

Query  504  G----YEIKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGR  337
                 Y+I P+  + VN++AI RDP  W+NP EFYPERF D+ +D+KGQ FE +PFG GR
Sbjct  401  ANGCTYDIFPQTTILVNAFAIGRDPNSWKNPDEFYPERFEDSDIDFKGQHFELLPFGAGR  460

Query  336  RVCPGIALGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKK  160
            R+CP IA+ V++ E  LANLLY FDWE+P  +K +D+D     GIT H+K PLCLV  K
Sbjct  461  RICPAIAMAVSTVEFTLANLLYCFDWEMPMGMKTQDMDMEEMGGITTHRKTPLCLVPIK  519



>ref|XP_010450434.1| PREDICTED: cytochrome P450 71B17-like [Camelina sativa]
Length=369

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 165/233 (71%), Gaps = 3/233 (1%)
 Frame = -1

Query  846  DILDVLISL--KMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            DI+DV++ +  K   + S+ LT DHIKA+L  + + G +T A  ++WAMT L+K P++M 
Sbjct  136  DIVDVMLDVMNKQGENDSLTLTLDHIKALLTNILLGGVETGAITMIWAMTELVKTPQVMK  195

Query  672  IVQSEIRDRVGK-KGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYE  496
             VQSEIRDR+G  K RI EED+ ++P+   V+KET RL+P  P+L+ RET+++  + GY+
Sbjct  196  KVQSEIRDRLGNNKERITEEDLDKVPFLNMVIKETFRLHPAAPLLLPRETMAHIKVQGYD  255

Query  495  IKPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIA  316
            I PK  + VN+WAI RDP+ W NP EF PERF+D+ VDYKG+ FE +PFG GRR+CPGIA
Sbjct  256  IPPKRQILVNAWAIGRDPKYWTNPEEFNPERFMDSPVDYKGRHFELLPFGSGRRICPGIA  315

Query  315  LGVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
            +G+A+ EL L NLLY FDW  P  +  +DID   +  +T+ KK+PL LV  +V
Sbjct  316  MGIATVELGLLNLLYYFDWRTPDGMTHKDIDKEEAGTLTVVKKVPLKLVPVRV  368



>gb|KDP26674.1| hypothetical protein JCGZ_17832 [Jatropha curcas]
Length=505

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 165/230 (72%), Gaps = 4/230 (2%)
 Frame = -1

Query  846  DILDVLISLKMENSSS--VNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D++DVL+ +K E + +     T D+IK VL+ +F+AG DTSA  + WAM  L + P +M 
Sbjct  271  DVIDVLLRIKEEQAETGMAKFTNDNIKGVLLNLFLAGVDTSAITVNWAMAELSRNPSVMK  330

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q E+R+ VGKKGRI E D+ +L Y K V+KET RL+P  P+L+ RET+S+  I+GY+I
Sbjct  331  KAQDEVRNVVGKKGRITEGDLDQLEYLKMVIKETFRLHPAAPLLLPRETISHFKINGYDI  390

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
             PK L+ VN+WAI RDP+ W++P +F+PERF D+ +D+KGQ+FEF+PFG GRR+CPGI +
Sbjct  391  YPKTLIQVNAWAIGRDPKYWKDPEQFFPERFADSDIDFKGQNFEFLPFGAGRRICPGIHM  450

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGI--TMHKKIPLCLV  169
               + E+ LANLLY FDW+LP  +K+EDID    PGI  T+ KK PL L+
Sbjct  451  ATITVEIVLANLLYCFDWKLPDGMKREDIDMEEQPGISLTVSKKTPLNLL  500



>ref|XP_010931871.1| PREDICTED: cytochrome P450 71A9-like [Elaeis guineensis]
Length=499

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 160/230 (70%), Gaps = 0/230 (0%)
 Frame = -1

Query  846  DILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMNIV  667
            D++  L+ L+ + +   +LT DHIKAV+M +F+AGSDT+ +++VW MT LM+ P +M   
Sbjct  266  DLMSTLLGLQNDPTQGFSLTRDHIKAVVMNMFIAGSDTTTSILVWGMTELMRNPMVMKKA  325

Query  666  QSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEIKP  487
            Q E+R  +G KG++ E DIQ L Y K VVKE LRL+PP P+L+ RE + +C I+G++I  
Sbjct  326  QDEVRGLIGNKGKVEESDIQRLHYLKLVVKEVLRLHPPGPLLIPRECMQHCKINGFDIPK  385

Query  486  KMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIALGV  307
            K  V++N+WAI RD   W+    F PERF DN +DYKGQ F+F+PFG GRR+CPG++L V
Sbjct  386  KTRVYINAWAINRDSRHWQGAEVFMPERFKDNDIDYKGQHFQFLPFGSGRRICPGMSLSV  445

Query  306  ASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLVAKKV  157
               ELALANLLY F+W+LP+ + KEDID      + MH+K  L LVA  +
Sbjct  446  VVLELALANLLYRFNWDLPAGMSKEDIDMEEQFDLVMHRKSNLVLVAAPI  495



>gb|KDO50397.1| hypothetical protein CISIN_1g020458mg [Citrus sinensis]
Length=326

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 158/228 (69%), Gaps = 0/228 (0%)
 Frame = -1

Query  852  DGDILDVLISLKMENSSSVNLTWDHIKAVLMIVFVAGSDTSAALIVWAMTALMKEPRIMN  673
            D D++DVL+ ++       +LT DHIKAV+  +F AGS+TSA  + WAM  +M+ PR+M 
Sbjct  89   DEDLVDVLLKIQGRGDLDSSLTTDHIKAVIFDIFAAGSETSATTVDWAMCEMMRNPRVMK  148

Query  672  IVQSEIRDRVGKKGRINEEDIQELPYFKAVVKETLRLYPPVPILVERETLSNCTIDGYEI  493
              Q+E+R+   + G++NE  I E+ +FK  VKETLRL+P  P+L+ RE    C I+G++I
Sbjct  149  KAQAEVREVFHRTGKVNETSIDEMKFFKLFVKETLRLHPVAPLLLPRECGERCQINGFDI  208

Query  492  KPKMLVFVNSWAIARDPECWENPHEFYPERFLDNKVDYKGQDFEFIPFGGGRRVCPGIAL  313
              K  VFVN+WAI RDP+ W  P  F PERFLD+ +DYKG +FEFIPFG GRR+CPG++ 
Sbjct  209  PVKAKVFVNAWAIGRDPKYWTEPASFIPERFLDHSIDYKGTNFEFIPFGAGRRICPGMSF  268

Query  312  GVASAELALANLLYAFDWELPSWLKKEDIDTNVSPGITMHKKIPLCLV  169
            G+AS EL LA LLY FDW+LP+ +K ED+D   +   T+ +K  LC++
Sbjct  269  GLASVELPLAMLLYHFDWKLPNGMKHEDLDMTEAFATTVRRKQDLCMI  316



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686