BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8667

Length=1168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFD22619.1|  dicer-like 2 protein                                    369   4e-112   Nicotiana attenuata
gb|KDP26899.1|  hypothetical protein JCGZ_18057                         345   2e-111   Jatropha curcas
ref|XP_009625898.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    366   4e-111   
ref|XP_009783913.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    365   7e-111   Nicotiana sylvestris
gb|KDO45678.1|  hypothetical protein CISIN_1g0030622mg                  336   4e-109   Citrus sinensis [apfelsine]
ref|XP_011466081.1|  PREDICTED: endoribonuclease Dicer homolog 2        355   4e-107   Fragaria vesca subsp. vesca
gb|KJB61696.1|  hypothetical protein B456_009G374900                    349   1e-106   Gossypium raimondii
ref|XP_007029212.1|  Dicer-like protein isoform 5                       349   2e-106   
ref|XP_010312608.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    352   4e-106   
ref|XP_002514810.1|  ATP binding protein, putative                      352   4e-106   
ref|XP_007029213.1|  Dicer-like protein isoform 6                       348   7e-106   
ref|XP_007029210.1|  Dicer-like protein isoform 3                       349   1e-105   
ref|XP_008370841.1|  PREDICTED: endoribonuclease Dicer homolog 2        350   1e-105   
gb|KJB61693.1|  hypothetical protein B456_009G374900                    350   2e-105   Gossypium raimondii
ref|XP_009340367.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    350   2e-105   Pyrus x bretschneideri [bai li]
gb|KJB61692.1|  hypothetical protein B456_009G374900                    350   2e-105   Gossypium raimondii
ref|XP_007029209.1|  Dicer-like protein isoform 2                       348   6e-105   
ref|XP_007029208.1|  Dicer-like protein isoform 1                       348   6e-105   
ref|XP_006428679.1|  hypothetical protein CICLE_v10010912mg             348   9e-105   Citrus clementina [clementine]
ref|XP_006480493.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    348   1e-104   Citrus sinensis [apfelsine]
ref|XP_002312197.1|  hypothetical protein POPTR_0008s07580g             348   2e-104   
gb|KJB14793.1|  hypothetical protein B456_002G143000                    346   4e-104   Gossypium raimondii
ref|XP_007208392.1|  hypothetical protein PRUPE_ppa000240mg             345   8e-104   
ref|XP_010312607.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    345   8e-104   
ref|XP_009361581.1|  PREDICTED: endoribonuclease Dicer homolog 2        345   9e-104   
ref|XP_010312606.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    345   9e-104   Solanum lycopersicum
ref|XP_010312604.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    345   1e-103   Solanum lycopersicum
gb|KHG30500.1|  hypothetical protein F383_12835                         343   4e-103   Gossypium arboreum [tree cotton]
ref|XP_008218472.1|  PREDICTED: endoribonuclease Dicer homolog 2        343   5e-103   Prunus mume [ume]
gb|KHG30499.1|  hypothetical protein F383_12835                         343   6e-103   Gossypium arboreum [tree cotton]
ref|XP_012085800.1|  PREDICTED: endoribonuclease Dicer homolog 2        343   8e-103   Jatropha curcas
ref|XP_002315119.1|  hypothetical protein POPTR_0010s18870g             341   3e-102   
ref|XP_008240740.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    332   4e-102   Prunus mume [ume]
emb|CDP04170.1|  unnamed protein product                                339   1e-101   Coffea canephora [robusta coffee]
ref|XP_011006570.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    339   1e-101   Populus euphratica
ref|XP_011015099.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    339   1e-101   Populus euphratica
ref|XP_011015091.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    339   1e-101   Populus euphratica
ref|XP_011015068.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    339   1e-101   Populus euphratica
ref|XP_008240779.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    327   1e-100   Prunus mume [ume]
ref|XP_011084676.1|  PREDICTED: endoribonuclease Dicer homolog 2        335   3e-100   Sesamum indicum [beniseed]
ref|XP_007217819.1|  hypothetical protein PRUPE_ppa027063mg             325   3e-100   
ref|XP_010649218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    335   4e-100   Vitis vinifera
emb|CBI17597.3|  unnamed protein product                                335   5e-100   Vitis vinifera
ref|XP_010649215.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    335   7e-100   Vitis vinifera
ref|XP_010649214.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    334   8e-100   Vitis vinifera
ref|XP_010649216.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    334   8e-100   Vitis vinifera
ref|XP_007216887.1|  hypothetical protein PRUPE_ppa020875mg             324   1e-99    
emb|CAN77284.1|  hypothetical protein VITISV_043738                     333   1e-99    Vitis vinifera
ref|XP_006480490.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    330   3e-98    Citrus sinensis [apfelsine]
ref|XP_006480488.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    330   4e-98    
ref|XP_004303843.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    328   8e-98    Fragaria vesca subsp. vesca
ref|XP_006428678.1|  hypothetical protein CICLE_v10010911mg             327   3e-97    Citrus clementina [clementine]
ref|XP_010101236.1|  Endoribonuclease Dicer-2-like protein              326   6e-97    
gb|EYU39730.1|  hypothetical protein MIMGU_mgv1a0003142mg               322   5e-96    Erythranthe guttata [common monkey flower]
gb|KCW84635.1|  hypothetical protein EUGRSUZ_B01461                     322   1e-95    Eucalyptus grandis [rose gum]
gb|AIE15764.1|  Dicer-like protein 2                                    321   3e-95    Salvia miltiorrhiza [Chinese salvia]
ref|XP_010038609.1|  PREDICTED: endoribonuclease Dicer homolog 2        321   3e-95    Eucalyptus grandis [rose gum]
ref|XP_010673887.1|  PREDICTED: endoribonuclease Dicer homolog 2        320   9e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007029214.1|  Dicer-like protein isoform 7                       314   2e-94    
ref|XP_010249398.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    317   4e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010249397.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    317   7e-94    Nelumbo nucifera [Indian lotus]
gb|KEH42074.1|  endoribonuclease dicer-like protein                     317   1e-93    Medicago truncatula
ref|XP_006586846.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    314   1e-92    Glycine max [soybeans]
ref|XP_003534774.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    314   1e-92    Glycine max [soybeans]
ref|XP_006586847.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    313   2e-92    Glycine max [soybeans]
gb|KHN23014.1|  Endoribonuclease Dicer like 2                           313   2e-92    Glycine soja [wild soybean]
ref|XP_007147466.1|  hypothetical protein PHAVU_006G127100g             311   1e-91    Phaseolus vulgaris [French bean]
emb|CDP20270.1|  unnamed protein product                                290   3e-91    Coffea canephora [robusta coffee]
ref|XP_004486471.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    307   3e-90    Cicer arietinum [garbanzo]
ref|XP_006300010.1|  hypothetical protein CARUB_v10016233mg             305   1e-89    
ref|NP_566199.4|  endoribonuclease Dicer-like 2                         305   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078101.1|  endoribonuclease Dicer-like 2                      304   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535104.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    303   6e-89    Glycine max [soybeans]
ref|XP_010508779.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    303   7e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010508629.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    303   1e-88    Camelina sativa [gold-of-pleasure]
gb|ABF19797.1|  dicer-like 2 spliceform 1                               302   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ABF19798.1|  dicer-like 2 spliceform 2                               302   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373030.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    295   2e-88    
gb|AES64802.2|  endoribonuclease dicer-like protein                     301   3e-88    Medicago truncatula
ref|XP_003594551.1|  Endoribonuclease Dicer                             301   4e-88    
ref|XP_007216896.1|  hypothetical protein PRUPE_ppa019601mg             295   4e-88    
gb|AAF26098.1|AC012328_1  unknown protein                               303   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011660218.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    300   7e-88    Cucumis sativus [cucumbers]
ref|XP_011660217.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    300   8e-88    Cucumis sativus [cucumbers]
ref|XP_004139098.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    300   9e-88    Cucumis sativus [cucumbers]
ref|XP_009348590.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    293   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_002884369.1|  hypothetical protein ARALYDRAFT_317213             302   2e-87    
ref|XP_007140643.1|  hypothetical protein PHAVU_008G129500g             299   3e-87    Phaseolus vulgaris [French bean]
ref|XP_007147469.1|  hypothetical protein PHAVU_006G127200g             298   5e-87    Phaseolus vulgaris [French bean]
ref|XP_010485668.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    298   6e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010485670.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    297   6e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010485666.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    298   7e-87    Camelina sativa [gold-of-pleasure]
emb|CDO96787.1|  unnamed protein product                                278   2e-86    Coffea canephora [robusta coffee]
ref|NP_001131630.1|  uncharacterized protein LOC100192986               278   3e-86    
emb|CDP06207.1|  unnamed protein product                                288   5e-86    Coffea canephora [robusta coffee]
ref|XP_006408318.1|  hypothetical protein EUTSA_v10019898mg             295   5e-86    Eutrema salsugineum [saltwater cress]
emb|CDY43132.1|  BnaA05g32540D                                          293   2e-85    Brassica napus [oilseed rape]
ref|XP_009130358.1|  PREDICTED: endoribonuclease Dicer homolog 2        293   3e-85    
emb|CDY50692.1|  BnaC05g47910D                                          293   3e-85    Brassica napus [oilseed rape]
gb|ACE60552.1|  dicer-like protein 2                                    291   2e-84    Brassica rapa
ref|XP_008443675.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    289   5e-84    
ref|XP_008443676.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    289   6e-84    Cucumis melo [Oriental melon]
ref|XP_008443670.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    289   7e-84    Cucumis melo [Oriental melon]
ref|XP_010508928.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    288   9e-84    
ref|XP_011623569.1|  PREDICTED: endoribonuclease Dicer homolog 2        288   1e-83    
gb|ERN06445.1|  hypothetical protein AMTR_s00016p00258500               288   2e-83    Amborella trichopoda
emb|CDO96788.1|  unnamed protein product                                279   1e-82    Coffea canephora [robusta coffee]
ref|XP_010549776.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    285   1e-82    Tarenaya hassleriana [spider flower]
ref|XP_010549772.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    285   2e-82    Tarenaya hassleriana [spider flower]
gb|AFW68290.1|  hypothetical protein ZEAMMB73_539070                    278   2e-82    
emb|CDO96789.1|  unnamed protein product                                277   2e-81    Coffea canephora [robusta coffee]
ref|XP_010088523.1|  Endoribonuclease Dicer-2-like protein              277   4e-80    
gb|ABK24820.1|  unknown                                                 260   9e-80    Picea sitchensis
ref|XP_008681081.1|  PREDICTED: uncharacterized protein LOC100192...    276   3e-79    
ref|XP_008681082.1|  PREDICTED: uncharacterized protein LOC100192...    276   3e-79    Zea mays [maize]
ref|XP_007147294.1|  hypothetical protein PHAVU_006G111800g             266   6e-78    Phaseolus vulgaris [French bean]
ref|XP_002464290.1|  hypothetical protein SORBIDRAFT_01g015670          273   6e-78    
ref|XP_010233062.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    270   1e-77    
ref|XP_010233057.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    270   2e-77    
ref|XP_003553782.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    265   3e-77    Glycine max [soybeans]
ref|XP_006604892.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    265   6e-77    Glycine max [soybeans]
gb|EMS67761.1|  Endoribonuclease Dicer-like protein 2a                  258   9e-77    Triticum urartu
gb|KHN43108.1|  Endoribonuclease Dicer like 2                           265   1e-76    Glycine soja [wild soybean]
ref|XP_004982513.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    268   2e-76    Setaria italica
gb|ADT91700.1|  dicer-like protein 2                                    248   3e-76    Nicotiana attenuata
ref|XP_010229604.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    267   6e-76    
ref|XP_008443674.1|  PREDICTED: endoribonuclease Dicer homolog 2 ...    262   3e-74    Cucumis melo [Oriental melon]
ref|XP_006651573.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    254   1e-71    Oryza brachyantha
ref|XP_008392375.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    247   1e-70    
ref|XP_008351646.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    246   1e-70    
gb|AAS07189.1|  putative ribonuclease III, 5'-partial (with alter...    244   1e-68    Oryza sativa Japonica Group [Japonica rice]
gb|EEC75643.1|  hypothetical protein OsI_12390                          244   6e-68    Oryza sativa Indica Group [Indian rice]
ref|NP_001050564.1|  Os03g0583900                                       244   8e-68    
gb|EEE59414.1|  hypothetical protein OsJ_11564                          236   5e-65    Oryza sativa Japonica Group [Japonica rice]
sp|Q69LX2.2|DCL2B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...    234   2e-64    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD34005.1|  CAF protein-like                                       234   3e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982511.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    228   1e-63    Setaria italica
gb|AFW68291.1|  hypothetical protein ZEAMMB73_565304                    221   2e-63    
ref|XP_004982509.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    227   2e-63    Setaria italica
ref|XP_008644683.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    221   3e-63    
ref|XP_008644682.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    221   5e-63    
ref|XP_008644680.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    221   2e-61    Zea mays [maize]
ref|XP_008644679.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    220   3e-61    Zea mays [maize]
ref|XP_008644678.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    220   4e-61    Zea mays [maize]
ref|XP_008644677.1|  PREDICTED: uncharacterized protein LOC103626...    221   5e-61    Zea mays [maize]
ref|XP_008644676.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    220   7e-61    Zea mays [maize]
gb|AJA90756.1|  Dicer-like 3                                            214   4e-57    Cycas revoluta
ref|XP_002464289.1|  hypothetical protein SORBIDRAFT_01g015666          204   5e-57    
gb|AIE15763.1|  Dicer-like protein 1                                    212   1e-56    Salvia miltiorrhiza [Chinese salvia]
gb|AFD22618.1|  dicer-like 1 protein                                    211   3e-56    Nicotiana attenuata
ref|XP_010934026.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    210   8e-56    
ref|XP_010934025.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    210   8e-56    Elaeis guineensis
dbj|BAD94606.1|  CAF protein                                            205   1e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686530.1|  PREDICTED: endoribonuclease Dicer homolog 1        209   1e-55    Beta vulgaris subsp. vulgaris [field beet]
gb|AIO05700.1|  putative endoribonuclease dicer-like protein 1          209   2e-55    Cocos nucifera
gb|AJA90772.1|  Dicer-like 3                                            209   3e-55    Ginkgo biloba [ginkgo]
ref|XP_009411416.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    208   3e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783544.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    208   3e-55    Phoenix dactylifera
ref|XP_009411415.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    208   5e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650986.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    207   7e-55    
gb|EYU35897.1|  hypothetical protein MIMGU_mgv1a000073mg                207   8e-55    Erythranthe guttata [common monkey flower]
ref|XP_010229289.1|  PREDICTED: endoribonuclease Dicer homolog 1        207   9e-55    Brachypodium distachyon [annual false brome]
ref|XP_012083084.1|  PREDICTED: endoribonuclease Dicer homolog 1        206   2e-54    Jatropha curcas
ref|XP_009794783.1|  PREDICTED: endoribonuclease Dicer homolog 1        204   2e-54    Nicotiana sylvestris
gb|KFK42493.1|  hypothetical protein AALP_AA1G000600                    205   3e-54    Arabis alpina [alpine rockcress]
ref|XP_002448150.1|  hypothetical protein SORBIDRAFT_06g022180          201   4e-54    
ref|XP_002515097.1|  dicer-1, putative                                  204   6e-54    
ref|XP_011071730.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    204   8e-54    
ref|XP_010054144.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    204   1e-53    Eucalyptus grandis [rose gum]
gb|EAZ25399.1|  hypothetical protein OsJ_09217                          204   1e-53    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88320.1|  hypothetical protein OsI_09779                          204   1e-53    Oryza sativa Indica Group [Indian rice]
sp|Q8LMR2.1|DCL1_ORYSJ  RecName: Full=Endoribonuclease Dicer homo...    204   1e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007220573.1|  hypothetical protein PRUPE_ppa000070mg             204   1e-53    Prunus persica
ref|XP_010054145.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    204   1e-53    Eucalyptus grandis [rose gum]
ref|XP_011071729.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    203   1e-53    Sesamum indicum [beniseed]
gb|EPS58332.1|  hypothetical protein M569_16483                         197   2e-53    Genlisea aurea
ref|XP_008373031.1|  PREDICTED: endoribonuclease Dicer homolog 2-...    199   2e-53    
ref|NP_001184881.1|  endoribonuclease Dicer-like 1                      203   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|NP_171612.1|  endoribonuclease Dicer-like 1                         203   2e-53    Arabidopsis thaliana [mouse-ear cress]
gb|AAF03534.1|AF187317_1  CAF protein                                   203   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474687.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    203   2e-53    Camelina sativa [gold-of-pleasure]
ref|XP_010474688.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    203   2e-53    
ref|XP_010661522.1|  PREDICTED: endoribonuclease Dicer homolog 1        203   3e-53    Vitis vinifera
gb|AEZ02177.1|  Dicer                                                   202   3e-53    Arabidopsis thaliana [mouse-ear cress]
gb|EMT07624.1|  Endoribonuclease Dicer-1-like protein                   202   3e-53    
gb|KHG02896.1|  Endoribonuclease Dicer -like protein                    202   3e-53    Gossypium arboreum [tree cotton]
ref|XP_002961233.1|  hypothetical protein SELMODRAFT_74321              202   3e-53    
tpg|DAA43005.1|  TPA: hypothetical protein ZEAMMB73_941906              201   4e-53    
gb|ERN08097.1|  hypothetical protein AMTR_s00018p00015000               202   4e-53    Amborella trichopoda
ref|NP_001289827.1|  endoribonuclease Dicer homolog 1                   202   4e-53    Solanum lycopersicum
ref|XP_011624219.1|  PREDICTED: endoribonuclease Dicer homolog 1        202   4e-53    
ref|XP_008437750.1|  PREDICTED: endoribonuclease Dicer homolog 1        202   5e-53    Cucumis melo [Oriental melon]
ref|XP_011468880.1|  PREDICTED: endoribonuclease Dicer homolog 1        202   5e-53    Fragaria vesca subsp. vesca
ref|XP_011650612.1|  PREDICTED: endoribonuclease Dicer homolog 1        202   5e-53    Cucumis sativus [cucumbers]
ref|XP_002969464.1|  hypothetical protein SELMODRAFT_91347              201   5e-53    
ref|XP_008244191.1|  PREDICTED: endoribonuclease Dicer homolog 1        202   5e-53    Prunus mume [ume]
ref|XP_006306578.1|  hypothetical protein CARUB_v10008073mg             202   5e-53    Capsella rubella
ref|XP_006352611.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    202   5e-53    Solanum tuberosum [potatoes]
ref|XP_010457181.1|  PREDICTED: endoribonuclease Dicer homolog 1        202   6e-53    Camelina sativa [gold-of-pleasure]
ref|XP_010240123.1|  PREDICTED: endoribonuclease Dicer homolog 4        201   8e-53    Brachypodium distachyon [annual false brome]
ref|XP_007139041.1|  hypothetical protein PHAVU_009G260000g             201   8e-53    Phaseolus vulgaris [French bean]
ref|XP_006386668.1|  Endoribonuclease Dicer family protein              201   8e-53    Populus trichocarpa [western balsam poplar]
ref|XP_008681621.1|  PREDICTED: uncharacterized protein LOC100381...    201   9e-53    
gb|EMS58929.1|  Endoribonuclease Dicer-like protein 1                   201   1e-52    Triticum urartu
gb|KHN11363.1|  Endoribonuclease Dicer like 1                           201   1e-52    Glycine soja [wild soybean]
ref|XP_006604922.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    201   1e-52    Glycine max [soybeans]
ref|XP_011025346.1|  PREDICTED: endoribonuclease Dicer homolog 1        201   1e-52    Populus euphratica
ref|XP_010932228.1|  PREDICTED: endoribonuclease Dicer homolog 4        200   2e-52    
ref|XP_011083770.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    200   2e-52    
ref|XP_011083691.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    200   2e-52    
ref|XP_011083615.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    200   2e-52    
ref|XP_011083398.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    200   2e-52    
ref|XP_011083472.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    200   2e-52    Sesamum indicum [beniseed]
ref|XP_011083544.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    200   3e-52    
ref|XP_010241057.1|  PREDICTED: endoribonuclease Dicer homolog 1        200   3e-52    Nelumbo nucifera [Indian lotus]
ref|XP_009358497.1|  PREDICTED: dicer-like protein 4                    199   3e-52    Pyrus x bretschneideri [bai li]
gb|ABV31244.1|  dicer-like 1                                            199   3e-52    Physcomitrella patens
gb|KHN16394.1|  Endoribonuclease Dicer like 1                           199   3e-52    Glycine soja [wild soybean]
ref|XP_006577359.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    199   3e-52    Glycine max [soybeans]
ref|XP_009606996.1|  PREDICTED: endoribonuclease Dicer homolog 1        199   4e-52    
ref|XP_001757950.1|  dsRNA-specific nuclease dicer and related ri...    199   5e-52    
ref|XP_002892088.1|  hypothetical protein ARALYDRAFT_333551             199   5e-52    
ref|XP_002991516.1|  hypothetical protein SELMODRAFT_448444             199   5e-52    
gb|AES82838.2|  endoribonuclease dicer-like protein                     199   5e-52    Medicago truncatula
gb|KEH24704.1|  endoribonuclease dicer-like protein                     199   5e-52    Medicago truncatula
ref|NP_001266210.1|  dicer-like protein 4                               199   5e-52    
gb|ABD32724.1|  Helicase, C-terminal; Argonaute and Dicer protein...    199   5e-52    Medicago truncatula
ref|XP_003626620.1|  Endoribonuclease Dicer-like protein                199   6e-52    
gb|ABR17101.1|  unknown                                                 194   6e-52    Picea sitchensis
ref|XP_007051387.1|  Helicase, C-terminal, Argonaute and Dicer pr...    199   6e-52    
ref|XP_004976180.1|  PREDICTED: endoribonuclease Dicer homolog 4-...    198   6e-52    Setaria italica
gb|KJB09575.1|  hypothetical protein B456_001G150400                    198   8e-52    Gossypium raimondii
gb|KJB09576.1|  hypothetical protein B456_001G150400                    198   9e-52    Gossypium raimondii
ref|XP_007051386.1|  Dicer-like 1 isoform 1                             198   9e-52    
ref|XP_009335261.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    198   1e-51    Pyrus x bretschneideri [bai li]
ref|XP_010107130.1|  Endoribonuclease Dicer-1-like protein              198   1e-51    
ref|XP_004976179.1|  PREDICTED: endoribonuclease Dicer homolog 4-...    198   1e-51    Setaria italica
ref|XP_009366581.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    197   2e-51    
ref|XP_008352221.1|  PREDICTED: dicer-like protein 4                    191   2e-51    
ref|XP_008337203.1|  PREDICTED: dicer-like protein 4                    191   2e-51    
ref|XP_008358840.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    197   2e-51    
ref|XP_006418369.1|  hypothetical protein EUTSA_v10006531mg             197   3e-51    Eutrema salsugineum [saltwater cress]
ref|XP_004985932.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    197   3e-51    Setaria italica
emb|CDX92469.1|  BnaA10g15080D                                          196   5e-51    
ref|XP_010556639.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    196   5e-51    Tarenaya hassleriana [spider flower]
ref|XP_010556636.1|  PREDICTED: endoribonuclease Dicer homolog 1 ...    196   5e-51    Tarenaya hassleriana [spider flower]
gb|EMS51466.1|  Endoribonuclease Dicer-like protein 4                   195   8e-51    Triticum urartu
gb|EMT06391.1|  Endoribonuclease Dicer-4-like protein                   195   8e-51    
gb|AIE15765.1|  Dicer-like protein 3                                    195   9e-51    Salvia miltiorrhiza [Chinese salvia]
ref|XP_004494885.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    195   9e-51    
ref|XP_004494884.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    195   9e-51    Cicer arietinum [garbanzo]
ref|XP_006653591.1|  PREDICTED: endoribonuclease Dicer homolog 4-...    195   1e-50    Oryza brachyantha
ref|XP_002978277.1|  hypothetical protein SELMODRAFT_108314             195   1e-50    Selaginella moellendorffii
ref|XP_002966292.1|  hypothetical protein SELMODRAFT_86110              195   1e-50    Selaginella moellendorffii
ref|XP_001772316.1|  predicted protein                                  194   1e-50    
ref|XP_006343690.1|  PREDICTED: dicer-like protein 4-like isoform X1    194   1e-50    Solanum tuberosum [potatoes]
gb|AIO05703.1|  putative endoribonuclease dicer 4-like protein 4        194   2e-50    Cocos nucifera
ref|XP_006343691.1|  PREDICTED: dicer-like protein 4-like isoform X2    194   2e-50    Solanum tuberosum [potatoes]
dbj|BAG90040.1|  unnamed protein product                                193   2e-50    Oryza sativa Japonica Group [Japonica rice]
emb|CDY35811.1|  BnaC09g37430D                                          194   2e-50    Brassica napus [oilseed rape]
ref|NP_001053278.1|  Os04g0509300                                       193   2e-50    
gb|AJA90780.1|  Dicer-like 3                                            194   3e-50    Pinus canariensis [Canary Island pine]
ref|XP_006491399.1|  PREDICTED: endoribonuclease Dicer homolog 1-...    194   3e-50    Citrus sinensis [apfelsine]
ref|XP_009119662.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    194   3e-50    Brassica rapa
ref|XP_006444699.1|  hypothetical protein CICLE_v10018447mg             194   3e-50    Citrus clementina [clementine]
gb|KDO86652.1|  hypothetical protein CISIN_1g000174mg                   194   4e-50    Citrus sinensis [apfelsine]
emb|CDX90002.1|  BnaA10g00800D                                          193   4e-50    
ref|XP_010323153.1|  PREDICTED: dicer-like protein 4 isoform X3         193   5e-50    
emb|CDY15207.1|  BnaC05g00860D                                          193   5e-50    Brassica napus [oilseed rape]
ref|XP_010323152.1|  PREDICTED: dicer-like protein 4 isoform X2         193   6e-50    
ref|XP_010323151.1|  PREDICTED: dicer-like protein 4 isoform X1         193   6e-50    Solanum lycopersicum
emb|CAE03362.1|  OSJNBb0065L13.5                                        192   7e-50    Oryza sativa Japonica Group [Japonica rice]
dbj|BAF80150.1|  SHOOT ORGANIZATION1                                    192   7e-50    Oryza sativa Japonica Group [Japonica rice]
sp|A7LFZ6.1|DCL4_ORYSJ  RecName: Full=Endoribonuclease Dicer homo...    192   7e-50    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77616.1|  hypothetical protein OsI_16596                          192   7e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_011078683.1|  PREDICTED: dicer-like protein 4 isoform X1         192   1e-49    Sesamum indicum [beniseed]
ref|XP_011078684.1|  PREDICTED: dicer-like protein 4 isoform X2         192   1e-49    
ref|XP_010424192.1|  PREDICTED: dicer-like protein 4                    191   1e-49    
ref|NP_197532.3|  dicer-like protein 4                                  192   1e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012077173.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    191   1e-49    
ref|XP_009120817.1|  PREDICTED: dicer-like protein 4                    191   2e-49    
ref|XP_009418500.1|  PREDICTED: endoribonuclease Dicer homolog 4        191   2e-49    
ref|NP_001190348.1|  dicer-like protein 4                               191   2e-49    
ref|XP_010495321.1|  PREDICTED: dicer-like protein 4                    191   2e-49    
ref|XP_010454337.1|  PREDICTED: dicer-like protein 4                    191   2e-49    
ref|XP_010261807.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    191   3e-49    
ref|XP_010261808.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    191   3e-49    
ref|XP_010520559.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    191   3e-49    
gb|AJA90765.1|  Dicer-like 3                                            191   3e-49    
gb|AFD22621.1|  dicer-like 4 protein                                    190   6e-49    
ref|XP_008376239.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    189   1e-48    
ref|XP_006289431.1|  hypothetical protein CARUB_v10002936mg             189   1e-48    
ref|XP_010047156.1|  PREDICTED: dicer-like protein 4 isoform X1         189   1e-48    
ref|XP_008364841.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    189   1e-48    
ref|XP_004982510.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    185   2e-48    
gb|AAF26461.1|AC007323_2  T25K16.4                                      188   3e-48    
ref|XP_007204799.1|  hypothetical protein PRUPE_ppa000144mg             187   7e-48    
gb|ABG74922.1|  Dicer-like 1b protein                                   186   1e-47    
gb|ABV31246.1|  dicer-like 4                                            186   1e-47    
gb|AIE15767.1|  Dicer-like protein 4b                                   186   2e-47    
ref|XP_008243098.1|  PREDICTED: dicer-like protein 4                    186   2e-47    
ref|XP_002873991.1|  predicted protein                                  186   2e-47    
gb|EEC67202.1|  hypothetical protein OsI_34085                          184   2e-47    
ref|XP_006452950.1|  hypothetical protein CICLE_v10007239mg             185   2e-47    
ref|XP_006452951.1|  hypothetical protein CICLE_v10007239mg             185   2e-47    
ref|XP_006474519.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    185   3e-47    
ref|XP_006474520.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    185   3e-47    
gb|ABB20894.1|  dicer-like protein                                      184   3e-47    
ref|XP_010535851.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    184   5e-47    
ref|XP_010098282.1|  Dicer-like protein 4                               184   7e-47    
gb|KJB65397.1|  hypothetical protein B456_010G093100                    184   7e-47    
ref|NP_001064898.2|  Os10g0485600                                       183   8e-47    
gb|KJB65396.1|  hypothetical protein B456_010G093100                    184   8e-47    
gb|AEC12444.1|  ribonuclease III family protein DCL3                    183   9e-47    
emb|CAX18337.1|  dicel-like 2                                           171   9e-47    
ref|XP_001766164.1|  dsRNA-specific nuclease dicer and related ri...    183   1e-46    
gb|KJB65395.1|  hypothetical protein B456_010G093100                    183   1e-46    
gb|KJB65398.1|  hypothetical protein B456_010G093100                    183   1e-46    
gb|EEE51167.1|  hypothetical protein OsJ_31945                          183   1e-46    
sp|Q7XD96.2|DCL3B_ORYSJ  RecName: Full=Endoribonuclease Dicer hom...    183   1e-46    
ref|XP_007225476.1|  hypothetical protein PRUPE_ppa000165mg             183   1e-46    
gb|AES73487.2|  endoribonuclease dicer-like protein                     183   1e-46    
ref|XP_007012010.1|  Dicer-like protein, putative isoform 1             183   2e-46    
ref|XP_003603236.1|  Endoribonuclease Dicer-like protein                183   2e-46    
ref|XP_007012011.1|  Dicer-like protein isoform 2                       182   2e-46    
ref|XP_009363041.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    182   2e-46    
gb|ABV31245.1|  dicer-like 3                                            182   2e-46    
gb|AIO05701.1|  putative endoribonuclease dicer 3a-like protein 3a      182   2e-46    
ref|XP_008445598.1|  PREDICTED: endoribonuclease Dicer homolog 3        182   3e-46    
ref|XP_010656556.1|  PREDICTED: dicer-like protein 4 isoform X1         182   3e-46    
ref|XP_008220598.1|  PREDICTED: endoribonuclease Dicer homolog 3        182   3e-46    
ref|XP_009400626.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    182   3e-46    
emb|CDP10524.1|  unnamed protein product                                182   3e-46    
ref|XP_007155126.1|  hypothetical protein PHAVU_003G1757001g            181   3e-46    
emb|CBI25610.3|  unnamed protein product                                182   4e-46    
ref|XP_002264486.2|  PREDICTED: dicer-like protein 4 isoform X2         181   4e-46    
ref|XP_009765935.1|  PREDICTED: dicer-like protein 4 isoform X2         181   4e-46    
ref|XP_009765936.1|  PREDICTED: dicer-like protein 4 isoform X3         181   4e-46    
ref|XP_009765934.1|  PREDICTED: dicer-like protein 4 isoform X1         181   4e-46    
ref|XP_006661878.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    181   6e-46    
ref|XP_006361520.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    181   7e-46    
ref|XP_011469001.1|  PREDICTED: dicer-like protein 4                    181   7e-46    
ref|XP_008357238.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    181   7e-46    
ref|XP_009588925.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    181   7e-46    
ref|XP_008357237.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    181   7e-46    
ref|XP_009381868.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    180   7e-46    
ref|XP_009588920.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    181   8e-46    
ref|XP_008796519.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    181   8e-46    
ref|XP_011002834.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    180   9e-46    
ref|XP_009777737.1|  PREDICTED: endoribonuclease Dicer homolog 3a       181   9e-46    
ref|NP_001289826.1|  endoribonuclease Dicer homolog 3a                  181   9e-46    
gb|KHG13242.1|  Endoribonuclease Dicera                                 181   9e-46    
ref|XP_010245534.1|  PREDICTED: dicer-like protein 4 isoform X1         180   1e-45    
ref|XP_002324204.2|  hypothetical protein POPTR_0018s08340g             180   1e-45    
ref|XP_011657368.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    180   1e-45    
ref|XP_002965641.1|  hypothetical protein SELMODRAFT_84784              175   1e-45    
ref|XP_009359046.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    180   1e-45    
ref|XP_011002832.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    180   1e-45    
ref|XP_011002831.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    180   1e-45    
ref|XP_011002828.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    180   1e-45    
ref|XP_011657364.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    180   1e-45    
ref|XP_011033477.1|  PREDICTED: dicer-like protein 4                    180   1e-45    
ref|XP_011002830.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    180   1e-45    
ref|XP_011657365.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    180   1e-45    
ref|XP_011657366.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    180   1e-45    
gb|AFD22620.1|  dicer-like 3 protein                                    176   1e-45    
ref|XP_006594228.1|  PREDICTED: dicer-like protein 4-like isoform X2    179   2e-45    
ref|XP_002308384.2|  hypothetical protein POPTR_0006s20310g             179   3e-45    
ref|XP_006594227.1|  PREDICTED: dicer-like protein 4-like isoform X1    179   3e-45    
ref|XP_006400600.1|  hypothetical protein EUTSA_v100124261mg            173   3e-45    
ref|XP_004292050.2|  PREDICTED: endoribonuclease Dicer homolog 3-...    177   3e-45    
ref|XP_006594229.1|  PREDICTED: dicer-like protein 4-like isoform X3    179   4e-45    
gb|KDP38631.1|  hypothetical protein JCGZ_03984                         178   4e-45    
ref|XP_002458957.1|  hypothetical protein SORBIDRAFT_03g043355          179   4e-45    
ref|XP_012071444.1|  PREDICTED: dicer-like protein 4 isoform X2         178   5e-45    
ref|XP_010231294.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    177   5e-45    
ref|XP_012071443.1|  PREDICTED: dicer-like protein 4 isoform X1         178   5e-45    
gb|KEH32166.1|  endoribonuclease dicer-like protein                     178   5e-45    
ref|XP_010932925.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    178   5e-45    
ref|XP_007012462.1|  Endoribonuclease Dicera, putative isoform 2        177   6e-45    
ref|XP_009334949.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    178   6e-45    
ref|XP_010231293.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    177   7e-45    
tpg|DAA49561.1|  TPA: hypothetical protein ZEAMMB73_299457              177   8e-45    
ref|XP_004508388.1|  PREDICTED: dicer-like protein 4-like               177   8e-45    
gb|KJB54891.1|  hypothetical protein B456_009G053300                    177   9e-45    
gb|KJB54890.1|  hypothetical protein B456_009G053300                    177   9e-45    
ref|XP_007012461.1|  Ribonuclease III, putative isoform 1               177   9e-45    
tpg|DAA49562.1|  TPA: hypothetical protein ZEAMMB73_299457              177   1e-44    
ref|XP_004970995.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    177   1e-44    
ref|XP_008664845.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    177   1e-44    
ref|XP_008664847.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    177   1e-44    
ref|XP_010236618.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    177   1e-44    
ref|XP_008664844.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    177   1e-44    
tpg|DAA49563.1|  TPA: hypothetical protein ZEAMMB73_299457              177   1e-44    
gb|KJB54892.1|  hypothetical protein B456_009G053300                    177   1e-44    
ref|XP_008664848.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    177   1e-44    
ref|XP_008393569.1|  PREDICTED: endoribonuclease Dicer homolog 3a       177   1e-44    
ref|XP_010049290.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    177   1e-44    
ref|XP_002523532.1|  Ribonuclease III, putative                         177   1e-44    
ref|XP_004501416.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    177   1e-44    
ref|XP_010049291.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    177   1e-44    
ref|XP_002989272.1|  hypothetical protein SELMODRAFT_129431             172   1e-44    
ref|XP_008382783.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    177   2e-44    
gb|AIE15766.1|  Dicer-like protein 4a                                   177   2e-44    
gb|EYU29223.1|  hypothetical protein MIMGU_mgv1a0001672mg               174   2e-44    
ref|XP_008235739.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    176   2e-44    
gb|KHG18654.1|  Dicer-like protein 4                                    176   3e-44    
ref|XP_007201640.1|  hypothetical protein PRUPE_ppa021659mg             176   3e-44    
ref|XP_008793257.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    176   4e-44    
ref|XP_010906745.1|  PREDICTED: endoribonuclease Dicer homolog 3b...    175   7e-44    
emb|CDP19693.1|  unnamed protein product                                174   9e-44    
gb|EEE55857.1|  hypothetical protein OsJ_04485                          174   1e-43    
gb|EMS52805.1|  Endoribonuclease Dicer-like protein 3a                  174   1e-43    
gb|KHN22101.1|  Dicer-like protein 4                                    174   1e-43    
ref|NP_001045148.1|  Os01g0909200                                       174   2e-43    
ref|XP_003550797.1|  PREDICTED: dicer-like protein 4-like isoform X1    174   2e-43    
ref|XP_006600705.1|  PREDICTED: dicer-like protein 4-like isoform X2    174   2e-43    
gb|ERN14227.1|  hypothetical protein AMTR_s00033p00127000               174   2e-43    
ref|XP_011626444.1|  PREDICTED: endoribonuclease Dicer homolog 3a       174   2e-43    
gb|EEC72002.1|  hypothetical protein OsI_04862                          174   2e-43    
gb|EPS61362.1|  hypothetical protein M569_13434                         172   2e-43    
gb|AIO05702.1|  putative endoribonuclease dicer 3b-like protein         172   3e-43    
ref|XP_011458182.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    173   3e-43    
gb|KHN18588.1|  Dicer-like protein 4                                    173   4e-43    
gb|EAZ27614.1|  hypothetical protein OsJ_11558                          161   6e-43    
ref|XP_010233576.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    171   6e-43    
ref|XP_002516160.1|  Ribonuclease III, putative                         172   8e-43    
ref|XP_002467056.1|  hypothetical protein SORBIDRAFT_01g018890          172   9e-43    
ref|XP_011467219.1|  PREDICTED: endoribonuclease Dicer homolog 3a       171   1e-42    
gb|EMT13587.1|  Endoribonuclease Dicer-3b-like protein                  171   1e-42    
ref|XP_006645199.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    171   2e-42    
ref|XP_006645200.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    171   2e-42    
gb|KDO59383.1|  hypothetical protein CISIN_1g0003801mg                  167   2e-42    
ref|XP_010648400.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    171   2e-42    
ref|XP_011655835.1|  PREDICTED: dicer-like protein 4 isoform X1         171   2e-42    
ref|XP_011655837.1|  PREDICTED: dicer-like protein 4 isoform X2         171   2e-42    
ref|XP_010648401.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    171   2e-42    
emb|CDM85593.1|  unnamed protein product                                171   2e-42    
ref|XP_010514744.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    171   2e-42    
ref|XP_010514745.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    170   2e-42    
emb|CBI20740.3|  unnamed protein product                                171   2e-42    
ref|XP_010514746.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    170   2e-42    
ref|XP_008443891.1|  PREDICTED: dicer-like protein 4 isoform X4         170   3e-42    
ref|XP_008443889.1|  PREDICTED: dicer-like protein 4 isoform X3         170   3e-42    
ref|XP_008443888.1|  PREDICTED: dicer-like protein 4 isoform X2         170   3e-42    
ref|XP_008443887.1|  PREDICTED: dicer-like protein 4 isoform X1         170   3e-42    
gb|EMT29032.1|  Endoribonuclease Dicer-3a-like protein                  169   5e-42    
gb|EYU31801.1|  hypothetical protein MIMGU_mgv1a000153mg                169   5e-42    
gb|EYU31800.1|  hypothetical protein MIMGU_mgv1a000153mg                169   6e-42    
tpg|DAA56229.1|  TPA: hypothetical protein ZEAMMB73_255524              166   6e-42    
gb|KFM82755.1|  Endoribonuclease Dcr-1                                  168   6e-42    
ref|XP_010503060.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    169   7e-42    
ref|XP_010503059.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    169   7e-42    
ref|XP_010427121.1|  PREDICTED: endoribonuclease Dicer homolog 3-...    169   7e-42    
ref|XP_006293341.1|  hypothetical protein CARUB_v100165770mg            166   8e-42    
ref|XP_008801683.1|  PREDICTED: LOW QUALITY PROTEIN: endoribonucl...    167   1e-41    
gb|ERN10341.1|  hypothetical protein AMTR_s00026p00051870               167   2e-41    
ref|XP_006404521.1|  hypothetical protein EUTSA_v10010061mg             168   2e-41    
ref|NP_189978.1|  endoribonuclease Dicer-like 3                         167   2e-41    
ref|NP_001154663.2|  endoribonuclease Dicer-like 3                      167   3e-41    
ref|XP_006290500.1|  hypothetical protein CARUB_v10016574mg             167   3e-41    
ref|XP_011625065.1|  PREDICTED: endoribonuclease Dicer homolog 4        167   3e-41    
ref|NP_001154662.2|  endoribonuclease Dicer-like 3                      167   3e-41    
ref|XP_006453683.1|  hypothetical protein CICLE_v10007241mg             167   4e-41    
ref|XP_006473958.1|  PREDICTED: dicer-like protein 4-like isoform X2    167   4e-41    
ref|XP_006473957.1|  PREDICTED: dicer-like protein 4-like isoform X1    167   5e-41    
emb|CDY21223.1|  BnaC03g54010D                                          166   6e-41    
ref|XP_006473959.1|  PREDICTED: dicer-like protein 4-like isoform X3    166   6e-41    
gb|KEH20231.1|  endoribonuclease dicer-like protein                     166   6e-41    
ref|XP_008672684.1|  PREDICTED: uncharacterized protein LOC100279...    165   1e-40    
ref|XP_006581316.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    158   1e-40    
emb|CDY30942.1|  BnaA06g19710D                                          165   2e-40    
ref|XP_009150278.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    165   2e-40    
ref|XP_009150277.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    165   2e-40    
ref|XP_009150279.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    165   2e-40    
ref|XP_002875633.1|  hypothetical protein ARALYDRAFT_484824             164   2e-40    
ref|XP_002979043.1|  hypothetical protein SELMODRAFT_444049             164   2e-40    
gb|KHN29665.1|  Endoribonuclease Dicer like 3a                          163   6e-40    
ref|XP_007136903.1|  hypothetical protein PHAVU_009G083800g             163   9e-40    
ref|XP_010687747.1|  PREDICTED: LOW QUALITY PROTEIN: dicer-like p...    162   1e-39    
ref|XP_010667466.1|  PREDICTED: endoribonuclease Dicer homolog 3 ...    161   2e-39    
gb|KFK44834.1|  hypothetical protein AALP_AA1G308600                    160   3e-39    
gb|KFK44833.1|  hypothetical protein AALP_AA1G308600                    160   3e-39    
gb|KFK44835.1|  hypothetical protein AALP_AA1G308600                    160   4e-39    
ref|XP_008644681.1|  PREDICTED: endoribonuclease Dicer homolog 2a...    157   6e-39    
ref|XP_006578101.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    160   8e-39    
ref|XP_006578099.1|  PREDICTED: endoribonuclease Dicer homolog 3a...    160   8e-39    
gb|KFK32317.1|  hypothetical protein AALP_AA6G226200                    159   2e-38    
gb|AGT63299.1|  ribonuclease III                                        145   2e-38    
gb|EFX86072.1|  hypothetical protein DAPPUDRAFT_309030                  159   2e-38    
ref|XP_008187012.1|  PREDICTED: endoribonuclease Dcr-1-like             158   3e-38    
gb|ENN74155.1|  hypothetical protein YQE_09128                          156   1e-37    
gb|ERL94289.1|  hypothetical protein D910_11570                         156   2e-37    
gb|ADB44075.1|  dicer-1                                                 156   2e-37    
ref|XP_002032258.1|  GM23619                                            154   1e-36    
emb|CDP13802.1|  unnamed protein product                                147   1e-36    
gb|ACF96960.1|  dicer-1                                                 154   1e-36    
ref|XP_001954492.1|  GF18290                                            153   2e-36    
ref|XP_011668948.1|  PREDICTED: endoribonuclease Dicer isoform X1       153   2e-36    
ref|XP_011668950.1|  PREDICTED: endoribonuclease Dicer isoform X2       153   2e-36    



>gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata]
Length=1403

 Score =   369 bits (947),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 243/313 (78%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+D
Sbjct  1082  FDEELLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGVDIDFVD  1141

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
             AP   +FP+NAE++VNV+ LES  LL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1142  APTPRHFPMNAEKLVNVRYLES--LLDYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1199

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDYAVT H Y +YPGL PG +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYAVTAHLYFKYPGLSPGFITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQR  1259

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V N E+   +STFGW  +T+FP VL D+IES+AGAI++DSG   D+VF+ +R +L
Sbjct  1260  QIVNTVLNFEKLDPASTFGWESETTFPKVLGDVIESLAGAIFVDSGFNKDVVFQSVRTLL  1319

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++++L+PV+EL+ELC ++ Y  K+ VV  ++G A  T+EV A+G     + S R
Sbjct  1320  EPLITPDTVKLHPVRELSELCDQKGYIKKKNVVSRENGVAYITVEVEADGVSHKFTCSER  1379

Query  266   NRKTAKRLACERM  228
             ++K A+++AC+ +
Sbjct  1380  DKKMAEKVACKNV  1392



>gb|KDP26899.1| hypothetical protein JCGZ_18057 [Jatropha curcas]
Length=424

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 225/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +  + K+Y  GRRK+  + +ADV EALIGA+LST GEIA L FL W+G+  +F +
Sbjct  97    LNEEFLSNTRKIYVTGRRKLKEKVVADVVEALIGAYLSTGGEIAGLLFLDWIGIKAEFDN  156

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P V +F + AE++VNV  LES  LLNY FRDPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  157   IPYVRHFEVKAERLVNVSYLES--LLNYQFRDPSLLVEALTHGSYMLPEVPRCYQRLEFL  214

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T + Y QYPG+ PG LT++RS SVNN CYA S+V+ GLH YI H+S  L  
Sbjct  215   GDSVLDYLITVYLYKQYPGMSPGLLTDMRSASVNNDCYAQSAVRGGLHKYICHASQKLHK  274

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA  V+N    S++ TFGW  +TSFP VL D+IES+AGAIY+DSG   + VF  IRP+L
Sbjct  275   DIAIAVENFNNVSSAPTFGWESETSFPKVLGDVIESLAGAIYVDSGYNKEAVFRSIRPLL  334

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE++RL+PV+EL ELCQK  +   + VV  K+G    T EV+A+G +   +S A 
Sbjct  335   EPLITPETIRLHPVRELNELCQKNNFEKSKSVVQRKNGMYSVTEEVVAHGEIFKHTSEAA  394

Query  266   NRKTAKRLACERM  228
             ++KTAKR+A + +
Sbjct  395   DKKTAKRVASKEV  407



>ref|XP_009625898.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana tomentosiformis]
Length=1403

 Score =   366 bits (939),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 242/313 (77%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+ 
Sbjct  1082  FDEEVLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGIDIDFVA  1141

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
             AP + +FP+NAE++VN++ LES  LL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1142  APTLRHFPMNAEKLVNIRYLES--LLDYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1199

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDYAVT H Y +YPGL PG +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYAVTAHLYFKYPGLSPGLITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQR  1259

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              + + V N E+    STFGW  +T+FP VL D+IES+AGAI++DSG   D+VF+ IR +L
Sbjct  1260  QMVNTVLNFEKLDPVSTFGWESETTFPKVLGDVIESLAGAIFVDSGFNKDVVFQSIRTLL  1319

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++++L+PV+EL+ELC ++ Y  K+ VV  ++G A  T+EV A+G     + S R
Sbjct  1320  EPLITPDTVKLHPVRELSELCDQKGYIKKKNVVSRENGVAYITVEVEADGVSHKFTCSER  1379

Query  266   NRKTAKRLACERM  228
             ++K A+++AC+ +
Sbjct  1380  DKKMAEKVACKNV  1392



>ref|XP_009783913.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Nicotiana sylvestris]
Length=1403

 Score =   365 bits (937),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 240/313 (77%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E ++ S K+YSRGR+KM ++ +ADV EALIGAFLS+ GE+AALSF++WLG+ IDF+D
Sbjct  1082  FDEEVLMPSVKMYSRGRQKMKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGIGIDFVD  1141

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
             AP   +FP+NAE++VNV+ LES  LL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1142  APSPRHFPMNAEKLVNVRYLES--LLHYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1199

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDYAVT H Y +YPGL PG +T+LRS SVNN CYA ++V+AGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYAVTAHLYFKYPGLSPGLITDLRSASVNNECYAQAAVRAGLHKHILHASQDLQR  1259

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V N E+    STFGW  +T+FP VL D+IES+AGAI++DSG   DIVF+ +R +L
Sbjct  1260  QIVNTVLNFEKLDPVSTFGWESETTFPKVLGDVIESLAGAIFVDSGFNKDIVFQSVRTLL  1319

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++++L+PV+EL+ELC ++ Y  K+ VV   +G A  T+EV A+G     + S R
Sbjct  1320  EPLITPDTVKLHPVRELSELCDQKGYIKKKNVVSRVNGVAYITVEVEADGVSHKFTCSER  1379

Query  266   NRKTAKRLACERM  228
             ++K A+++AC+ +
Sbjct  1380  DKKMAEKVACKNV  1392



>gb|KDO45678.1| hypothetical protein CISIN_1g0030622mg, partial [Citrus sinensis]
Length=346

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 224/314 (71%), Gaps = 3/314 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  24    ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  83

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
             + P    F + AE++VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P   + YQRLEF
Sbjct  84    NVPYERQFQVQAERLVNVRHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEF  141

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T + Y++YP L PG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  142   LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  201

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I   V + E+ S  STFGW  +TSFP  L DIIES++GAI++DSG   ++VFE IRP+
Sbjct  202   KWINITVDSFERLSLESTFGWESETSFPKALGDIIESLSGAIFVDSGCNKEVVFESIRPL  261

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEPM+TPE++RL P +EL E CQK  + MK+ V    +G+A  T+EV ANG +   + + 
Sbjct  262   LEPMITPETMRLQPARELNEYCQKHHFSMKKTVAPRINGKAAVTVEVHANGTLFKHTHAD  321

Query  269   RNRKTAKRLACERM  228
              +++TAK++A + +
Sbjct  322   ADKETAKKVASKEV  335



>ref|XP_011466081.1| PREDICTED: endoribonuclease Dicer homolog 2 [Fragaria vesca subsp. 
vesca]
Length=1397

 Score =   355 bits (910),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 224/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E + +   +Y RG RK+ +++IADV EALIGAFLST GE AA+ F+ W+G+ +DF  
Sbjct  1077  LKEEFLSSERNIYIRGTRKIKSKSIADVVEALIGAFLSTGGETAAVYFMNWVGIKVDFTY  1136

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   NFP+  E++VNVK LE   LLNY+F DPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1137  IPYERNFPVQPEKLVNVKHLEG--LLNYSFHDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1194

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T + YD+YPG+ PG LT++RS SVNN CYA S+VKAGLH +ILH+S  L  
Sbjct  1195  GDAVLDYLITVYLYDKYPGMSPGVLTDMRSASVNNDCYARSAVKAGLHKHILHASQKLHK  1254

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   + N +  S  STFGW  +TSFP VL DI+ES+ GAIY+DSG   DIVFE IRP+L
Sbjct  1255  DIVQTISNFQTLSTESTFGWESETSFPKVLGDIVESLGGAIYVDSGYNKDIVFESIRPLL  1314

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE++ L+P +EL E C K  Y MK+P+   ++  A  TIEV ANG     SS+A 
Sbjct  1315  EPLITPETMTLHPARELNEYCSKMHYDMKKPLKSFQNDAATVTIEVEANGVTYRHSSTAS  1374

Query  266   NRKTAKRLACERM  228
             ++KTAK+LAC+ +
Sbjct  1375  DKKTAKKLACKEV  1387



>gb|KJB61696.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1076

 Score =   349 bits (896),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 229/309 (74%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +  + K+Y RGRRK+  + +ADV EALIGA+LST GE A L FL W+G+ IDF +
Sbjct  756   LNEETLCNAKKIYVRGRRKVKCKKVADVVEALIGAYLSTGGEAAGLLFLDWIGISIDFTN  815

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F + AE+ VNV+  ES  LL+Y+F+DPSLLVEALTHGSY +      YQRLEFL
Sbjct  816   IPYERHFKVRAEKFVNVQHFES--LLHYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFL  873

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y++YPG+ PG LT+LRS SVNN CYALS+VKAG H +IL SS  L  
Sbjct  874   GDSVLDYLITLHLYNKYPGITPGLLTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYK  933

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V++ ++ S   TFGW  + SFP VL D++ES+AGAI++DSG + +IVF+ IRP+L
Sbjct  934   DIKETVESFQELSLEYTFGWESEKSFPKVLGDVMESLAGAIFVDSGYKKEIVFQSIRPLL  993

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EPM+TPE++ ++PVKEL ELCQK  Y +++P+V H+DG +  TIEV ANG V   +S+A 
Sbjct  994   EPMITPETMTVHPVKELYELCQKEHYELRKPIVSHEDGISSITIEVEANGKVFKHTSTAC  1053

Query  266   NRKTAKRLA  240
             ++K AK+LA
Sbjct  1054  DKKMAKKLA  1062



>ref|XP_007029212.1| Dicer-like protein isoform 5 [Theobroma cacao]
 gb|EOY09714.1| Dicer-like protein isoform 5 [Theobroma cacao]
Length=1077

 Score =   349 bits (895),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 226/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  753   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  812

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  813   IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  870

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YP + PG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  871   GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  930

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V++ ++ S   TFGW    SFP VLADIIES+AGAI++DSG     VF  IRP+L
Sbjct  931   EIAETVESFKELSMKYTFGWECDKSFPKVLADIIESLAGAIFVDSGYDKHAVFRSIRPLL  990

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+++ +PVKEL ELCQK  +  +   V H +G    T EV ANG V   +SSA 
Sbjct  991   EPLITPETIKFHPVKELNELCQKEHFEQRPATVSHDNGVTSITTEVEANGMVFKHTSSAS  1050

Query  266   NRKTAKRLACERM  228
             N+K A++LAC+ +
Sbjct  1051  NKKMARKLACKEV  1063



>ref|XP_010312608.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Solanum lycopersicum]
Length=1406

 Score =   352 bits (903),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 235/309 (76%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+  + +S K+YSR ++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1082  FDEVLLTSSDKMYSRVKQKIRSKRVADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1141

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
             AP+  +FP+NAE++VNV+ LES  LL+Y F DPSLLVEALTHGSY IP   + YQRLEFL
Sbjct  1142  APMSRHFPMNAEKLVNVRYLES--LLHYKFNDPSLLVEALTHGSYMIPEIPRCYQRLEFL  1199

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY VT H Y +YPGL PG +T+LRS SVNN CYA S+VKAGLH +ILH+S  L+ 
Sbjct  1200  GDAVLDYVVTAHLYFKYPGLTPGLITDLRSASVNNECYAQSAVKAGLHKHILHASQDLQR  1259

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   V++ ++ +  STFGW  +T+FP VL D+IES+ GAI++DSG   +  F+ IRP+L
Sbjct  1260  QICSTVEDFDKLNLDSTFGWEAETTFPKVLGDVIESLGGAIFVDSGFDKETTFQCIRPLL  1319

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP+VTP++L+ +PV+EL+ELC ++ Y  K+ VV  ++G A  T+EV ANG V   + S R
Sbjct  1320  EPLVTPQTLKPHPVRELSELCDQKGYIRKKDVVSRENGIAYITVEVEANGVVHKSTCSGR  1379

Query  266   NRKTAKRLA  240
             ++  AK++A
Sbjct  1380  DKLIAKKVA  1388



>ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47364.1| ATP binding protein, putative [Ricinus communis]
Length=1388

 Score =   352 bits (903),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 224/309 (72%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y + RRK+  + IADV EALIGA+LST GEIA L FL W+G+  DF++
Sbjct  1067  LSEEILSNGRKMYIKRRRKLKEKMIADVVEALIGAYLSTGGEIAGLLFLDWIGIKADFLN  1126

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F +N E+ VN+  LES  LL Y+FRDP LLVEALTHGSY +P   + YQRLEFL
Sbjct  1127  MPYERGFEMNPEKYVNICHLES--LLKYSFRDPCLLVEALTHGSYMLPEIPRCYQRLEFL  1184

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y++YPG+ PG LT++RS SVNN CYA S+V+ GLH YILH+S  L  
Sbjct  1185  GDSVLDYLITVHLYEKYPGMSPGLLTDMRSASVNNDCYAQSAVREGLHKYILHASQKLHK  1244

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   V N ++ S+ STFGW  + SFP VL D+IES+AGAI++DSG   ++VF  IRP+L
Sbjct  1245  DIVSTVANCKEFSSESTFGWESEISFPKVLGDVIESLAGAIFVDSGYNKEVVFNSIRPLL  1304

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE++RL+P +ELTELCQK+ +  ++PVV   +G +C T+EV ANG V   +S+A 
Sbjct  1305  EPLITPETIRLHPTRELTELCQKQHFDRRKPVVSRNNGMSCVTVEVEANGVVFKHTSAAA  1364

Query  266   NRKTAKRLA  240
              RKTAKRLA
Sbjct  1365  ERKTAKRLA  1373



>ref|XP_007029213.1| Dicer-like protein isoform 6 [Theobroma cacao]
 gb|EOY09715.1| Dicer-like protein isoform 6 [Theobroma cacao]
Length=1114

 Score =   348 bits (893),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 226/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  790   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  849

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  850   IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  907

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YP + PG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  908   GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  967

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V++ ++ S   TFGW    SFP VLADIIES+AGAI++DSG     VF  IRP+L
Sbjct  968   EIAETVESFKELSMKYTFGWECDKSFPKVLADIIESLAGAIFVDSGYDKHAVFRSIRPLL  1027

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+++ +PVKEL ELCQK  +  +   V H +G    T EV ANG V   +SSA 
Sbjct  1028  EPLITPETIKFHPVKELNELCQKEHFEQRPATVSHDNGVTSITTEVEANGMVFKHTSSAS  1087

Query  266   NRKTAKRLACERM  228
             N+K A++LAC+ +
Sbjct  1088  NKKMARKLACKEV  1100



>ref|XP_007029210.1| Dicer-like protein isoform 3 [Theobroma cacao]
 gb|EOY09712.1| Dicer-like protein isoform 3 [Theobroma cacao]
Length=1202

 Score =   349 bits (895),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 226/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  878   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  937

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  938   IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  995

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YP + PG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  996   GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  1055

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V++ ++ S   TFGW    SFP VLADIIES+AGAI++DSG     VF  IRP+L
Sbjct  1056  EIAETVESFKELSMKYTFGWECDKSFPKVLADIIESLAGAIFVDSGYDKHAVFRSIRPLL  1115

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+++ +PVKEL ELCQK  +  +   V H +G    T EV ANG V   +SSA 
Sbjct  1116  EPLITPETIKFHPVKELNELCQKEHFEQRPATVSHDNGVTSITTEVEANGMVFKHTSSAS  1175

Query  266   NRKTAKRLACERM  228
             N+K A++LAC+ +
Sbjct  1176  NKKMARKLACKEV  1188



>ref|XP_008370841.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
 ref|XP_008370842.1| PREDICTED: endoribonuclease Dicer homolog 2 [Malus domestica]
Length=1397

 Score =   350 bits (899),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 229/313 (73%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y+R RRK+ ++++ADV EALIGAFLST GE+AA+ F+ W+G+ +DF+ 
Sbjct  1073  LYEELLYDGRKIYTRERRKVKSKSVADVVEALIGAFLSTGGEVAAMYFMNWVGIKVDFVH  1132

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F L  E++VNV R+ES  LL Y+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1133  IPCERHFQLQPEKLVNVGRIES--LLKYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1190

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T + Y++YPG+ PG LT++RS SVNN CYA S++KA L+ +ILH+S  L  
Sbjct  1191  GDAVLDYLITIYLYNEYPGMSPGILTDMRSASVNNDCYARSAIKAELYKHILHASHKLHK  1250

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   ++N E+ S  STFGW  +TSFP VL D++ES+AGAIY+DSG     VF+ I P+L
Sbjct  1251  DIVYTIENFERLSTESTFGWDSETSFPKVLGDVVESLAGAIYVDSGYDKXXVFQSISPLL  1310

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             +P++TPE+L+L+PV+EL E CQK  Y MK+PV    +GEA  TIEV ANG     +S+A 
Sbjct  1311  QPLITPETLKLHPVRELNEHCQKMHYDMKKPVKTSHNGEAAITIEVEANGVTHKHTSTAS  1370

Query  266   NRKTAKRLACERM  228
             N+KTA +LAC+ +
Sbjct  1371  NKKTALKLACKEV  1383



>gb|KJB61693.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1306

 Score =   350 bits (897),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 229/309 (74%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +  + K+Y RGRRK+  + +ADV EALIGA+LST GE A L FL W+G+ IDF +
Sbjct  986   LNEETLCNAKKIYVRGRRKVKCKKVADVVEALIGAYLSTGGEAAGLLFLDWIGISIDFTN  1045

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F + AE+ VNV+  ES  LL+Y+F+DPSLLVEALTHGSY +      YQRLEFL
Sbjct  1046  IPYERHFKVRAEKFVNVQHFES--LLHYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFL  1103

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y++YPG+ PG LT+LRS SVNN CYALS+VKAG H +IL SS  L  
Sbjct  1104  GDSVLDYLITLHLYNKYPGITPGLLTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYK  1163

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V++ ++ S   TFGW  + SFP VL D++ES+AGAI++DSG + +IVF+ IRP+L
Sbjct  1164  DIKETVESFQELSLEYTFGWESEKSFPKVLGDVMESLAGAIFVDSGYKKEIVFQSIRPLL  1223

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EPM+TPE++ ++PVKEL ELCQK  Y +++P+V H+DG +  TIEV ANG V   +S+A 
Sbjct  1224  EPMITPETMTVHPVKELYELCQKEHYELRKPIVSHEDGISSITIEVEANGKVFKHTSTAC  1283

Query  266   NRKTAKRLA  240
             ++K AK+LA
Sbjct  1284  DKKMAKKLA  1292



>ref|XP_009340367.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
 ref|XP_009340372.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Pyrus x bretschneideri]
Length=1397

 Score =   350 bits (898),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 229/313 (73%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y+R RRK+ ++++ADV EALIGAFLST GE+AA+ F+ W+G+ +DF+ 
Sbjct  1073  LYEELLYDGRKIYTRERRKVKSKSVADVVEALIGAFLSTGGEVAAIYFMNWVGIKVDFVH  1132

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F L  E++VNV  LES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1133  IPCERHFQLQPEKLVNVGHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1190

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T + Y++YPG+ PG LT++RS SVNN CYA S++KA L+ +ILH+S  L  
Sbjct  1191  GDAVLDYLITIYLYNEYPGMSPGILTDMRSASVNNDCYARSAIKAELYKHILHASHKLHK  1250

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   ++N E+ S  STFGW  +TSFP VL D++ES+AGAIY+DSG    IVF+ I P+L
Sbjct  1251  DIVYTIENFERLSTESTFGWESETSFPKVLGDVVESLAGAIYVDSGYDKKIVFQSISPLL  1310

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             +P++TPE+L+L+PV+EL E CQK  Y MK+PV    +G A  TIEV ANG     +S+A 
Sbjct  1311  QPLITPETLKLHPVRELNEHCQKMHYDMKKPVKTSHNGVAAITIEVEANGFTYEHTSTAS  1370

Query  266   NRKTAKRLACERM  228
             N+KTA +LAC+ +
Sbjct  1371  NKKTALKLACKEV  1383



>gb|KJB61692.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61694.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
 gb|KJB61695.1| hypothetical protein B456_009G374900 [Gossypium raimondii]
Length=1395

 Score =   350 bits (898),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 229/309 (74%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +  + K+Y RGRRK+  + +ADV EALIGA+LST GE A L FL W+G+ IDF +
Sbjct  1075  LNEETLCNAKKIYVRGRRKVKCKKVADVVEALIGAYLSTGGEAAGLLFLDWIGISIDFTN  1134

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F + AE+ VNV+  ES  LL+Y+F+DPSLLVEALTHGSY +      YQRLEFL
Sbjct  1135  IPYERHFKVRAEKFVNVQHFES--LLHYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFL  1192

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y++YPG+ PG LT+LRS SVNN CYALS+VKAG H +IL SS  L  
Sbjct  1193  GDSVLDYLITLHLYNKYPGITPGLLTDLRSASVNNNCYALSAVKAGFHKHILQSSQKLYK  1252

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V++ ++ S   TFGW  + SFP VL D++ES+AGAI++DSG + +IVF+ IRP+L
Sbjct  1253  DIKETVESFQELSLEYTFGWESEKSFPKVLGDVMESLAGAIFVDSGYKKEIVFQSIRPLL  1312

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EPM+TPE++ ++PVKEL ELCQK  Y +++P+V H+DG +  TIEV ANG V   +S+A 
Sbjct  1313  EPMITPETMTVHPVKELYELCQKEHYELRKPIVSHEDGISSITIEVEANGKVFKHTSTAC  1372

Query  266   NRKTAKRLA  240
             ++K AK+LA
Sbjct  1373  DKKMAKKLA  1381



>ref|XP_007029209.1| Dicer-like protein isoform 2 [Theobroma cacao]
 gb|EOY09711.1| Dicer-like protein isoform 2 [Theobroma cacao]
Length=1307

 Score =   348 bits (892),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 226/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  983   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  1042

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  1043  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  1100

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YP + PG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  1101  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  1160

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V++ ++ S   TFGW    SFP VLADIIES+AGAI++DSG     VF  IRP+L
Sbjct  1161  EIAETVESFKELSMKYTFGWECDKSFPKVLADIIESLAGAIFVDSGYDKHAVFRSIRPLL  1220

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+++ +PVKEL ELCQK  +  +   V H +G    T EV ANG V   +SSA 
Sbjct  1221  EPLITPETIKFHPVKELNELCQKEHFEQRPATVSHDNGVTSITTEVEANGMVFKHTSSAS  1280

Query  266   NRKTAKRLACERM  228
             N+K A++LAC+ +
Sbjct  1281  NKKMARKLACKEV  1293



>ref|XP_007029208.1| Dicer-like protein isoform 1 [Theobroma cacao]
 gb|EOY09710.1| Dicer-like protein isoform 1 [Theobroma cacao]
Length=1418

 Score =   348 bits (894),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 226/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  1094  LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  1153

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  1154  IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  1211

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YP + PG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  1212  GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  1271

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V++ ++ S   TFGW    SFP VLADIIES+AGAI++DSG     VF  IRP+L
Sbjct  1272  EIAETVESFKELSMKYTFGWECDKSFPKVLADIIESLAGAIFVDSGYDKHAVFRSIRPLL  1331

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+++ +PVKEL ELCQK  +  +   V H +G    T EV ANG V   +SSA 
Sbjct  1332  EPLITPETIKFHPVKELNELCQKEHFEQRPATVSHDNGVTSITTEVEANGMVFKHTSSAS  1391

Query  266   NRKTAKRLACERM  228
             N+K A++LAC+ +
Sbjct  1392  NKKMARKLACKEV  1404



>ref|XP_006428679.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|ESR41919.1| hypothetical protein CICLE_v10010912mg [Citrus clementina]
 gb|KDO45680.1| hypothetical protein CISIN_1g000607mg [Citrus sinensis]
Length=1396

 Score =   348 bits (893),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 172/314 (55%), Positives = 228/314 (73%), Gaps = 3/314 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             EL+ + +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDDSLFNGRKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
             + P    F ++AE++VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYQRQFQVHAERLVNVRHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T + Y++YPGL PG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPGLSPGYLTDMRSASVNNDCYALSSVKHGLHKHILHASHELY  1251

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I   V + E+ S  STFGW   TSFP  L DIIES+AGAI++DSG   ++VF+ IRP+
Sbjct  1252  KRINITVDSFEKLSLGSTFGWESVTSFPKALGDIIESLAGAIFVDSGCNREVVFQSIRPL  1311

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEPM+TPE++R +PV+ELTE CQK  + MK+PV     G+A  T+EV ANG +   +   
Sbjct  1312  LEPMITPETMRFHPVRELTEYCQKNHFSMKKPVASRISGKAAVTVEVQANGRLFEHTFLD  1371

Query  269   RNRKTAKRLACERM  228
              ++KTAK++AC+ +
Sbjct  1372  ADKKTAKKVACKEV  1385



>ref|XP_006480493.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X6 [Citrus 
sinensis]
Length=1396

 Score =   348 bits (893),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 172/314 (55%), Positives = 228/314 (73%), Gaps = 3/314 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             EL+ + +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDDSLFNGRKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
             + P    F ++AE++VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYQRQFQVHAERLVNVRHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T + Y++YPGL PG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPGLSPGYLTDMRSASVNNDCYALSSVKHGLHKHILHASHELY  1251

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I   V + E+ S  STFGW   TSFP  L DIIES+AGAI++DSG   ++VF+ IRP+
Sbjct  1252  KRINITVDSFEKLSLGSTFGWESVTSFPKALGDIIESLAGAIFVDSGCNREVVFQSIRPL  1311

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEPM+TPE++R +PV+ELTE CQK  + MK+PV     G+A  T+EV ANG +   +   
Sbjct  1312  LEPMITPETMRFHPVRELTEYCQKNHFSMKKPVASRISGKAAVTVEVQANGRLFEHTFLD  1371

Query  269   RNRKTAKRLACERM  228
              ++KTAK++AC+ +
Sbjct  1372  ADKKTAKKVACKEV  1385



>ref|XP_002312197.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
 gb|EEE89564.1| hypothetical protein POPTR_0008s07580g [Populus trichocarpa]
Length=1468

 Score =   348 bits (892),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 225/309 (73%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y RGRRK+ ++TIADV EALIGA+LST GE+ AL F+ W+G+ +DF++
Sbjct  1140  LSEEPLSKGRKIYIRGRRKVKSKTIADVVEALIGAYLSTGGEVTALLFMDWIGIKVDFMN  1199

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +  L AE+ VNV+ LES  LLNY+F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1200  TPYERHIQLQAEKFVNVRYLES--LLNYSFNDPSLLVEALTHGSYMLPEIPRCYQRLEFL  1257

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y +YPG+ PG LT+LRS SVNN CYALS+VK GL  +ILH+S  L  
Sbjct  1258  GDAVLDYLITLHMYKEYPGMSPGLLTDLRSASVNNDCYALSAVKVGLDRHILHASHDLHK  1317

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   VK I++ S  STFGW  +T+FP VL D+IES+AGAI +DSG   ++VFE IRP+L
Sbjct  1318  HIVATVKKIQEFSLESTFGWESETAFPKVLGDVIESLAGAILVDSGYNKEVVFESIRPLL  1377

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+LRL PV+EL ELCQ++ +  K+P+V      A  TIEV ANG +   +++  
Sbjct  1378  EPLITPETLRLQPVRELNELCQRQHFDYKKPIVSRNGRNASVTIEVEANGLIFKHTATVA  1437

Query  266   NRKTAKRLA  240
             ++ TAK+LA
Sbjct  1438  DKTTAKKLA  1446



>gb|KJB14793.1| hypothetical protein B456_002G143000 [Gossypium raimondii]
Length=1393

 Score =   346 bits (888),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 228/307 (74%), Gaps = 3/307 (1%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN  966
             L + K+Y  GRRK+ ++ +ADV EALIGA+LST GE+AAL F+ W+G+ IDF + P   +
Sbjct  1079  LNTRKIYVSGRRKLKSKKVADVVEALIGAYLSTGGEVAALLFMNWIGITIDFRNIPYERH  1138

Query  965   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLD  789
             F + AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +      YQRLEFLGD+VLD
Sbjct  1139  FEVQAEKIVNVQHLES--LLNYSFQDPSLLVEALTHGSYMLAEIPGCYQRLEFLGDSVLD  1196

Query  788   YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  609
             Y +TRH Y++YPG+ PG LT+LRS SVNN CYALS+VKAGLH +IL SS  L   I + V
Sbjct  1197  YLITRHLYNKYPGISPGLLTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYKHIKETV  1256

Query  608   KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP  429
             ++ ++ S   TFGW  + SFP VL D++ESIAGAI++DSG   + VF  IRP+LEP++T 
Sbjct  1257  ESFQELSLDCTFGWESEKSFPKVLGDVMESIAGAIFVDSGYNKETVFRSIRPLLEPLITL  1316

Query  428   ESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAK  249
             E++ ++PVKEL ELCQK+ Y  ++P+V H +G +  TIEV ANG V   +S+A ++K AK
Sbjct  1317  ETMTVHPVKELNELCQKKHYEQRKPIVSHGNGVSSVTIEVEANGEVLKHTSTACDKKMAK  1376

Query  248   RLACERM  228
             +LA + +
Sbjct  1377  KLASKEI  1383



>ref|XP_007208392.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
 gb|EMJ09591.1| hypothetical protein PRUPE_ppa000240mg [Prunus persica]
Length=1415

 Score =   345 bits (886),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 231/313 (74%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +    ++Y R RRK+ ++++ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  1097  LNEELLSNERRIYFRERRKVKSKSVADVVEALIGAFLSTGGEIAAMYFMNWVGIKVDSVH  1156

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F +  E++VNV+ +ES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1157  IPYGRHFQVQPEKLVNVRHVES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1214

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLD+ +T + Y++YPG+ PG LT++RS SVNN CYA S++KAGLH +ILH+S  L  
Sbjct  1215  GDAVLDHLITIYLYNKYPGMSPGILTDMRSASVNNDCYARSAIKAGLHKHILHASHKLHK  1274

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   ++N E+ S+ STFGW  +TSFP VL D+IES+AGAI++DSG    IVF+ I P++
Sbjct  1275  DIVYTIENFERLSSESTFGWESETSFPKVLGDVIESLAGAIFVDSGYDKKIVFQSISPLI  1334

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             +P+VTPE++RL+PV+EL E CQK  Y +K+PV   ++  A  TIEV ANG     SS+A 
Sbjct  1335  QPLVTPETMRLHPVRELNEHCQKMHYNLKKPVKSFQNNVATVTIEVEANGYTYKHSSTAS  1394

Query  266   NRKTAKRLACERM  228
             N+KTA +LAC+ +
Sbjct  1395  NKKTALKLACKEV  1407



>ref|XP_010312607.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Solanum 
lycopersicum]
Length=1370

 Score =   345 bits (886),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 236/309 (76%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E + +S K+YSRG++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1049  FDEELLTSSVKMYSRGKQKIKSKIMADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1108

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  807
             AP   + P+NAE++VNV+ LES  LL+Y F DPSLLVEAL+HGS  +P   + Y+RLEFL
Sbjct  1109  APTSRHLPVNAEKLVNVRYLES--LLHYKFNDPSLLVEALSHGSCMLPDIPRCYKRLEFL  1166

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY VT H Y +YPGL PG +T+LRS SVNN CYALS+VKAGLH++IL+    L+ 
Sbjct  1167  GDAVLDYVVTTHLYFKYPGLTPGLITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQR  1226

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I+  V++ ++ +  STFGW  +T++P VLAD+IES+AGAI++DSG   D  F  IRP+L
Sbjct  1227  HISSTVEDFKKLNLVSTFGWEAETTYPKVLADVIESLAGAIFVDSGFNQDTTFLCIRPLL  1286

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++L+++P +EL ELC ++ Y  ++ VV  ++G    T+EV ANG +   S+S R
Sbjct  1287  EPLITPQTLKVHPARELRELCHQKGYIKQKNVVFRENGIVYVTVEVEANGVIHKDSNSGR  1346

Query  266   NRKTAKRLA  240
             N+K A+++A
Sbjct  1347  NQKMAEKVA  1355



>ref|XP_009361581.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
 ref|XP_009361582.1| PREDICTED: endoribonuclease Dicer homolog 2 [Pyrus x bretschneideri]
Length=1410

 Score =   345 bits (886),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 167/299 (56%), Positives = 224/299 (75%), Gaps = 3/299 (1%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  942
             R RRK+ ++++ADV EALIGAFLST GE+AA+ F+ W+G+ +DF+  P   +F L  E++
Sbjct  1100  RERRKVKSKSVADVVEALIGAFLSTGGEVAAIYFMNWVGIKVDFVHIPCERHFQLQPEKL  1159

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             VNV  LES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFLGDAVLDY +T + Y
Sbjct  1160  VNVGHLES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFLGDAVLDYLITIYLY  1217

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
             ++YPG+ PG LT++RS SVNN CYA S++KA L+ +ILH+S  L   I   ++N E+ S 
Sbjct  1218  NEYPGMSPGILTDMRSASVNNDCYARSAIKAELYKHILHASHKLHKDIVYTIENFERLST  1277

Query  584   SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV  405
              STFGW  +TSFP VL D++ES+AGAIY+DSG    IVF+ I P+L+P++TPE+L+L+PV
Sbjct  1278  ESTFGWESETSFPKVLGDVVESLAGAIYVDSGYDKKIVFQSISPLLQPLITPETLKLHPV  1337

Query  404   KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
             +EL E CQK  Y MK+PV    +G A  TIEV ANG + + +S+A N+KTA +LAC+++
Sbjct  1338  RELNEHCQKMHYDMKKPVKTSHNGVAAITIEVEANGFMYTDTSTASNKKTALKLACKKV  1396



>ref|XP_010312606.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Solanum 
lycopersicum]
Length=1406

 Score =   345 bits (886),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 236/309 (76%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E + +S K+YSRG++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1085  FDEELLTSSVKMYSRGKQKIKSKIMADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1144

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  807
             AP   + P+NAE++VNV+ LES  LL+Y F DPSLLVEAL+HGS  +P   + Y+RLEFL
Sbjct  1145  APTSRHLPVNAEKLVNVRYLES--LLHYKFNDPSLLVEALSHGSCMLPDIPRCYKRLEFL  1202

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY VT H Y +YPGL PG +T+LRS SVNN CYALS+VKAGLH++IL+    L+ 
Sbjct  1203  GDAVLDYVVTTHLYFKYPGLTPGLITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQR  1262

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I+  V++ ++ +  STFGW  +T++P VLAD+IES+AGAI++DSG   D  F  IRP+L
Sbjct  1263  HISSTVEDFKKLNLVSTFGWEAETTYPKVLADVIESLAGAIFVDSGFNQDTTFLCIRPLL  1322

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++L+++P +EL ELC ++ Y  ++ VV  ++G    T+EV ANG +   S+S R
Sbjct  1323  EPLITPQTLKVHPARELRELCHQKGYIKQKNVVFRENGIVYVTVEVEANGVIHKDSNSGR  1382

Query  266   NRKTAKRLA  240
             N+K A+++A
Sbjct  1383  NQKMAEKVA  1391



>ref|XP_010312604.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010312605.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Solanum 
lycopersicum]
Length=1433

 Score =   345 bits (885),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 236/309 (76%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E + +S K+YSRG++K+ ++ +ADV EALIGA+LS+ GE+AALSF++WLG+DI+F+D
Sbjct  1112  FDEELLTSSVKMYSRGKQKIKSKIMADVVEALIGAYLSSGGEVAALSFMKWLGVDINFVD  1171

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  807
             AP   + P+NAE++VNV+ LES  LL+Y F DPSLLVEAL+HGS  +P   + Y+RLEFL
Sbjct  1172  APTSRHLPVNAEKLVNVRYLES--LLHYKFNDPSLLVEALSHGSCMLPDIPRCYKRLEFL  1229

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY VT H Y +YPGL PG +T+LRS SVNN CYALS+VKAGLH++IL+    L+ 
Sbjct  1230  GDAVLDYVVTTHLYFKYPGLTPGLITDLRSASVNNECYALSAVKAGLHDHILYDLQVLQR  1289

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I+  V++ ++ +  STFGW  +T++P VLAD+IES+AGAI++DSG   D  F  IRP+L
Sbjct  1290  HISSTVEDFKKLNLVSTFGWEAETTYPKVLADVIESLAGAIFVDSGFNQDTTFLCIRPLL  1349

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++L+++P +EL ELC ++ Y  ++ VV  ++G    T+EV ANG +   S+S R
Sbjct  1350  EPLITPQTLKVHPARELRELCHQKGYIKQKNVVFRENGIVYVTVEVEANGVIHKDSNSGR  1409

Query  266   NRKTAKRLA  240
             N+K A+++A
Sbjct  1410  NQKMAEKVA  1418



>gb|KHG30500.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1290

 Score =   343 bits (879),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 226/313 (72%), Gaps = 4/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             LD+E  L + K+Y  GRRK+ ++ +ADV EALIGA+LS  GE AAL FL W+G+ IDF +
Sbjct  971   LDEE-TLNTRKIYVSGRRKLKSKKVADVVEALIGAYLSMGGEAAALLFLNWIGITIDFRN  1029

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F + AE+ VNV+ LES  LLNY+F+DPS LVEALTHGSY +      YQRLEFL
Sbjct  1030  IPYERHFEVQAEKFVNVQHLES--LLNYSFQDPSFLVEALTHGSYMLAEIPGCYQRLEFL  1087

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +TRH Y+ YPG+ PG LT+LRS SVNN CYALS+VKAGLH +IL SS  L  
Sbjct  1088  GDSVLDYLITRHLYNNYPGISPGLLTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYK  1147

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V++  + S   TFGW  + SFP VL D++ES+AGAI++DSG   + VF  IRP+L
Sbjct  1148  HIKETVESFRELSLDCTFGWESEKSFPKVLGDVMESLAGAIFVDSGYNKETVFRSIRPLL  1207

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++T E++ ++PVKEL ELCQK+ Y  ++P+V H +G +  TIEV ANG V   +S+A 
Sbjct  1208  EPLITLETMTVHPVKELNELCQKKHYEQRKPIVSHDNGVSSVTIEVEANGEVLKHTSTAS  1267

Query  266   NRKTAKRLACERM  228
             +RK AK+LA + +
Sbjct  1268  DRKMAKKLASKEI  1280



>ref|XP_008218472.1| PREDICTED: endoribonuclease Dicer homolog 2 [Prunus mume]
Length=1396

 Score =   343 bits (880),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 230/313 (73%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y R RRK+ ++++ADV EALIGAFL T GEIAA+ F+ W+G+ +D + 
Sbjct  1078  LTEELLSNERKIYFRERRKVKSKSVADVVEALIGAFLITGGEIAAMYFMNWVGIKVDSVH  1137

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F +  E++VNV+R+ES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1138  IPSDRHFQVQPEKLVNVRRVES--LLNYSFRDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1195

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLD+ +T + Y++YPG+ PG LT++RS SVNN CYA S++KAGLH +ILH+S  L  
Sbjct  1196  GDAVLDHLITIYLYNKYPGMSPGVLTDMRSASVNNDCYARSAIKAGLHKHILHASHKLHK  1255

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   ++N EQ S+ STFGW  +TSFP VL D+IES+AGAI++DSG    IVF+ I P++
Sbjct  1256  DIVYTIENFEQLSSESTFGWESETSFPKVLGDVIESLAGAIFVDSGYDKKIVFQSISPLI  1315

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             +P+VTPE++RL+PV+EL E CQK  Y +K+ V   ++  A  TIEV ANG     SS+A 
Sbjct  1316  QPLVTPETMRLHPVRELNEHCQKMHYNLKKHVKSFQNNVATITIEVEANGFTYKHSSTAS  1375

Query  266   NRKTAKRLACERM  228
             ++KTA++LAC+ +
Sbjct  1376  DKKTARKLACKEV  1388



>gb|KHG30499.1| hypothetical protein F383_12835 [Gossypium arboreum]
Length=1358

 Score =   343 bits (879),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 226/313 (72%), Gaps = 4/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             LD+E  L + K+Y  GRRK+ ++ +ADV EALIGA+LS  GE AAL FL W+G+ IDF +
Sbjct  1039  LDEE-TLNTRKIYVSGRRKLKSKKVADVVEALIGAYLSMGGEAAALLFLNWIGITIDFRN  1097

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F + AE+ VNV+ LES  LLNY+F+DPS LVEALTHGSY +      YQRLEFL
Sbjct  1098  IPYERHFEVQAEKFVNVQHLES--LLNYSFQDPSFLVEALTHGSYMLAEIPGCYQRLEFL  1155

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +TRH Y+ YPG+ PG LT+LRS SVNN CYALS+VKAGLH +IL SS  L  
Sbjct  1156  GDSVLDYLITRHLYNNYPGISPGLLTDLRSASVNNNCYALSAVKAGLHKHILQSSQKLYK  1215

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I + V++  + S   TFGW  + SFP VL D++ES+AGAI++DSG   + VF  IRP+L
Sbjct  1216  HIKETVESFRELSLDCTFGWESEKSFPKVLGDVMESLAGAIFVDSGYNKETVFRSIRPLL  1275

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++T E++ ++PVKEL ELCQK+ Y  ++P+V H +G +  TIEV ANG V   +S+A 
Sbjct  1276  EPLITLETMTVHPVKELNELCQKKHYEQRKPIVSHDNGVSSVTIEVEANGEVLKHTSTAS  1335

Query  266   NRKTAKRLACERM  228
             +RK AK+LA + +
Sbjct  1336  DRKMAKKLASKEI  1348



>ref|XP_012085800.1| PREDICTED: endoribonuclease Dicer homolog 2 [Jatropha curcas]
Length=1413

 Score =   343 bits (879),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 223/309 (72%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +  + K+Y  GRRK+  + +ADV EALIGA+LST GEIA L FL W+G+  +F +
Sbjct  1086  LNEEFLSNTRKIYVTGRRKLKEKVVADVVEALIGAYLSTGGEIAGLLFLDWIGIKAEFDN  1145

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P V +F + AE++VNV  LES  LLNY FRDPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  1146  IPYVRHFEVKAERLVNVSYLES--LLNYQFRDPSLLVEALTHGSYMLPEVPRCYQRLEFL  1203

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T + Y QYPG+ PG LT++RS SVNN CYA S+V+ GLH YI H+S  L  
Sbjct  1204  GDSVLDYLITVYLYKQYPGMSPGLLTDMRSASVNNDCYAQSAVRGGLHKYICHASQKLHK  1263

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA  V+N    S++ TFGW  +TSFP VL D+IES+AGAIY+DSG   + VF  IRP+L
Sbjct  1264  DIAIAVENFNNVSSAPTFGWESETSFPKVLGDVIESLAGAIYVDSGYNKEAVFRSIRPLL  1323

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE++RL+PV+EL ELCQK  +   + VV  K+G    T EV+A+G +   +S A 
Sbjct  1324  EPLITPETIRLHPVRELNELCQKNNFEKSKSVVQRKNGMYSVTEEVVAHGEIFKHTSEAA  1383

Query  266   NRKTAKRLA  240
             ++KTAKR+A
Sbjct  1384  DKKTAKRVA  1392



>ref|XP_002315119.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
 gb|EEF01290.1| hypothetical protein POPTR_0010s18870g [Populus trichocarpa]
Length=1408

 Score =   341 bits (875),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y RGRRK+ ++T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1079  LSEEPLSECRKIYVRGRRKVKSKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1138

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1139  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYQRLEFL  1196

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VK  LH +ILH+S  L  
Sbjct  1197  GDAVLDYLITMHLYKEYPGMSPGLLTDLRSASVNNDCYAQSAVKGDLHKHILHTSQDLHK  1256

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I +  +  ++SS  STFGW  +TSFP VL D+IES+AGAI +DSG   +IVF+ IRP+L
Sbjct  1257  HIVETAEIFQKSSLGSTFGWESETSFPKVLGDVIESLAGAILVDSGYNKEIVFQSIRPLL  1316

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP ++RL+P +EL+ELCQK+ +  K+ VV +    A  TI V ANG     +++A 
Sbjct  1317  EPLITPATVRLHPARELSELCQKQHFDYKKSVVSYNGRNASITIVVGANGVTFKHTATAA  1376

Query  266   NRKTAKRLA  240
             ++KTAK+LA
Sbjct  1377  DKKTAKKLA  1385



>ref|XP_008240740.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=804

 Score =   332 bits (850),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 224/314 (71%), Gaps = 3/314 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L+++       +Y RG RK+  + +ADV EALIGAFLST GEIAA+ F+ W+G+ +D   
Sbjct  485   LNEKLRFNEKNIYIRGTRKVKGKRVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLAH  544

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F +  E++++++ LES  L NY+FRDPSLL+EALTHGSY +P     Y+RLEFL
Sbjct  545   IPYERHFQVQPEKLIDIRHLES-LLNNYSFRDPSLLLEALTHGSYMLPQIPGCYERLEFL  603

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y++YP + P  LT++RS SVNN CYA ++V+AGLH +IL S + L +
Sbjct  604   GDAVLDYVITAHLYNKYPDMSPELLTDMRSASVNNVCYARTAVRAGLHKHILASDSVLHT  663

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V N E+ S  STFGW  +TSF  VLADIIES+AGAI++DS    + VF+ IRP+L
Sbjct  664   DIANTVNNFERLSMESTFGWESETSFSEVLADIIESLAGAIFVDSEYDKNAVFQSIRPLL  723

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVR-SCSSSA  270
             EP+VTPE++ LNPVKE  + CQK +Y MK+PV   ++G A  TIEV ANG V+ + +S+A
Sbjct  724   EPLVTPETMPLNPVKEFHDYCQKMQYIMKKPVKSIQNGVATRTIEVEANGVVKHTHTSTA  783

Query  269   RNRKTAKRLACERM  228
              N  TAKRLAC+  
Sbjct  784   SNNDTAKRLACKEF  797



>emb|CDP04170.1| unnamed protein product [Coffea canephora]
Length=1351

 Score =   339 bits (870),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 220/302 (73%), Gaps = 3/302 (1%)
 Frame = -3

Query  1130  LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  951
             +Y+R +RK+ ++ +ADV EALIGAFLST GEIAAL FL WLG+ +DF+D P      +N 
Sbjct  1039  VYAREKRKIKSKRVADVVEALIGAFLSTVGEIAALLFLEWLGIKVDFVDVPYTMPLQVNP  1098

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTR  774
             EQ+VNVK LES  LLNY+FRD SLLVEALTHGSY +P   + YQRLEFLGDAVLDY +T 
Sbjct  1099  EQLVNVKFLES--LLNYSFRDASLLVEALTHGSYMLPEIPRCYQRLEFLGDAVLDYLITM  1156

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H Y +YP L PG LT+LRS S +N CYA S+VKAGL+ +IL++S  L+  I   V+N EQ
Sbjct  1157  HLYAKYPELSPGLLTDLRSASASNDCYAQSAVKAGLYKHILYASQELQRHIVSAVQNFEQ  1216

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
              S  STFGW  +T  P VL DIIES+AGAI +DSG   D+VF+ IRP+LEPM+TP+ L+L
Sbjct  1217  LSMDSTFGWESETKIPKVLGDIIESLAGAILIDSGYNKDVVFQSIRPLLEPMITPDKLKL  1276

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
             +PV+E  ELCQK  Y   +    +++G+A  T+EV ANG   + S SA ++ TAK+LAC+
Sbjct  1277  HPVREFHELCQKEGYIRNKRDWNYENGKATITLEVEANGITHNYSCSAADKNTAKKLACK  1336

Query  233   RM  228
              +
Sbjct  1337  AL  1338



>ref|XP_011006570.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2-like [Populus euphratica]
Length=1406

 Score =   339 bits (870),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 226/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y +GRRK+ ++TIADV EALIGA+LST GE+ AL F+ W+G+ +DF++
Sbjct  1078  LGEEPLSEGRKIYIKGRRKVKSKTIADVVEALIGAYLSTGGEVTALLFMDWIGIKVDFMN  1137

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFL  807
              P   +  L AE+ VNV+ LES  LLNY+F DPSLLVEALTHGSY+ P   +  QRLEFL
Sbjct  1138  TPYERHIQLQAEKFVNVRYLES--LLNYSFNDPSLLVEALTHGSYLLPEIPRCXQRLEFL  1195

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VK GL  +ILH+S  L  
Sbjct  1196  GDSVLDYLITLHMYKEYPGMSPGLLTDLRSASVNNDCYAQSAVKVGLDRHILHASHDLHK  1255

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   VK  ++ S  STFGW  +T+FP VL D+IES+AGAI +DSG + ++VFE IRP+L
Sbjct  1256  HIVATVKKFQEFSLESTFGWESETAFPKVLGDVIESLAGAILVDSGYKKEVVFESIRPLL  1315

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TPE+LRL PV+EL ELCQ++ +  K+P+V      A  TIEV ANG +   +++  
Sbjct  1316  EPLITPETLRLQPVRELNELCQRQHFDYKKPIVSRNGRNASVTIEVEANGLIFKHTATVA  1375

Query  266   NRKTAKRLACERM  228
             ++KTA++LA + +
Sbjct  1376  DKKTAQKLASKEV  1388



>ref|XP_011015099.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Populus 
euphratica]
Length=1407

 Score =   339 bits (870),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 225/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y RGRRK+  +T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1078  LSEEPLSERRKIYVRGRRKVKGKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1137

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     Y+RLEFL
Sbjct  1138  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYERLEFL  1195

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y +YP + PG LT+LRS SVNN CYA S+VKA LH +ILH+S  L  
Sbjct  1196  GDAVLDYLITMHLYKEYPSMSPGLLTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHK  1255

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I +  +  ++SS  STFGW  +TSFP VL D+IES+AGAI +DSG   +IVF+ IRP+L
Sbjct  1256  QIVETAEIFQKSSLGSTFGWESETSFPKVLGDVIESLAGAILVDSGYNKEIVFQSIRPLL  1315

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP ++RL+P +EL+ELCQK+ +  K+ VV      A  TI V ANG +   +++A 
Sbjct  1316  EPLITPATVRLHPARELSELCQKQHFDYKKSVVPCNGRNASVTIVVGANGVIFKHTATAA  1375

Query  266   NRKTAKRLACERM  228
             N+KTAK+LA + +
Sbjct  1376  NKKTAKKLASKEV  1388



>ref|XP_011015091.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Populus 
euphratica]
Length=1408

 Score =   339 bits (870),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 225/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y RGRRK+  +T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1079  LSEEPLSERRKIYVRGRRKVKGKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1138

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     Y+RLEFL
Sbjct  1139  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYERLEFL  1196

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y +YP + PG LT+LRS SVNN CYA S+VKA LH +ILH+S  L  
Sbjct  1197  GDAVLDYLITMHLYKEYPSMSPGLLTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHK  1256

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I +  +  ++SS  STFGW  +TSFP VL D+IES+AGAI +DSG   +IVF+ IRP+L
Sbjct  1257  QIVETAEIFQKSSLGSTFGWESETSFPKVLGDVIESLAGAILVDSGYNKEIVFQSIRPLL  1316

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP ++RL+P +EL+ELCQK+ +  K+ VV      A  TI V ANG +   +++A 
Sbjct  1317  EPLITPATVRLHPARELSELCQKQHFDYKKSVVPCNGRNASVTIVVGANGVIFKHTATAA  1376

Query  266   NRKTAKRLACERM  228
             N+KTAK+LA + +
Sbjct  1377  NKKTAKKLASKEV  1389



>ref|XP_011015068.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
 ref|XP_011015076.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Populus 
euphratica]
 ref|XP_011015084.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Populus 
euphratica]
Length=1409

 Score =   339 bits (870),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 225/313 (72%), Gaps = 3/313 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E +    K+Y RGRRK+  +T+ADV EALIGA+LST GE+ AL F+ W+G+ +DF+ 
Sbjct  1080  LSEEPLSERRKIYVRGRRKVKGKTVADVVEALIGAYLSTGGEVLALFFMDWIGIKVDFMI  1139

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F L AE+ VNV+ LES  LLNY+FRDPSLLVEALTHGSY +P     Y+RLEFL
Sbjct  1140  VPYERHFQLQAEKFVNVRYLES--LLNYSFRDPSLLVEALTHGSYMLPEIPSCYERLEFL  1197

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y +YP + PG LT+LRS SVNN CYA S+VKA LH +ILH+S  L  
Sbjct  1198  GDAVLDYLITMHLYKEYPSMSPGLLTDLRSASVNNDCYAQSAVKADLHKHILHNSQDLHK  1257

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I +  +  ++SS  STFGW  +TSFP VL D+IES+AGAI +DSG   +IVF+ IRP+L
Sbjct  1258  QIVETAEIFQKSSLGSTFGWESETSFPKVLGDVIESLAGAILVDSGYNKEIVFQSIRPLL  1317

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP ++RL+P +EL+ELCQK+ +  K+ VV      A  TI V ANG +   +++A 
Sbjct  1318  EPLITPATVRLHPARELSELCQKQHFDYKKSVVPCNGRNASVTIVVGANGVIFKHTATAA  1377

Query  266   NRKTAKRLACERM  228
             N+KTAK+LA + +
Sbjct  1378  NKKTAKKLASKEV  1390



>ref|XP_008240779.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Prunus mume]
Length=781

 Score =   327 bits (839),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 227/312 (73%), Gaps = 4/312 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E       +Y RGRRK+ ++ +ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  463   LNEELPFNKRNIYIRGRRKVKSKRVADVVEALIGAFLSTGGEIAAIHFMNWVGIKVDLVH  522

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F +  E++++V+ LES  L NY+FR P LL+EALTH SY +P     Y+RLEFL
Sbjct  523   TPYERHFQVQPEKLIDVRHLES-LLNNYSFRHPHLLLEALTHRSYMLPQIPGCYERLEFL  581

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDYA+T + Y++YPG+ PG LT++RS SVNN CYALS+VKA LH +IL +S  + S
Sbjct  582   GDAVLDYAITVYLYNKYPGMSPGVLTDMRSASVNNNCYALSAVKARLHEHIL-ASDNVHS  640

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
             +IA+ V N E+ S  STFGW   TSF  VLADIIES+AGAI++DS    + VF+ IRP+L
Sbjct  641   NIANTVNNFERLSMESTFGWESDTSFCEVLADIIESLAGAIFVDSEYDKNAVFQSIRPLL  700

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVR-SCSSSA  270
             EP+V+PE++ LNPV+E  + CQK +Y MK+PV   ++G A  TIEV ANG V+ + +S+A
Sbjct  701   EPLVSPETMPLNPVREFHDYCQKMQYIMKKPVKSIQNGVATRTIEVEANGVVKYTYTSTA  760

Query  269   RNRKTAKRLACE  234
              N  TAKRLAC+
Sbjct  761   SNNDTAKRLACK  772



>ref|XP_011084676.1| PREDICTED: endoribonuclease Dicer homolog 2 [Sesamum indicum]
Length=1398

 Score =   335 bits (859),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/309 (54%), Positives = 224/309 (72%), Gaps = 3/309 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E +L+S K+Y  G  K+ ++T+ADV EALIGAFLS  GE+AALSF+ WLG+ +DF++ P
Sbjct  1078  KEELLSSTKVYIGGSMKIKSKTVADVIEALIGAFLSAGGEVAALSFMTWLGISVDFVNVP  1137

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                N  +N E  VNV  L+S  LLNY+FRD SLLVEALTHGSY +P     YQRLEFLGD
Sbjct  1138  YTRNVAVNPELHVNVPHLQS--LLNYSFRDVSLLVEALTHGSYMLPEIPGCYQRLEFLGD  1195

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             A+LDY +T H Y ++PGL PG LT+LRS SVNN CYA ++VKA L+ ++LH+S  L   I
Sbjct  1196  ALLDYLITVHLYHKHPGLSPGLLTDLRSASVNNDCYAQAAVKAELYKHVLHASPELHRHI  1255

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V N     ++STFGW  +T++P VL DIIES+AGAI++DSG   ++VF+ +RP+LEP
Sbjct  1256  VHAVCNHVVVPSASTFGWESETNYPKVLGDIIESLAGAIFVDSGYNMEVVFQCVRPLLEP  1315

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             +VTPE+L+L+PV+EL ELCQ   Y  K+  V +++G+AC T+EV A+G V        +R
Sbjct  1316  LVTPETLKLHPVRELVELCQSEHYVFKKTTVCNQNGKACATVEVEASGVVYKEMRCEADR  1375

Query  260   KTAKRLACE  234
             KTAKRLAC+
Sbjct  1376  KTAKRLACK  1384



>ref|XP_007217819.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
 gb|EMJ19018.1| hypothetical protein PRUPE_ppa027063mg, partial [Prunus persica]
Length=758

 Score =   325 bits (834),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 219/311 (70%), Gaps = 3/311 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L+++       +Y RG RK+  + +ADV EALIGAFLST GEIAA+ F+ W+G+ +D   
Sbjct  439   LNEKLPFNEKNIYIRGTRKIKGKRVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLFH  498

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F +  E++++V+ LES  L NY+FRDPSLL+EALTHGSY +P     Y+RLEFL
Sbjct  499   IPYERHFQVQPEKLIDVRHLES-LLNNYSFRDPSLLLEALTHGSYMLPQIPGCYERLEFL  557

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y +YP + PG LT++RS SVNN CYA ++V+AGLH +IL S   L +
Sbjct  558   GDAVLDYVITAHLYHKYPDMSPGLLTDMRSASVNNICYARTAVRAGLHKHILASDCVLHT  617

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V N    SA STFGW  +T F  VLADIIES+AGAI++DS    + VF+ IRP+L
Sbjct  618   DIANTVNNFGSLSAESTFGWESETYFSEVLADIIESLAGAIFVDSEYDKNAVFKSIRPLL  677

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVR-SCSSSA  270
             EP+V+PE++ LNP KE  + CQK +Y MK+PV   ++G A  TIEV ANG V+ + +S+A
Sbjct  678   EPLVSPETMPLNPAKEFHDYCQKMQYIMKKPVKSIQNGVATRTIEVEANGVVKYTHTSTA  737

Query  269   RNRKTAKRLAC  237
              N  TAKRLAC
Sbjct  738   SNNDTAKRLAC  748



>ref|XP_010649218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Vitis 
vinifera]
Length=1405

 Score =   335 bits (859),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 5/311 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1084  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1143

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1144  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1201

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1202  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1261

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V N ++    STFGW  ++SFP VL D+IES+AGAI +DS    ++VF+ IRP+LEP
Sbjct  1262  VVTVGNFDKLPVESTFGWESESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEP  1321

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             ++TPE+++L+P +EL ELCQK  Y +K  VVV ++G+A  TIEV ANG     +S++ ++
Sbjct  1322  LITPETVKLHPARELGELCQKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DK  1379

Query  260   KTAKRLACERM  228
             +TA +LA + +
Sbjct  1380  RTATKLASKEV  1390



>emb|CBI17597.3| unnamed protein product [Vitis vinifera]
Length=1340

 Score =   335 bits (858),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 225/307 (73%), Gaps = 5/307 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1021  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1080

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1081  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1138

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1139  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1198

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V N ++    STFGW  ++SFP VL D+IES+AGAI +DS    ++VF+ IRP+LEP
Sbjct  1199  VVTVGNFDKLPVESTFGWESESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEP  1258

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             ++TPE+++L+P +EL ELCQK  Y +K  VVV ++G+A  TIEV ANG     +S++ ++
Sbjct  1259  LITPETVKLHPARELGELCQKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DK  1316

Query  260   KTAKRLA  240
             +TA +LA
Sbjct  1317  RTATKLA  1323



>ref|XP_010649215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Vitis 
vinifera]
Length=1461

 Score =   335 bits (858),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 5/311 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1084  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1143

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1144  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1201

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1202  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1261

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V N ++    STFGW  ++SFP VL D+IES+AGAI +DS    ++VF+ IRP+LEP
Sbjct  1262  VVTVGNFDKLPVESTFGWESESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEP  1321

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             ++TPE+++L+P +EL ELCQK  Y +K  VVV ++G+A  TIEV ANG     +S++ ++
Sbjct  1322  LITPETVKLHPARELGELCQKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DK  1379

Query  260   KTAKRLACERM  228
             +TA +LA + +
Sbjct  1380  RTATKLASKEV  1390



>ref|XP_010649214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Vitis 
vinifera]
Length=1468

 Score =   334 bits (857),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 5/311 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1084  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1143

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1144  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1201

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1202  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1261

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V N ++    STFGW  ++SFP VL D+IES+AGAI +DS    ++VF+ IRP+LEP
Sbjct  1262  VVTVGNFDKLPVESTFGWESESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEP  1321

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             ++TPE+++L+P +EL ELCQK  Y +K  VVV ++G+A  TIEV ANG     +S++ ++
Sbjct  1322  LITPETVKLHPARELGELCQKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DK  1379

Query  260   KTAKRLACERM  228
             +TA +LA + +
Sbjct  1380  RTATKLASKEV  1390



>ref|XP_010649216.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Vitis 
vinifera]
Length=1460

 Score =   334 bits (857),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 5/311 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  1076  EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1135

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1136  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVEALTHGSYMLPEIPRCYQRLEFLGD  1193

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1194  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1253

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V N ++    STFGW  ++SFP VL D+IES+AGAI +DS    ++VF+ IRP+LEP
Sbjct  1254  VVTVGNFDKLPVESTFGWESESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEP  1313

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             ++TPE+++L+P +EL ELCQK  Y +K  VVV ++G+A  TIEV ANG     +S++ ++
Sbjct  1314  LITPETVKLHPARELGELCQKEHYDIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DK  1371

Query  260   KTAKRLACERM  228
             +TA +LA + +
Sbjct  1372  RTATKLASKEV  1382



>ref|XP_007216887.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
 gb|EMJ18086.1| hypothetical protein PRUPE_ppa020875mg, partial [Prunus persica]
Length=752

 Score =   324 bits (830),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 226/312 (72%), Gaps = 4/312 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +     +Y RGRRK+ ++ +ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  434   LNEELLFNKRNIYIRGRRKVKSKRVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLVH  493

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   +F +  E++++V+ LES  L NY+FR P LL+EALTH SY +P     Y+RLEFL
Sbjct  494   IPYERHFQVQPEKLIDVRHLES-LLNNYSFRHPHLLLEALTHRSYMLPQIPGCYERLEFL  552

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T + Y++YPG+ PG LT++RS SVNN CYALS+VK  LH +IL +   + S
Sbjct  553   GDAVLDYVITVYLYNKYPGMSPGVLTDMRSASVNNNCYALSAVKHRLHEHIL-APDNVHS  611

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
             +IA+ V N E+ S  STFGW  +TSF  VLADIIES+AGAI++DS    + VF+ IRP+L
Sbjct  612   NIANTVNNFERLSMESTFGWESETSFSEVLADIIESLAGAIFVDSEYDKNAVFQSIRPLL  671

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVR-SCSSSA  270
             EP+V+PE++ LNPVKE  + CQK +Y MK+PV   ++G A  TIEV ANG V+ + +S+A
Sbjct  672   EPLVSPETMPLNPVKEFHDYCQKMQYIMKKPVKSIQNGVATRTIEVEANGVVKYTYTSTA  731

Query  269   RNRKTAKRLACE  234
              N  TAKRLAC+
Sbjct  732   SNNDTAKRLACK  743



>emb|CAN77284.1| hypothetical protein VITISV_043738 [Vitis vinifera]
Length=1296

 Score =   333 bits (854),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/307 (54%), Positives = 225/307 (73%), Gaps = 5/307 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E + ++ K+Y   RRK+ ++ IADV EALIGAFLST GE AAL F+RWLG+++DF+  P
Sbjct  977   EELLSSTRKIYVSERRKLKSKRIADVVEALIGAFLSTGGETAALIFMRWLGINVDFVKVP  1036

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +FP+  ++ VNV  LES  +LNY+FRDPSLLVE+LTHGSY +P   + YQRLEFLGD
Sbjct  1037  YKRDFPVILKRHVNVSYLES--ILNYSFRDPSLLVESLTHGSYMLPEIPRCYQRLEFLGD  1094

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y +YPG+ PG LT+LRS SVNN CYA S+VKA LH +ILHSS  L   I
Sbjct  1095  AVLDYLMTMHLYHKYPGMSPGLLTDLRSASVNNDCYAQSAVKAKLHQHILHSSQELHRHI  1154

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                V + ++    STFGW  ++SFP VL D+IES+AGAI +DS    ++VF+ IRP+LEP
Sbjct  1155  VVTVGBFDKLPXESTFGWESESSFPKVLGDVIESLAGAILVDSDYNKEVVFQSIRPLLEP  1214

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             ++TPE+++L+P +EL ELCQK  Y +K  VVV ++G+A  TIEV ANG     +S++ ++
Sbjct  1215  LITPETVKLHPARELXELCQKEHYXIKR-VVVSQNGKASVTIEVEANGAKHKHTSTS-DK  1272

Query  260   KTAKRLA  240
             +TA +LA
Sbjct  1273  RTAXKLA  1279



>ref|XP_006480490.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006480491.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X4 [Citrus 
sinensis]
 ref|XP_006480492.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X5 [Citrus 
sinensis]
Length=1401

 Score =   330 bits (845),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 220/310 (71%), Gaps = 3/310 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
             + P    F +  E++VNV+ LES  LLNY+F DPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYERQFQVQVERLVNVRHLES--LLNYSFCDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T + Y++YP L PG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  1251

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I   V + E+ S  STFGW  +TSFP  L DIIES++GAI++DSG   ++VFE IRP+
Sbjct  1252  KWINITVDSFERLSLESTFGWESETSFPKALGDIIESLSGAIFVDSGCNKEVVFESIRPL  1311

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEPM+TPE++RL P +EL E CQK  + MK+ V    +G+A  T+EV ANG +   + + 
Sbjct  1312  LEPMITPETMRLQPARELNEYCQKHHFAMKKTVAPRINGKAAVTVEVHANGTLFKHTHAD  1371

Query  269   RNRKTAKRLA  240
              +++TAK++A
Sbjct  1372  ADKETAKKVA  1381



>ref|XP_006480488.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480489.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Citrus 
sinensis]
Length=1401

 Score =   330 bits (845),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 220/310 (71%), Gaps = 3/310 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
             + P    F +  E++VNV+ LES  LLNY+F DPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYERQFQVQVERLVNVRHLES--LLNYSFCDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T + Y++YP L PG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  1251

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I   V + E+ S  STFGW  +TSFP  L DIIES++GAI++DSG   ++VFE IRP+
Sbjct  1252  KWINITVDSFERLSLESTFGWESETSFPKALGDIIESLSGAIFVDSGCNKEVVFESIRPL  1311

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEPM+TPE++RL P +EL E CQK  + MK+ V    +G+A  T+EV ANG +   + + 
Sbjct  1312  LEPMITPETMRLQPARELNEYCQKHHFAMKKTVAPRINGKAAVTVEVHANGTLFKHTHAD  1371

Query  269   RNRKTAKRLA  240
              +++TAK++A
Sbjct  1372  ADKETAKKVA  1381



>ref|XP_004303843.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Fragaria vesca 
subsp. vesca]
Length=1393

 Score =   328 bits (842),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 216/309 (70%), Gaps = 3/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E + +  K+Y RG R++ ++ IAD+ EALIGAFL T GE+AA+ F+ W+G+ +DF  
Sbjct  1071  LKEELLSSERKIYIRGTRRIKSKRIADIVEALIGAFLVTGGEMAAVYFMNWVGIKVDFTY  1130

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P   NFP+  E+++NVK LE    LNY+F DPSLLVEALTHGSY +P     YQRLEFL
Sbjct  1131  IPYDRNFPVQPEKLINVKVLEKK--LNYSFHDPSLLVEALTHGSYMLPEIPGCYQRLEFL  1188

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T + Y++YPG+ PG LT++RS SVNN CYA SSVKA LH +ILH+S  L  
Sbjct  1189  GDAVLDYLITIYLYNKYPGMSPGVLTDMRSASVNNDCYARSSVKAELHKHILHASQKLHR  1248

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   V N E+    STFGW  +TSFP VL DIIES+ GAI++DSG   ++VF+ IRP+L
Sbjct  1249  EIVHTVDNFEKLHTESTFGWESETSFPKVLGDIIESLGGAIFVDSGYDKNVVFQSIRPLL  1308

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++T E++RL+P +EL E C K  Y MK+P+   ++  A  TIEV ANG     +S A 
Sbjct  1309  EPLITLETMRLHPARELNEFCAKMHYDMKKPLKSFENDVATITIEVEANGVTYKHTSKAS  1368

Query  266   NRKTAKRLA  240
             ++KT  +LA
Sbjct  1369  DKKTGIKLA  1377



>ref|XP_006428678.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
 gb|ESR41918.1| hypothetical protein CICLE_v10010911mg [Citrus clementina]
Length=1401

 Score =   327 bits (838),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 219/310 (71%), Gaps = 3/310 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             EL+   +    K+Y  GR+K+ ++T+ADV EALIGAFLST GE   L FL  +G+ +DF+
Sbjct  1074  ELNDHSLFNERKIYVTGRKKVKSKTVADVVEALIGAFLSTGGENVGLIFLDRIGIKVDFV  1133

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
             + P    F +  E++VNV+ LE   LLNY+F DPSLLVEALTHGSY +P   + YQRLEF
Sbjct  1134  NVPYERQFQVQVERLVNVRHLEL--LLNYSFCDPSLLVEALTHGSYMLPEIPRCYQRLEF  1191

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T + Y++YP L PG LT++RS SVNN CYALSSVK GLH +ILH+S  L 
Sbjct  1192  LGDAVLDYLITVYLYNKYPTLSPGDLTDMRSASVNNDCYALSSVKHGLHKHILHASQELY  1251

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I   V + E+ S  STFGW  +TSFP  L DIIES++GAI++DSG   ++VFE IRP+
Sbjct  1252  KWINITVDSFERLSLESTFGWESETSFPKALGDIIESLSGAIFVDSGCNKEVVFESIRPL  1311

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEPM+TPE++RL P +EL E CQK  + MK+ V    +G+A  T+EV ANG +   + + 
Sbjct  1312  LEPMITPETMRLQPARELNEYCQKHHFAMKKTVAPRINGKAAVTVEVHANGTLFKHTHAD  1371

Query  269   RNRKTAKRLA  240
              +++TAK++A
Sbjct  1372  ADKETAKKVA  1381



>ref|XP_010101236.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB88160.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1429

 Score =   326 bits (836),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 224/332 (67%), Gaps = 31/332 (9%)
 Frame = -3

Query  1130  LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  951
             +Y +G +KM ++ +ADV EALIGAFLST GEI A+ F+ WLG+++D    P   +F + +
Sbjct  1087  IYIKGTKKMKSKRVADVVEALIGAFLSTGGEIPAVKFMNWLGIEVDLEFKPYETHFQVQS  1146

Query  950   EQMVNVKRLE------------------------------SDSLLNYTFRDPSLLVEALT  861
             ++++N+K LE                                 LLNYTFRD SLLVEALT
Sbjct  1147  DRLLNIKHLEFLLNYTFRDRSLLVEALTHGSYMLPEIPRCYQFLLNYTFRDHSLLVEALT  1206

Query  860   HGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALS  684
             HGSY +P   + YQRLEFLGDAVLDY +T HFY+ YPG+ P  LT++RS SVNN CYALS
Sbjct  1207  HGSYMLPEIPRCYQRLEFLGDAVLDYVITMHFYNTYPGMSPEKLTDMRSASVNNDCYALS  1266

Query  683   SVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAI  504
             +VKAGL  +IL++S  L   IA+ + N E+ S+ STFGW  +TSFP VL D+IES+AGAI
Sbjct  1267  AVKAGLQKHILYTSHQLHKEIANTIINFEKLSSESTFGWESETSFPKVLGDVIESLAGAI  1326

Query  503   YLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC  324
             ++DSG   ++VF+ IRP+LEP++TPE+++L+P KEL ELCQK  + MK+PV   ++G + 
Sbjct  1327  FVDSGYDKELVFQSIRPLLEPLITPETVKLHPAKELNELCQKMHFDMKKPVKSRENGVSS  1386

Query  323   TTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
              TIEV ANG     +S+  ++K  K++AC+ +
Sbjct  1387  ITIEVEANGVTYRHTSNVSDKKIGKKVACKEV  1418



>gb|EYU39730.1| hypothetical protein MIMGU_mgv1a0003142mg, partial [Erythranthe 
guttata]
Length=1143

 Score =   322 bits (824),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 216/311 (69%), Gaps = 4/311 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L  E   ++ K+Y  G RK+  +T+ADV EALIGAFLS  GEI ALSF+ WLG+D+DF+ 
Sbjct  824   LQNELFSSTKKIYINGSRKIKGKTVADVAEALIGAFLSAGGEIPALSFIAWLGIDVDFVS  883

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFL  807
              P      L  E  VN+  LES  +LNY+F+D SLLVEALTHGSY+ P     YQRLEFL
Sbjct  884   IPYTRGLFLKPELHVNIGHLES--ILNYSFKDVSLLVEALTHGSYMRPEIPGCYQRLEFL  941

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y + P L PG LT+LRS SVNN CYA S+VKAGLH +ILH S  L  
Sbjct  942   GDAVLDYIITVHLYQENPSLSPGLLTDLRSASVNNDCYANSAVKAGLHKHILHLSPELHR  1001

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   + N ++ ++ STFGW  +T++P VL D+IES+AGAI++DSG   +IVF+ +RP+L
Sbjct  1002  HINTALSNFDEINSKSTFGWESETTYPKVLGDVIESLAGAIFVDSGHNKEIVFQSLRPLL  1061

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP+VT E+LRL+PV+EL ELCQ+  +  ++ +V   +G    TIEV A G V   + SA 
Sbjct  1062  EPLVTLETLRLHPVRELNELCQREHFNFQK-LVTKLNGLVYATIEVEARGVVHKETRSAA  1120

Query  266   NRKTAKRLACE  234
             ++ TAKRLAC+
Sbjct  1121  DKDTAKRLACK  1131



>gb|KCW84635.1| hypothetical protein EUGRSUZ_B01461 [Eucalyptus grandis]
Length=1194

 Score =   322 bits (824),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/299 (54%), Positives = 214/299 (72%), Gaps = 3/299 (1%)
 Frame = -3

Query  1133  KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLN  954
             K+Y+  RRK+  +T+ADV EAL+GA +S  GE A L F+ WLG+++DF   P   N   N
Sbjct  883   KMYTMQRRKIKRKTVADVVEALLGACVSDGGENAGLFFVHWLGIEVDFGIRPSNRNLLAN  942

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVT  777
              E+ +N++ +ES  LL Y+FRDPSLLVEALTHGSY +P     YQRLEFLGD+VLDY VT
Sbjct  943   PERFINIRDIES--LLGYSFRDPSLLVEALTHGSYMLPEVPTCYQRLEFLGDSVLDYLVT  1000

Query  776   RHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  597
              H Y ++PGL PG LT+LRS SVNN  YA S++K GLH +ILH+S  L   IAD   N E
Sbjct  1001  IHLYRKHPGLSPGVLTDLRSASVNNNFYAQSAMKVGLHKHILHASHVLHKHIADVANNFE  1060

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
             + S+  TFGW  +TSFP VL DIIES+AGAI +DS    + VF+ IRP+LEP+VTPE++R
Sbjct  1061  KLSSEFTFGWESETSFPKVLGDIIESLAGAILVDSNYDKERVFQSIRPLLEPLVTPETVR  1120

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             L+PV+EL+ELCQK ++ + +P+V  +DG +  TI+V A G V   ++   ++KTAKRLA
Sbjct  1121  LHPVRELSELCQKERFILGKPIVSREDGVSSVTIQVEAEGVVYCHTTREADKKTAKRLA  1179



>gb|AIE15764.1| Dicer-like protein 2 [Salvia miltiorrhiza]
Length=1385

 Score =   321 bits (823),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 217/311 (70%), Gaps = 5/311 (2%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E + T+ K+Y+RG R++  +T+ADV EALIGA+LS AGE+AALSF+ WLG++++F  
Sbjct  1065  LKEEQLSTTRKVYTRGSRQIKGKTVADVVEALIGAYLSAAGEVAALSFMVWLGIEVNFET  1124

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFL  807
              P    F  N E  VN+  LES  LL Y F+D SLLVEALTHGSY+ P     YQRLEFL
Sbjct  1125  IPYTRMFVTNPEMHVNIGYLES--LLGYNFQDASLLVEALTHGSYMRPEIPGCYQRLEFL  1182

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDY +T H Y  YPGL PG LT+LRS SVNN CYALS++KAGLH  ILH S  L  
Sbjct  1183  GDAVLDYLITVHLYHNYPGLSPGMLTDLRSASVNNDCYALSAIKAGLHKQILHLSPDLHR  1242

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ +    QS    T+GW  + + P VL D+IES+AGAIY+DSG   + VF  ++P+L
Sbjct  1243  HIAETMGKDLQSV--ETYGWESEMTLPKVLGDVIESLAGAIYVDSGHDKETVFRCMKPLL  1300

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             +P+VT E+LRL+P +EL +LCQK  Y M++PV    DG A  T+EV A G V   + SA+
Sbjct  1301  DPLVTLETLRLHPKRELNQLCQKENYTMQKPVTSRHDGLAYATVEVEARGVVHKETRSAK  1360

Query  266   NRKTAKRLACE  234
             ++K A+RLAC+
Sbjct  1361  DKKLAERLACK  1371



>ref|XP_010038609.1| PREDICTED: endoribonuclease Dicer homolog 2 [Eucalyptus grandis]
Length=1403

 Score =   321 bits (823),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/299 (54%), Positives = 214/299 (72%), Gaps = 3/299 (1%)
 Frame = -3

Query  1133  KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLN  954
             K+Y+  RRK+  +T+ADV EAL+GA +S  GE A L F+ WLG+++DF   P   N   N
Sbjct  1092  KMYTMQRRKIKRKTVADVVEALLGACVSDGGENAGLFFVHWLGIEVDFGIRPSNRNLLAN  1151

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVT  777
              E+ +N++ +ES  LL Y+FRDPSLLVEALTHGSY +P     YQRLEFLGD+VLDY VT
Sbjct  1152  PERFINIRDIES--LLGYSFRDPSLLVEALTHGSYMLPEVPTCYQRLEFLGDSVLDYLVT  1209

Query  776   RHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  597
              H Y ++PGL PG LT+LRS SVNN  YA S++K GLH +ILH+S  L   IAD   N E
Sbjct  1210  IHLYRKHPGLSPGVLTDLRSASVNNNFYAQSAMKVGLHKHILHASHVLHKHIADVANNFE  1269

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
             + S+  TFGW  +TSFP VL DIIES+AGAI +DS    + VF+ IRP+LEP+VTPE++R
Sbjct  1270  KLSSEFTFGWESETSFPKVLGDIIESLAGAILVDSNYDKERVFQSIRPLLEPLVTPETVR  1329

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             L+PV+EL+ELCQK ++ + +P+V  +DG +  TI+V A G V   ++   ++KTAKRLA
Sbjct  1330  LHPVRELSELCQKERFILGKPIVSREDGVSSVTIQVEAEGVVYCHTTREADKKTAKRLA  1388



>ref|XP_010673887.1| PREDICTED: endoribonuclease Dicer homolog 2 [Beta vulgaris subsp. 
vulgaris]
Length=1432

 Score =   320 bits (820),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 221/309 (72%), Gaps = 4/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y+ G RK+ ++ +ADV EALIGAFLS  GE+A+L F+ WLG++++F  
Sbjct  1112  LEKEFLSSTYKIYNGGTRKIKSKRVADVVEALIGAFLSAGGEVASLMFMNWLGIEVEFSC  1171

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
                  N P+N   ++NV  +ES  +LNY+F+DPSL+VEALTHGSY +P   + YQRLEFL
Sbjct  1172  ITYQRNVPMNPRMILNVNHIES--VLNYSFKDPSLVVEALTHGSYMLPEIPRCYQRLEFL  1229

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLD+ +T H Y ++P + PG LT+LRS SVNN CY L +++AGLH +ILH+S  L  
Sbjct  1230  GDAVLDHLITIHLYTKHPEMSPGLLTDLRSASVNNECYGLCAIRAGLHKHILHASQILYK  1289

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              +A  V + +QSS  STFGW  + + P VLADIIES+AGAI++DSG   ++VF+ I P+L
Sbjct  1290  QMAAAVASFQQSSLESTFGWESEINLPKVLADIIESLAGAIFVDSGFNKEVVFKSISPLL  1349

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP++TP++L+LNPV EL  LCQ   Y M +     ++G A  TIEV ANG V   + +A 
Sbjct  1350  EPLITPKTLKLNPVSELNHLCQTHHYTMTKKKTC-ENGVASITIEVEANGVVHRHTRTAS  1408

Query  266   NRKTAKRLA  240
             +RKTAK+LA
Sbjct  1409  DRKTAKKLA  1417



>ref|XP_007029214.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
 gb|EOY09716.1| Dicer-like protein isoform 7, partial [Theobroma cacao]
Length=947

 Score =   314 bits (805),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 199/266 (75%), Gaps = 3/266 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E + ++ K+Y  GRRK+ N+ +ADV EALIGA+LS  GE A + FL W+G+++DF +
Sbjct  683   LNEETLCSTRKIYVSGRRKLKNKKVADVVEALIGAYLSVGGEAAGVLFLNWIGINVDFTN  742

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P    F ++AE++VNV+ LES  LLNY+F+DPSLLVEALTHGSY +    + YQR+EFL
Sbjct  743   IPYQRQFKVHAEKLVNVRVLES--LLNYSFQDPSLLVEALTHGSYMLAEIPECYQRMEFL  800

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T H Y +YP + PG LT+LRS SVNN CYALS+VKAGLH YILH+S  L  
Sbjct  801   GDSVLDYLITVHLYSKYPRMSPGLLTDLRSASVNNDCYALSAVKAGLHKYILHASQKLHK  860

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              IA+ V++ ++ S   TFGW    SFP VLADIIES+AGAI++DSG     VF  IRP+L
Sbjct  861   EIAETVESFKELSMKYTFGWECDKSFPKVLADIIESLAGAIFVDSGYDKHAVFRSIRPLL  920

Query  446   EPMVTPESLRLNPVKELTELCQKRKY  369
             EP++TPE+++ +PVKEL ELCQK  +
Sbjct  921   EPLITPETIKFHPVKELNELCQKEHF  946



>ref|XP_010249398.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Nelumbo 
nucifera]
Length=1188

 Score =   317 bits (812),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 219/312 (70%), Gaps = 3/312 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             E  +E +  + K+Y RG+R+M N+ +AD  EALIGA+L T GE+AAL F+ WLG+++ F+
Sbjct  866   EFGEELLSDTRKIYFRGKRRMKNKVVADAVEALIGAYLETGGEVAALIFMDWLGIEVTFV  925

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
               P    F  + +  +N++ +ES  LL Y+FRDPSLLVEALTHGSY IP   + YQRLEF
Sbjct  926   HIPHEKPFLGDPKMHINIRHIES--LLKYSFRDPSLLVEALTHGSYMIPEIPRCYQRLEF  983

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGD+VLDY +T + Y++YPG  PG LT+LRS SVNN  YA +++KAGLH +ILH+S  L 
Sbjct  984   LGDSVLDYLITTYLYNKYPGASPGLLTDLRSASVNNDSYANAALKAGLHKHILHASPKLH  1043

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I+  +   EQ +   T GW  + +FP VL D+IES+AGAI +DS    D+V++ ++P+
Sbjct  1044  QQISSILNYHEQINLGPTIGWDSEMTFPKVLGDVIESLAGAILVDSEYNKDVVWKSMQPL  1103

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEP+VTP++++L+PV+EL ELCQ+  Y MK   V +K+G A  TIEV A G   S + + 
Sbjct  1104  LEPIVTPDTVKLHPVRELHELCQRHSYVMKPYSVSYKEGLASITIEVEAYGITYSHTCTG  1163

Query  269   RNRKTAKRLACE  234
              N+KTAKRLAC+
Sbjct  1164  ENKKTAKRLACK  1175



>ref|XP_010249397.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Nelumbo 
nucifera]
Length=1394

 Score =   317 bits (813),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 219/312 (70%), Gaps = 3/312 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             E  +E +  + K+Y RG+R+M N+ +AD  EALIGA+L T GE+AAL F+ WLG+++ F+
Sbjct  1072  EFGEELLSDTRKIYFRGKRRMKNKVVADAVEALIGAYLETGGEVAALIFMDWLGIEVTFV  1131

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
               P    F  + +  +N++ +ES  LL Y+FRDPSLLVEALTHGSY IP   + YQRLEF
Sbjct  1132  HIPHEKPFLGDPKMHINIRHIES--LLKYSFRDPSLLVEALTHGSYMIPEIPRCYQRLEF  1189

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGD+VLDY +T + Y++YPG  PG LT+LRS SVNN  YA +++KAGLH +ILH+S  L 
Sbjct  1190  LGDSVLDYLITTYLYNKYPGASPGLLTDLRSASVNNDSYANAALKAGLHKHILHASPKLH  1249

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I+  +   EQ +   T GW  + +FP VL D+IES+AGAI +DS    D+V++ ++P+
Sbjct  1250  QQISSILNYHEQINLGPTIGWDSEMTFPKVLGDVIESLAGAILVDSEYNKDVVWKSMQPL  1309

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEP+VTP++++L+PV+EL ELCQ+  Y MK   V +K+G A  TIEV A G   S + + 
Sbjct  1310  LEPIVTPDTVKLHPVRELHELCQRHSYVMKPYSVSYKEGLASITIEVEAYGITYSHTCTG  1369

Query  269   RNRKTAKRLACE  234
              N+KTAKRLAC+
Sbjct  1370  ENKKTAKRLACK  1381



>gb|KEH42074.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1385

 Score =   317 bits (811),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/312 (50%), Positives = 218/312 (70%), Gaps = 5/312 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V    K+Y+RG RK+  +  ADV EALIGAFLST GE+AAL FL W+G+ ++F   P
Sbjct  1065  EETVFKGTKIYTRGNRKLKRKIAADVVEALIGAFLSTGGEMAALLFLDWVGIKVNFNITP  1124

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                 F    + ++NV  LES  LL ++FRD SLLVEA+THGSY +P   + YQRLE+LGD
Sbjct  1125  YERQFDACPDNLINVSFLES--LLKHSFRDRSLLVEAMTHGSYMLPDVPRCYQRLEYLGD  1182

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             AVLDY +T H Y+++PG+ PG LT++RS SVNN CYA+S++K  LH ++LH+S  L   I
Sbjct  1183  AVLDYLITTHLYNEHPGMTPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHI  1242

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  +   ++ S+S TFGW  + SFP VL DIIES+AGAI++DSG   ++V++ IRP+LEP
Sbjct  1243  AATLDKFDEQSSSQTFGWESEASFPKVLGDIIESLAGAIFVDSGYNKEVVWQSIRPLLEP  1302

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCS-SSARN  264
             +VTP++L ++P++ELTELCQK  Y M E  +   DG     IEV+A+G +       + +
Sbjct  1303  LVTPDTLTIHPIRELTELCQKMNYTM-EKNLSRNDGVTSCRIEVIADGIIHQYEYKGSTD  1361

Query  263   RKTAKRLACERM  228
             +KTA RLAC+R+
Sbjct  1362  KKTATRLACKRV  1373



>ref|XP_006586846.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
Length=1420

 Score =   314 bits (804),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 220/312 (71%), Gaps = 4/312 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1103  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1162

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1163  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1220

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y++YPG+ PG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1221  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1280

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  + N ++ S+SSTFG+  + S P VL DIIES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1281  AVTLNNFDKLSSSSTFGYESEASPPKVLGDIIESLAGAILVDSGFNKEVVWQSIRPLLEP  1340

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN-  264
             +VTPE+L+L+P++EL ELCQKR Y++    V  KDG     ++V A+G +     +    
Sbjct  1341  LVTPETLKLHPIRELNELCQKRSYKIVLEDVSRKDGVTNYRMKVEADGVIHEYEYTGPAL  1400

Query  263   RKTAKRLACERM  228
             R TAK++AC+ +
Sbjct  1401  RDTAKKIACKEI  1412



>ref|XP_003534774.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
Length=1421

 Score =   314 bits (804),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 220/312 (71%), Gaps = 4/312 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1104  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1163

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1164  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1221

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y++YPG+ PG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1222  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1281

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  + N ++ S+SSTFG+  + S P VL DIIES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1282  AVTLNNFDKLSSSSTFGYESEASPPKVLGDIIESLAGAILVDSGFNKEVVWQSIRPLLEP  1341

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN-  264
             +VTPE+L+L+P++EL ELCQKR Y++    V  KDG     ++V A+G +     +    
Sbjct  1342  LVTPETLKLHPIRELNELCQKRSYKIVLEDVSRKDGVTNYRMKVEADGVIHEYEYTGPAL  1401

Query  263   RKTAKRLACERM  228
             R TAK++AC+ +
Sbjct  1402  RDTAKKIACKEI  1413



>ref|XP_006586847.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Glycine 
max]
Length=1387

 Score =   313 bits (803),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 220/312 (71%), Gaps = 4/312 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1070  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1129

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1130  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1187

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y++YPG+ PG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1188  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1247

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  + N ++ S+SSTFG+  + S P VL DIIES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1248  AVTLNNFDKLSSSSTFGYESEASPPKVLGDIIESLAGAILVDSGFNKEVVWQSIRPLLEP  1307

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN-  264
             +VTPE+L+L+P++EL ELCQKR Y++    V  KDG     ++V A+G +     +    
Sbjct  1308  LVTPETLKLHPIRELNELCQKRSYKIVLEDVSRKDGVTNYRMKVEADGVIHEYEYTGPAL  1367

Query  263   RKTAKRLACERM  228
             R TAK++AC+ +
Sbjct  1368  RDTAKKIACKEI  1379



>gb|KHN23014.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1324

 Score =   313 bits (802),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 220/312 (71%), Gaps = 4/312 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V+   K+Y  G+RK++ + IADV EALIGAFLST GEI+AL F+ W+G+ + F   P
Sbjct  1007  EELVIKGKKIYVHGKRKLNRKIIADVVEALIGAFLSTGGEISALLFMDWVGIKVSFDKIP  1066

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E+++NV+ LES   L Y+F D SLLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1067  YERHFDIQPEKLLNVRFLESQ--LKYSFHDHSLLVEALTHGSYMLPEVPRCYQRLEFLGD  1124

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y++YPG+ PG LT++R+ SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1125  SVLDYLITWHLYNEYPGMSPGQLTDMRAASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1184

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  + N ++ S+SSTFG+  + S P VL DIIES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1185  AVTLNNFDKLSSSSTFGYESEASPPKVLGDIIESLAGAILVDSGFNKEVVWQSIRPLLEP  1244

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN-  264
             +VTPE+L+L+P++EL ELCQKR Y++    V  KDG     ++V A+G +     +    
Sbjct  1245  LVTPETLKLHPIRELNELCQKRSYKIVLEDVSRKDGVTNYRMKVEADGVIHEYEYTGPAL  1304

Query  263   RKTAKRLACERM  228
             R TAK++AC+ +
Sbjct  1305  RDTAKKIACKEI  1316



>ref|XP_007147466.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147467.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 ref|XP_007147468.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19460.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19461.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
 gb|ESW19462.1| hypothetical protein PHAVU_006G127100g [Phaseolus vulgaris]
Length=1392

 Score =   311 bits (797),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 215/311 (69%), Gaps = 4/311 (1%)
 Frame = -3

Query  1154  ECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI  975
             E V    K Y  G+RK+  + +ADV EALIGAFLST GE AAL F+ W+G+ + F   P 
Sbjct  1070  ELVTKGKKNYVYGKRKLKRKIVADVVEALIGAFLSTGGEKAALMFMDWVGIKVSFDKIPY  1129

Query  974   VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDA  798
               +F +  +++VNVK LES   L Y+FRD SLLVEALTHGSY +P   + YQRLEFLGD+
Sbjct  1130  ERHFDIQPDKLVNVKFLESQ--LKYSFRDRSLLVEALTHGSYMLPEVPRCYQRLEFLGDS  1187

Query  797   VLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA  618
             VLDY +T H Y++YPG+ PG LT++RS SVNN CYA  ++K GLH ++LH+S  L   IA
Sbjct  1188  VLDYLITWHLYNKYPGMSPGQLTDMRSASVNNDCYAWCTIKHGLHKHVLHASQELHMHIA  1247

Query  617   DFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM  438
               + N E+ S+SSTFG+  +TS P VL DI+ES+AGAI +DSG   ++V++ IRP+LEP+
Sbjct  1248  VTLDNFEKLSSSSTFGYESETSLPKVLGDILESLAGAILVDSGYDKEVVWQSIRPLLEPL  1307

Query  437   VTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRK  258
             VTPE+L+L+P++E  ELCQKR YR+ + VV  KDG     + V A+G +          K
Sbjct  1308  VTPETLKLHPIREFYELCQKRNYRIIQSVVSRKDGVTNYKMGVEADGVIHEYEYLGSALK  1367

Query  257   -TAKRLACERM  228
              TAK++ C+++
Sbjct  1368  DTAKKIVCKKL  1378



>emb|CDP20270.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 216/314 (69%), Gaps = 22/314 (7%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E + T   +Y+R +R + N+T+ADV EALIG F+ T  E AAL+F++W+G ++DFI 
Sbjct  34    LRKEVLSTRIIVYAREKRTIKNKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFIY  93

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  810
              P     P N E++V++K  +   LLN Y+FRD SLLVEALTHGSY+ P    SY+RL+F
Sbjct  94    VPYKRPVPANPEKLVDLKFFKK--LLNQYSFRDASLLVEALTHGSYVRPESPTSYERLKF  151

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVL+Y +T HFY+++P L  G LT+LRS SVNN  YA +++K GLH +ILH S  L+
Sbjct  152   LGDAVLEYLITMHFYNKHPNLSSGLLTDLRSASVNNDRYARTAIKTGLHKHILHDSQDLQ  211

Query  629   SSIADFVKNIEQSSASSTFGW----VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
               I   VKN +QSS  STFGW    V+K     ++ADII+S+AGAIY+DSG   ++VF  
Sbjct  212   RRILAIVKNFKQSSQDSTFGWGSGPVIK-----LVADIIKSLAGAIYVDSGYDKEVVFRS  266

Query  461   IRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSC  282
             I+P+LEP+ TPE+L+L PV+EL ELC K  + +KE     +DG+    ++V ANG + + 
Sbjct  267   IKPLLEPLPTPETLKLQPVRELEELCAKEHFDLKE-----EDGK----LKVNANGVIYAR  317

Query  281   SSSARNRKTAKRLA  240
               SA N+KTA++ A
Sbjct  318   RLSAANKKTARKTA  331



>ref|XP_004486471.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Cicer arietinum]
Length=1400

 Score =   307 bits (786),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 217/311 (70%), Gaps = 8/311 (3%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V    K+Y+RG R +  + +ADV EALIGAFL+  GE AAL F+ W+G+ ++F   P
Sbjct  1081  KETVYKGTKIYTRGDRNLKRKIVADVVEALIGAFLTAGGEKAALLFMDWIGIKVNFNIMP  1140

Query  977   IVGNFPLNA-EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  804
                   LNA E +VNV  LES  LL Y+FR+PSLLVEA+THGSY +P     YQRLE+LG
Sbjct  1141  YERQ--LNAPENVVNVGFLES--LLKYSFRNPSLLVEAMTHGSYMLPEVPTCYQRLEYLG  1196

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             D+VLDY +T H Y +YPG+ PG LT++RS SVNN CYA+S++K  LH ++LH+S  L   
Sbjct  1197  DSVLDYLITMHLYKEYPGMSPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKH  1256

Query  623   IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE  444
             I   +   ++ S+SSTFGW  + SFP VL DIIES+AGAI +DSG   ++V++ IRP+LE
Sbjct  1257  IVATLDKFDEVSSSSTFGWESEASFPKVLGDIIESLAGAILVDSGYNKEVVWKSIRPLLE  1316

Query  443   PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGV-RSCSSSAR  267
             P+VTP++L+++PV+ELTELCQ+  Y M E  +   DG     +EV+A+G + +S      
Sbjct  1317  PLVTPDTLKVHPVRELTELCQEMNYTM-EKTLSRNDGVTSCRVEVIADGVIHQSEYKGYA  1375

Query  266   NRKTAKRLACE  234
             ++KTAKRLAC+
Sbjct  1376  DKKTAKRLACK  1386



>ref|XP_006300010.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
 gb|EOA32908.1| hypothetical protein CARUB_v10016233mg, partial [Capsella rubella]
Length=1392

 Score =   305 bits (782),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 212/309 (69%), Gaps = 4/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L+ + +  SG +Y    R +  + +ADV EALIGA+LS  GE+AAL F+ W+G+ IDF  
Sbjct  1073  LNNDTLPESGNVYVASIRNLKRKCVADVVEALIGAYLSEGGELAALVFMNWVGIKIDFTT  1132

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
               I     + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFL
Sbjct  1133  TKIERESLIQAEKLVNVGYIES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFL  1190

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T+H YD++P L PG LT++RS SVNN CYA  +VKA LH +ILH+S  L  
Sbjct  1191  GDSVLDYLITKHLYDKFPSLSPGLLTDMRSASVNNDCYAQVAVKANLHKHILHASHDLHK  1250

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I+  V   E+SS  STFGW    SFP VL D+IES+AGAI++DSG   D+VF  I+P+L
Sbjct  1251  HISRTVSEFERSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKDVVFASIKPLL  1310

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
               ++TPE+++L+PV+ELTELCQ+ ++ + + V   K+GEA   +EV A G   + ++ A 
Sbjct  1311  GCLITPETVKLHPVRELTELCQREQFELSK-VQGFKNGEAYFVVEVKAKGMSFAHTAKAS  1369

Query  266   NRKTAKRLA  240
             ++K AK+LA
Sbjct  1370  DKKMAKKLA  1378



>ref|NP_566199.4| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 ref|NP_001189798.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 sp|Q3EBC8.2|DCL2_ARATH RecName: Full=Endoribonuclease Dicer homolog 2; AltName: Full=Dicer-like 
protein 2; Short=AtDCL2 [Arabidopsis thaliana]
 gb|AEE73924.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73926.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1388

 Score =   305 bits (780),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 212/301 (70%), Gaps = 8/301 (3%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct  1081  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP  1140

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1141  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1198

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP L PG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V  
Sbjct  1199  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSE  1258

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1259  FEQSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1318

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     KD ++  T+EV A     + ++ A ++K AK+L
Sbjct  1319  VKLHPVRELTELCQKWQFELSKA----KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKL  1373

Query  242   A  240
             A
Sbjct  1374  A  1374



>ref|NP_001078101.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
 gb|AEE73925.1| endoribonuclease Dicer-like 2 [Arabidopsis thaliana]
Length=1374

 Score =   304 bits (779),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 212/301 (70%), Gaps = 8/301 (3%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct  1067  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP  1126

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1127  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1184

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP L PG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V  
Sbjct  1185  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSE  1244

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1245  FEQSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1304

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     KD ++  T+EV A     + ++ A ++K AK+L
Sbjct  1305  VKLHPVRELTELCQKWQFELSKA----KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKL  1359

Query  242   A  240
             A
Sbjct  1360  A  1360



>ref|XP_003535104.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Glycine 
max]
 ref|XP_006586845.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Glycine 
max]
 gb|KHN23015.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=1414

 Score =   303 bits (777),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 213/312 (68%), Gaps = 4/312 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V     +Y  G+RK+  + +ADV EALIGAFLST GE AAL F+ W+G+ + F   P
Sbjct  1071  KELVAKGKTIYVSGKRKLRQKIVADVVEALIGAFLSTGGEKAALLFMDWVGIKVSFNKIP  1130

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E++VNV  LES   LNY+F D SLLVEA+THGSY +P   + YQRLEFLGD
Sbjct  1131  YDRHFDIQPEKLVNVSFLESQ--LNYSFHDRSLLVEAVTHGSYMLPEVPRCYQRLEFLGD  1188

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y++YPG+ PG LT++RS SVNN CYA S++K GLH ++LH+S  L   +
Sbjct  1189  SVLDYLITWHLYNKYPGMTPGQLTDMRSASVNNDCYAWSAIKHGLHKHVLHASQELHMHV  1248

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             +  +   ++ S+ STFG+  +TS P VL DI+ES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1249  SATLNKFDKLSSLSTFGYEAETSLPKVLGDIVESLAGAILVDSGYNKEVVWQSIRPLLEP  1308

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN-  264
             +VTPE+L+L+P++EL ELCQKR Y++    V  KDG     +EV A+G +          
Sbjct  1309  LVTPETLKLHPIRELNELCQKRSYKIILEDVSRKDGLTYYRMEVEADGIIHKYEYKGDAL  1368

Query  263   RKTAKRLACERM  228
             R TAK++ C+ +
Sbjct  1369  RDTAKKIVCKEI  1380



>ref|XP_010508779.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
 ref|XP_010508854.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Camelina 
sativa]
Length=1394

 Score =   303 bits (776),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 209/302 (69%), Gaps = 4/302 (1%)
 Frame = -3

Query  1130  LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  951
             +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    +    P+ A
Sbjct  1085  IYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGITIDFTTTKMERESPIQA  1144

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTR  774
             E++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY +T+
Sbjct  1145  EKLVNVGYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYLITK  1202

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H YD+YP + PG LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+
Sbjct  1203  HLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTVSEFER  1262

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             SS  STFGW    SFP VL D+IES+AGAI++DSG    +VF  I+P+L  M+TPE+++L
Sbjct  1263  SSLQSTFGWESDVSFPKVLGDVIESLAGAIFVDSGYNKSVVFASIKPLLGCMITPETVKL  1322

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
             +PV+ELTELCQK ++ +       K+GEA  T+EV A     + +S A ++K AK++A +
Sbjct  1323  HPVRELTELCQKAQFELSTAKGF-KNGEAYFTVEVKAKEMSFAHTSKASDKKLAKKMAYK  1381

Query  233   RM  228
             ++
Sbjct  1382  QV  1383



>ref|XP_010508629.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
 ref|XP_010508709.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Camelina 
sativa]
Length=1397

 Score =   303 bits (775),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/302 (51%), Positives = 209/302 (69%), Gaps = 4/302 (1%)
 Frame = -3

Query  1130  LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  951
             +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    +    P+ A
Sbjct  1088  IYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGITIDFTTTKMERESPIQA  1147

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTR  774
             E++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY +T+
Sbjct  1148  EKLVNVGYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYLITK  1205

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H YD+YP + PG LT++RS SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+
Sbjct  1206  HLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLHKHILHASHDLHKHISRTVSEFER  1265

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             SS  STFGW    SFP VL D+IES+AGAI++DSG    +VF  I+P+L  M+TPE+++L
Sbjct  1266  SSLQSTFGWESDVSFPKVLGDVIESLAGAIFVDSGYNKSVVFASIKPLLGCMITPETVKL  1325

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
             +PV+ELTELCQK ++ +       K+GEA  T+EV A     + +S A ++K AK++A +
Sbjct  1326  HPVRELTELCQKAQFELSTAKGF-KNGEAYFTVEVKAKEMSFAHTSKASDKKLAKKMAYK  1384

Query  233   RM  228
             ++
Sbjct  1385  QV  1386



>gb|ABF19797.1| dicer-like 2 spliceform 1 [Arabidopsis thaliana]
Length=1386

 Score =   302 bits (773),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 211/301 (70%), Gaps = 8/301 (3%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +D     I  + P
Sbjct  1079  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDLTTTKIQRDSP  1138

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1139  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1196

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP L PG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V  
Sbjct  1197  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSE  1256

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1257  FEQSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1316

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     KD ++  T+EV A     + ++ A ++K AK+L
Sbjct  1317  VKLHPVRELTELCQKWQFELSKA----KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKL  1371

Query  242   A  240
             A
Sbjct  1372  A  1372



>gb|ABF19798.1| dicer-like 2 spliceform 2 [Arabidopsis thaliana]
Length=1374

 Score =   302 bits (773),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 211/301 (70%), Gaps = 8/301 (3%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +D     I  + P
Sbjct  1067  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDLTTTKIQRDSP  1126

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1127  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1184

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP L PG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V  
Sbjct  1185  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSE  1244

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1245  FEQSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1304

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     KD ++  T+EV A     + ++ A ++K AK+L
Sbjct  1305  VKLHPVRELTELCQKWQFELSKA----KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKL  1359

Query  242   A  240
             A
Sbjct  1360  A  1360



>ref|XP_008373030.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Malus 
domestica]
Length=776

 Score =   295 bits (754),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 212/309 (69%), Gaps = 7/309 (2%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +     +Y  G RK+D + + DV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  461   LNEELLFNKRSIYVGGTRKIDTKVVGDVVEALIGAFLSTGGELDAIYFMNWVGIEVDXDH  520

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  804
                  + P+  E++++V  LES  LL Y F DPSLLVEAL+HGSY+P G   YQRLEFLG
Sbjct  521   IRYERHLPVQPEKLIDVGHLES--LLGYKFCDPSLLVEALSHGSYMPGG---YQRLEFLG  575

Query  803   DAVLDYAVTRHFYDQYPGLF-PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             DAVLDY +T +FY +YPG+  PG LT++RS SVNN CYA S+VKAGLH +IL S    R+
Sbjct  576   DAVLDYMITTYFYYKYPGMMSPGFLTDMRSASVNNDCYARSAVKAGLHEHILASDIVHRN  635

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   V N    S  STFG+  +TSF  VLADI+E++AGAI++DSG    IVF+ IR +L
Sbjct  636   -IDSTVNNFGLLSTESTFGFESETSFTSVLADIVEALAGAIFIDSGYDKQIVFQSIRRLL  694

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP+V+PE+LRL+P ++  + CQK+ Y +++ V   ++GEA  TIEV A       +S+A 
Sbjct  695   EPLVSPETLRLHPGRDFNDYCQKKHYNVQKLVECFQNGEAMVTIEVEAEXVTYKHTSTAS  754

Query  266   NRKTAKRLA  240
             N+ TA++LA
Sbjct  755   NKITARKLA  763



>gb|AES64802.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1377

 Score =   301 bits (771),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 211/310 (68%), Gaps = 6/310 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V    K+Y+RG RK+  + +ADV EALIGAFLS  GE+AAL F+ W+G+ ++F   P
Sbjct  1063  EETVFNGRKIYTRGDRKLKRKVVADVVEALIGAFLSAGGEMAALLFMDWIGIKVNFNIIP  1122

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                 F    + +VNV+ LES  LL Y+FRD SLLVEALTHGSY +P   + YQRLE+LGD
Sbjct  1123  YERQFIACPDNLVNVRFLES--LLKYSFRDRSLLVEALTHGSYMLPDVPRCYQRLEYLGD  1180

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y  YPG+ PG LT++RS SVNN CYA+S++K  LH ++LH+S  L   I
Sbjct  1181  SVLDYLITMHLYRVYPGMSPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHI  1240

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                +   +  S SS+FGW  + +FP VL DIIES+AGAI++DSG   + V++ IRP+LEP
Sbjct  1241  VATLDKFDDQS-SSSFGWESEATFPKVLGDIIESLAGAIFVDSGYDKEAVWKSIRPLLEP  1299

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCS-SSARN  264
             +VTP++L ++P++EL ELCQK  Y  KE  +   DG     IEV+A+G +       + +
Sbjct  1300  LVTPDTLTIHPIRELNELCQKMNY-TKEKTLSRNDGVTSCKIEVIADGVIHQFEYKGSTD  1358

Query  263   RKTAKRLACE  234
             +KTA RLAC+
Sbjct  1359  KKTATRLACK  1368



>ref|XP_003594551.1| Endoribonuclease Dicer [Medicago truncatula]
Length=1418

 Score =   301 bits (771),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 211/310 (68%), Gaps = 6/310 (2%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V    K+Y+RG RK+  + +ADV EALIGAFLS  GE+AAL F+ W+G+ ++F   P
Sbjct  1104  EETVFNGRKIYTRGDRKLKRKVVADVVEALIGAFLSAGGEMAALLFMDWIGIKVNFNIIP  1163

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                 F    + +VNV+ LES  LL Y+FRD SLLVEALTHGSY +P   + YQRLE+LGD
Sbjct  1164  YERQFIACPDNLVNVRFLES--LLKYSFRDRSLLVEALTHGSYMLPDVPRCYQRLEYLGD  1221

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H Y  YPG+ PG LT++RS SVNN CYA+S++K  LH ++LH+S  L   I
Sbjct  1222  SVLDYLITMHLYRVYPGMSPGQLTDMRSASVNNDCYAMSAIKVQLHKHVLHASQELHKHI  1281

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
                +   +  S SS+FGW  + +FP VL DIIES+AGAI++DSG   + V++ IRP+LEP
Sbjct  1282  VATLDKFDDQS-SSSFGWESEATFPKVLGDIIESLAGAIFVDSGYDKEAVWKSIRPLLEP  1340

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCS-SSARN  264
             +VTP++L ++P++EL ELCQK  Y  KE  +   DG     IEV+A+G +       + +
Sbjct  1341  LVTPDTLTIHPIRELNELCQKMNY-TKEKTLSRNDGVTSCKIEVIADGVIHQFEYKGSTD  1399

Query  263   RKTAKRLACE  234
             +KTA RLAC+
Sbjct  1400  KKTATRLACK  1409



>ref|XP_007216896.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
 gb|EMJ18095.1| hypothetical protein PRUPE_ppa019601mg, partial [Prunus persica]
Length=806

 Score =   295 bits (754),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 211/302 (70%), Gaps = 5/302 (2%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L ++       +Y RGRRK+ +ET+ADV EALIGAFLST GEIAA+ F+ W+G+ +D + 
Sbjct  461   LSEDLPFNERNIYIRGRRKVTDETVADVVEALIGAFLSTGGEIAAIYFMNWVGIKVDLVH  520

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRLEFL  807
              P   +F +  E++++V+ L+S  LLNY+F DPSLL+EALTH S  +P     Y+RLEFL
Sbjct  521   IPYKRHFQVQPEKLIDVRYLKS--LLNYSFHDPSLLLEALTHSSCMLPKIPGCYERLEFL  578

Query  806   GDAVLDYAVTRHFYDQYPGLF-PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             GDAVLDY +T + Y++Y  +  PG +T++RS SVNN CYALS+VKAGLH +IL +S  + 
Sbjct  579   GDAVLDYVITFYLYNKYRDMSSPGFITDMRSASVNNDCYALSAVKAGLHKHIL-ASDNVD  637

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
             + IA+ V N  + S  STFGW ++T F  VLADIIES+AGAI++DS    DIVF+ IRP+
Sbjct  638   NDIANTVNNFGRLSIESTFGWEIETYFSEVLADIIESLAGAIFVDSEYDKDIVFQSIRPL  697

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEP+VTPE++ LN ++E  ++C+K +Y MK+P +   +G    TIEV A G V    +S 
Sbjct  698   LEPLVTPETMPLNHIREFKDICKKMQYIMKKPAIYTPNGVVTRTIEVEAKGVVIYKHTST  757

Query  269   RN  264
              N
Sbjct  758   HN  759



>gb|AAF26098.1|AC012328_1 unknown protein [Arabidopsis thaliana]
Length=2042

 Score =   303 bits (776),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 212/301 (70%), Gaps = 8/301 (3%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct  1735  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP  1794

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1795  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1852

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP L PG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V  
Sbjct  1853  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSE  1912

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1913  FEQSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1972

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     KD ++  T+EV A     + ++ A ++K AK+L
Sbjct  1973  VKLHPVRELTELCQKWQFELSKA----KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKL  2027

Query  242   A  240
             A
Sbjct  2028  A  2028



>ref|XP_011660218.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
sativus]
Length=1306

 Score =   300 bits (768),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 217/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             +L +E + +  K+Y + +RK+ ++ IADV EALIGA+LST GE AA+ FL  +G++++F 
Sbjct  982   QLREEVLFSGRKVYVQRKRKIKSKRIADVVEALIGAYLSTGGEKAAMQFLNRIGIEVNFD  1041

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
               P    F ++  +++NV  LES  LL YTF D SLL+EA+THGSY +P   + YQRLEF
Sbjct  1042  FVPYERPFRVDVHKLINVGHLES--LLKYTFNDRSLLLEAMTHGSYMLPEIPRCYQRLEF  1099

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGD+VLDYA+T H Y++YPG+ P  LT++RS SV+N CY+ +++KA LH  ILH S  L 
Sbjct  1100  LGDSVLDYAITVHLYNKYPGMTPELLTDMRSASVSNDCYSRTALKAQLHKSILHCSHDLH  1159

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I+  V+N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   +IVF  IRP+
Sbjct  1160  KHISSAVQNFETLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEIVFRSIRPL  1219

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEP+V+PE+L+ +P +EL ELCQK  Y++K+ V    +G +  T+EV  NG +   +  +
Sbjct  1220  LEPLVSPETLKKHPRRELNELCQKENYKLKKTVTSRVNGRSYVTVEVEVNGRIFKHTEIS  1279

Query  269   RNRKTAKRLA  240
              +R+T +++A
Sbjct  1280  LDRETGEKVA  1289



>ref|XP_011660217.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
sativus]
Length=1346

 Score =   300 bits (768),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 217/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             +L +E + +  K+Y + +RK+ ++ IADV EALIGA+LST GE AA+ FL  +G++++F 
Sbjct  1022  QLREEVLFSGRKVYVQRKRKIKSKRIADVVEALIGAYLSTGGEKAAMQFLNRIGIEVNFD  1081

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
               P    F ++  +++NV  LES  LL YTF D SLL+EA+THGSY +P   + YQRLEF
Sbjct  1082  FVPYERPFRVDVHKLINVGHLES--LLKYTFNDRSLLLEAMTHGSYMLPEIPRCYQRLEF  1139

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGD+VLDYA+T H Y++YPG+ P  LT++RS SV+N CY+ +++KA LH  ILH S  L 
Sbjct  1140  LGDSVLDYAITVHLYNKYPGMTPELLTDMRSASVSNDCYSRTALKAQLHKSILHCSHDLH  1199

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I+  V+N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   +IVF  IRP+
Sbjct  1200  KHISSAVQNFETLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEIVFRSIRPL  1259

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEP+V+PE+L+ +P +EL ELCQK  Y++K+ V    +G +  T+EV  NG +   +  +
Sbjct  1260  LEPLVSPETLKKHPRRELNELCQKENYKLKKTVTSRVNGRSYVTVEVEVNGRIFKHTEIS  1319

Query  269   RNRKTAKRLA  240
              +R+T +++A
Sbjct  1320  LDRETGEKVA  1329



>ref|XP_004139098.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
sativus]
 ref|XP_011660214.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
sativus]
 ref|XP_011660215.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
sativus]
 gb|KGN66658.1| hypothetical protein Csa_1G654870 [Cucumis sativus]
Length=1393

 Score =   300 bits (768),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 217/310 (70%), Gaps = 3/310 (1%)
 Frame = -3

Query  1166  ELDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI  987
             +L +E + +  K+Y + +RK+ ++ IADV EALIGA+LST GE AA+ FL  +G++++F 
Sbjct  1069  QLREEVLFSGRKVYVQRKRKIKSKRIADVVEALIGAYLSTGGEKAAMQFLNRIGIEVNFD  1128

Query  986   DAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEF  810
               P    F ++  +++NV  LES  LL YTF D SLL+EA+THGSY +P   + YQRLEF
Sbjct  1129  FVPYERPFRVDVHKLINVGHLES--LLKYTFNDRSLLLEAMTHGSYMLPEIPRCYQRLEF  1186

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGD+VLDYA+T H Y++YPG+ P  LT++RS SV+N CY+ +++KA LH  ILH S  L 
Sbjct  1187  LGDSVLDYAITVHLYNKYPGMTPELLTDMRSASVSNDCYSRTALKAQLHKSILHCSHDLH  1246

Query  629   SSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
               I+  V+N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   +IVF  IRP+
Sbjct  1247  KHISSAVQNFETLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEIVFRSIRPL  1306

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSA  270
             LEP+V+PE+L+ +P +EL ELCQK  Y++K+ V    +G +  T+EV  NG +   +  +
Sbjct  1307  LEPLVSPETLKKHPRRELNELCQKENYKLKKTVTSRVNGRSYVTVEVEVNGRIFKHTEIS  1366

Query  269   RNRKTAKRLA  240
              +R+T +++A
Sbjct  1367  LDRETGEKVA  1376



>ref|XP_009348590.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=775

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/309 (50%), Positives = 210/309 (68%), Gaps = 7/309 (2%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +     +Y  G RK+D E + DV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  460   LNEELLFNKRSIYVGGTRKIDTEVVGDVVEALIGAFLSTGGELDAIYFMNWVGIEVDLDH  519

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  804
                  +  +  E++++V  LES  LL+Y F DPSLLVEAL+HGSY+P G   YQRLEFLG
Sbjct  520   IRYERHLQVQPEKLIDVGHLES--LLDYKFCDPSLLVEALSHGSYMPGG---YQRLEFLG  574

Query  803   DAVLDYAVTRHFYDQYPGLF-PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             DAVLDY +T +FY  YPG+  P  LT++RS SVNN CYA S+VKAGLH +IL S    R+
Sbjct  575   DAVLDYMITDYFYHTYPGMMSPRFLTDMRSASVNNDCYARSAVKAGLHEHILASDIVHRN  634

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              I   V N    S  STFG+  +TSF  VLADI+E++AGAI++DSG    IVF+ IR +L
Sbjct  635   -IDSTVNNFGLLSTESTFGFESETSFTNVLADIVEALAGAIFIDSGYDKQIVFQSIRRLL  693

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
             EP+V+PE+LRL+P ++  + CQK+ Y +++ V   ++GEA  TIEV A G      S+A 
Sbjct  694   EPLVSPETLRLHPGRDFNDYCQKKHYNVQKLVECLQNGEAMVTIEVEAEGVTYKHKSTAS  753

Query  266   NRKTAKRLA  240
             N+ TA++LA
Sbjct  754   NKITARKLA  762



>ref|XP_002884369.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60628.1| hypothetical protein ARALYDRAFT_317213 [Arabidopsis lyrata subsp. 
lyrata]
Length=2033

 Score =   302 bits (773),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/301 (51%), Positives = 208/301 (69%), Gaps = 8/301 (3%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE++AL F+ W+G+ +DF    I    P
Sbjct  1726  SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELSALMFMNWVGIKVDFTTTKIERESP  1785

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct  1786  IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL  1843

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP L PG LT++RS SVNN CYAL +VK  LH +ILH+S  L   I+  V  
Sbjct  1844  ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKENLHKHILHASHVLHKHISRTVSE  1903

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1904  FEQSSLQSTFGWECDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1963

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     KD     T+EV A     + ++ A ++K AK+L
Sbjct  1964  VKLHPVRELTELCQKSQFELSKA----KDFNY-FTVEVKAKEMSFAHTAKASDKKMAKKL  2018

Query  242   A  240
             A
Sbjct  2019  A  2019



>ref|XP_007140643.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
 gb|ESW12637.1| hypothetical protein PHAVU_008G129500g [Phaseolus vulgaris]
Length=1420

 Score =   299 bits (765),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 207/288 (72%), Gaps = 3/288 (1%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E +    K+Y  G+RK+  + IADV EALIGAFLS+ GE AAL F+  +G+ ++F   P
Sbjct  1102  EEFISKGKKIYISGQRKLKRKLIADVVEALIGAFLSSGGEKAALLFMDCVGIKVNFNKIP  1161

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E++++V  LES   LNY+F D +LLVEALTHGSY +P   + YQRLE+LGD
Sbjct  1162  YERHFDIQPEKLIHVTFLESQ--LNYSFHDRTLLVEALTHGSYMLPEVPRCYQRLEYLGD  1219

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +T H + +YPG+ PG LT++RS SVNN CYA S++K GLH ++LH+S  L   I
Sbjct  1220  SVLDYLITWHLFKKYPGMSPGQLTDMRSASVNNDCYAWSAIKHGLHKHVLHASQELHKHI  1279

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  + + ++ S+SSTFG+ L+TS P VL DIIES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1280  AISLDSFDKVSSSSTFGYELETSLPKVLGDIIESLAGAILVDSGYNKEVVWQSIRPLLEP  1339

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANG  297
             +VTPE+L+L+P++EL ELCQKR Y + + +V  KDG     +EV A+G
Sbjct  1340  LVTPETLKLHPIRELNELCQKRSYNIIQDIVTRKDGVTNYRMEVEADG  1387



>ref|XP_007147469.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 ref|XP_007147470.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19463.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
 gb|ESW19464.1| hypothetical protein PHAVU_006G127200g [Phaseolus vulgaris]
Length=1388

 Score =   298 bits (762),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 218/314 (69%), Gaps = 8/314 (3%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP  978
             +E V    K+Y  G RK++ + IADV EALIGAFLS+ GE AAL F+ W+G+ + F   P
Sbjct  1068  KELVSGEKKIYVIGERKLNRKIIADVVEALIGAFLSSGGEKAALLFMDWVGIKMSFNKIP  1127

Query  977   IVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGD  801
                +F +  E++V+V  LES   L Y+F D +LLVEALTHGSY +P   + YQRLEFLGD
Sbjct  1128  YKRHFDIQPEKLVHVSHLESQ--LKYSFHDRTLLVEALTHGSYMLPEIPRCYQRLEFLGD  1185

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLDY +TRH Y++YPG+ PG LT++RS SVNN CYA S++  GLH ++LH+S  L   I
Sbjct  1186  SVLDYLITRHLYNEYPGMSPGQLTDMRSASVNNDCYAWSAINHGLHKHVLHASQELHKHI  1245

Query  620   ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP  441
             A  + N ++ S+SSTFG+  +TS P VL DIIES+AGAI +DSG   ++V++ IRP+LEP
Sbjct  1246  AITLANFDKLSSSSTFGFGSETSLPKVLGDIIESLAGAILVDSGFNIEVVWQSIRPLLEP  1305

Query  440   MVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRS---CSSSA  270
             +VTPE+L+L+PV+EL ELCQKR Y + +  V   DG     +EV A+G +     C SS 
Sbjct  1306  LVTPETLKLHPVRELNELCQKRSYNIVQETVSRTDGVTRYKMEVEADGVIHQYEYCGSSL  1365

Query  269   RNRKTAKRLACERM  228
             ++  TAK++ C+ +
Sbjct  1366  KD--TAKKIVCKEI  1377



>ref|XP_010485668.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010485669.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Camelina 
sativa]
Length=1395

 Score =   298 bits (762),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 209/305 (69%), Gaps = 4/305 (1%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1083  SRNIYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGIKIDFTTTKIERESL  1142

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1143  IQAEKLVNVDYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1200

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP + PG LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V  
Sbjct  1201  ITKHLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTVSE  1260

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              E+SS  STFGW    SFP VL D+IES+AGAI++DSG    +VF  I+P+L  M+TPE+
Sbjct  1261  FERSSLQSTFGWESDVSFPKVLGDVIESLAGAIFVDSGYNKGVVFASIKPLLGCMITPET  1320

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     K+GEA  T+EV A     + ++ A ++K AK+L
Sbjct  1321  VKLHPVRELTELCQKAQFELSKAKGF-KNGEAYFTVEVKAKEMSFAHTAEASDKKMAKKL  1379

Query  242   ACERM  228
             A +++
Sbjct  1380  AYKQV  1384



>ref|XP_010485670.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X3 [Camelina 
sativa]
Length=1354

 Score =   297 bits (761),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 209/305 (69%), Gaps = 4/305 (1%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1042  SRNIYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGIKIDFTTTKIERESL  1101

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1102  IQAEKLVNVDYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1159

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP + PG LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V  
Sbjct  1160  ITKHLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTVSE  1219

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              E+SS  STFGW    SFP VL D+IES+AGAI++DSG    +VF  I+P+L  M+TPE+
Sbjct  1220  FERSSLQSTFGWESDVSFPKVLGDVIESLAGAIFVDSGYNKGVVFASIKPLLGCMITPET  1279

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     K+GEA  T+EV A     + ++ A ++K AK+L
Sbjct  1280  VKLHPVRELTELCQKAQFELSKAKGF-KNGEAYFTVEVKAKEMSFAHTAEASDKKMAKKL  1338

Query  242   ACERM  228
             A +++
Sbjct  1339  AYKQV  1343



>ref|XP_010485666.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010485667.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X1 [Camelina 
sativa]
Length=1398

 Score =   298 bits (762),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 209/305 (69%), Gaps = 4/305 (1%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1086  SRNIYVTSRRNLKRKSVADVVESLIGAYLSEGGELAALLFMNWVGIKIDFTTTKIERESL  1145

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LL Y F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1146  IQAEKLVNVDYMES--LLKYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1203

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H YD+YP + PG LT++RS SVNN CYA  +VKA L  +ILH+S  L   I+  V  
Sbjct  1204  ITKHLYDKYPCMTPGLLTDMRSASVNNECYAQVAVKANLDKHILHASHDLHKHISRTVSE  1263

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              E+SS  STFGW    SFP VL D+IES+AGAI++DSG    +VF  I+P+L  M+TPE+
Sbjct  1264  FERSSLQSTFGWESDVSFPKVLGDVIESLAGAIFVDSGYNKGVVFASIKPLLGCMITPET  1323

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK ++ + +     K+GEA  T+EV A     + ++ A ++K AK+L
Sbjct  1324  VKLHPVRELTELCQKAQFELSKAKGF-KNGEAYFTVEVKAKEMSFAHTAEASDKKMAKKL  1382

Query  242   ACERM  228
             A +++
Sbjct  1383  AYKQV  1387



>emb|CDO96787.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 204/293 (70%), Gaps = 22/293 (8%)
 Frame = -3

Query  1100  NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRLE  921
             ++T+ADV EALIG F+ T  E AAL+F++W+G ++DFI  P     P N E++V++K  +
Sbjct  51    SKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFIYVPYKRPVPANPEKLVDLKFFK  110

Query  920   SDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL  747
                LLN Y+FRD SLLVEALTHGSY+ P    SY+RL+FLGDAVL+Y +T HFY+++P L
Sbjct  111   K--LLNQYSFRDASLLVEALTHGSYVRPERPTSYKRLKFLGDAVLEYLITMHFYNKHPNL  168

Query  746   FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW  567
               G LT+LRS SVNN  YA +++K GLH +ILH S  L+  I   VKN +QSS  STFGW
Sbjct  169   SSGLLTDLRSASVNNDRYARTAIKTGLHKHILHDSQDLQRRILAIVKNFKQSSQDSTFGW  228

Query  566   ----VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE  399
                 V+K     ++ADII+S+AGAIY+DSG   ++VF  I+P+LEP+ TPE+L+L PV+E
Sbjct  229   GSGPVIK-----LVADIIKSLAGAIYVDSGYDKEVVFRSIKPLLEPLPTPETLKLQPVRE  283

Query  398   LTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             L ELC K  + +KE     +DG+    ++V ANG + +   SA N+KTA++ A
Sbjct  284   LEELCAKEHFDLKE-----EDGK----LKVNANGVIYARRLSAANKKTARKTA  327



>ref|NP_001131630.1| uncharacterized protein LOC100192986 [Zea mays]
 gb|ACF80129.1| unknown [Zea mays]
Length=365

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 196/295 (66%), Gaps = 4/295 (1%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  942
             R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  50    RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  109

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  110   INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  167

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
              QYP   P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +
Sbjct  168   HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFS  227

Query  584   SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV  405
               + GW    S P VL D++ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PV
Sbjct  228   GPSHGWEAGISLPKVLGDVVESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPV  287

Query  404   KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             KEL E C  + Y + E  V   +G +    EV   G     + +  ++  AK+LA
Sbjct  288   KELQEFCDSKGYTL-EYTVTRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  341



>emb|CDP06207.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   288 bits (738),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 218/319 (68%), Gaps = 23/319 (7%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +  S  +Y R +R ++ +T+ADV EALIG FL +  EIAAL+F+ WLG+++D I 
Sbjct  432   LEKEQLSPSRTIYDRKKRMIEMKTVADVIEALIGVFLCSTSEIAALAFMEWLGIEVDSIY  491

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  810
              P +   P N  ++V+++  E+  LLN Y+F D SLLVEALTHGSY  P   + Y+RLEF
Sbjct  492   VPYIRPLPANPGEVVDLRFFET--LLNQYSFHDASLLVEALTHGSYKRPENPRCYKRLEF  549

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL-HSSTAL  633
             LGDAVLDY +T H ++++P L    LT+LRS SVNN CYA +++KAGLH +IL H S  L
Sbjct  550   LGDAVLDYLITMHLHNEHPNLSSRLLTDLRSASVNNDCYARAAIKAGLHQHILLHDSQHL  609

Query  632   RSSIADFVKNIEQSSASSTFGW----VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFE  465
             +  I   VKN +QSS  ST GW    V+K     +LADIIES+AGAIY+DSG   ++VF+
Sbjct  610   KPRILAIVKNFKQSSQDSTSGWESEPVIK-----ILADIIESLAGAIYVDSGYDKEVVFQ  664

Query  464   KIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRS  285
              I+P+LEP+VTPE+L+L P +EL ELC+K  +  KE     +DG+    +EV ANG +  
Sbjct  665   SIKPLLEPLVTPETLKLQPGRELKELCEKENFVKKE-----EDGK----LEVNANGAIYV  715

Query  284   CSSSARNRKTAKRLACERM  228
             C  +A N+KTA+++A  R+
Sbjct  716   CGLTAANKKTAEKIASMRI  734



>ref|XP_006408318.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
 gb|ESQ49771.1| hypothetical protein EUTSA_v10019898mg [Eutrema salsugineum]
Length=1390

 Score =   295 bits (756),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 207/301 (69%), Gaps = 4/301 (1%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ IDF    I     
Sbjct  1079  SRNIYIARRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKIDFTTTMIQRESS  1138

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  + ++SLLNY F D SLLVEALTHGSY IP   + YQRLEFLGDAVLDY 
Sbjct  1139  IQAEKLVNV--VYTESLLNYKFEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDAVLDYL  1196

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H Y +YP L PG LT++RS SVNN CYA  +VK+ LH +ILH+S  L   I   V  
Sbjct  1197  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHILHASHDLHKHIFRTVSE  1256

Query  602   IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
              E+SS  STFGW    +FP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct  1257  FERSSLQSTFGWESDIAFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET  1316

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             ++L+PV+ELTELCQK +  + +     ++G+A  T+EV A     S ++ A ++K AK+L
Sbjct  1317  VKLHPVRELTELCQKSQLELSKAKGF-ENGKAFFTVEVKAKEMSFSHTAKASDKKMAKKL  1375

Query  242   A  240
             A
Sbjct  1376  A  1376



>emb|CDY43132.1| BnaA05g32540D [Brassica napus]
Length=1388

 Score =   293 bits (750),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 211/302 (70%), Gaps = 5/302 (2%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   R  +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1076  SRNMYIARRMNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1135

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV+ +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1136  IQAEKLVNVRYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1193

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H Y +YP L PG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V  
Sbjct  1194  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSE  1253

Query  602   IEQ-SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
              E+ SS  S+FGW  + +FP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE
Sbjct  1254  FERLSSVQSSFGWESEIAFPKVLGDVIESLAGAIHVDSGYNKEVVFASIKPLLGCMITPE  1313

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKR  246
             +++L+PV+ELTELCQK ++ + +     ++GEA  T+EV A     + ++ A ++K AK+
Sbjct  1314  TVKLHPVRELTELCQKAQFELSKAKGF-ENGEAFFTVEVEAKEMSFAHTARASDKKMAKK  1372

Query  245   LA  240
             LA
Sbjct  1373  LA  1374



>ref|XP_009130358.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
 ref|XP_009130359.1| PREDICTED: endoribonuclease Dicer homolog 2 [Brassica rapa]
Length=1388

 Score =   293 bits (750),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 211/302 (70%), Gaps = 5/302 (2%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   R  +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1076  SRNMYIARRMNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1135

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV+ +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1136  IQAEKLVNVRYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1193

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H Y +YP L PG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V  
Sbjct  1194  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSE  1253

Query  602   IEQ-SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
              E+ SS  S+FGW  + +FP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE
Sbjct  1254  FERLSSVQSSFGWESEIAFPKVLGDVIESLAGAIHVDSGYNKEVVFASIKPLLGCMITPE  1313

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKR  246
             +++L+PV+ELTELCQK ++ + +     ++GEA  T+EV A     + ++ A ++K AK+
Sbjct  1314  TVKLHPVRELTELCQKAQFELSKAKGF-ENGEAFFTVEVEAKEMSFAHTARASDKKMAKK  1372

Query  245   LA  240
             LA
Sbjct  1373  LA  1374



>emb|CDY50692.1| BnaC05g47910D [Brassica napus]
Length=1389

 Score =   293 bits (750),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/302 (50%), Positives = 211/302 (70%), Gaps = 5/302 (2%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   RR +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1077  SRSMYIARRRNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1136

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV  +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1137  IQAEKLVNVSYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1194

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H Y +YP L PG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V  
Sbjct  1195  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSE  1254

Query  602   IEQ-SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
              E+ SS  S+FGW  + +FP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE
Sbjct  1255  FERLSSVQSSFGWESEIAFPKVLGDLIESLAGAIHVDSGYDKEVVFACIKPLLGCMITPE  1314

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKR  246
             +++L+PV+ELTELCQK ++ + +     ++GEA  T+EV A     + ++ A ++K AK+
Sbjct  1315  TVKLHPVRELTELCQKAQFELTKAKGF-ENGEAYFTVEVEAKEMSFAHTAKASDKKMAKK  1373

Query  245   LA  240
             LA
Sbjct  1374  LA  1375



>gb|ACE60552.1| dicer-like protein 2 [Brassica rapa]
Length=1392

 Score =   291 bits (744),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 211/302 (70%), Gaps = 5/302 (2%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP  960
             S  +Y   R  +  +++ADV EALIGA+LS  GE+AAL+F+ W+G+ +DF    I     
Sbjct  1080  SRNMYIARRMNLKRKSVADVVEALIGAYLSEGGELAALTFMNWVGIKVDFTTTMIQREPS  1139

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYA  783
             + AE++VNV+ +ES  LLNY F+D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY 
Sbjct  1140  IQAEKLVNVRYMES--LLNYKFKDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYL  1197

Query  782   VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN  603
             +T+H Y +YP L PG LT++RS SVNN CYA  +VK+ LH ++LH+S  L   I+  V  
Sbjct  1198  ITKHLYGEYPNLSPGLLTDMRSASVNNECYAQVAVKSNLHKHVLHASHDLHKHISRTVSE  1257

Query  602   IEQ-SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
              E+ SS  S+FGW  + +FP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE
Sbjct  1258  FERLSSVQSSFGWESEIAFPKVLGDVIESLAGAIHVDSGYNKEVVFACIKPLLGCMITPE  1317

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKR  246
             +++L+PV+ELTELCQK ++ + + V   ++GEA   +EV A     + ++ A ++K AK+
Sbjct  1318  TVKLHPVRELTELCQKAQFELSK-VKGFENGEAFFPVEVEAKEMSFAHTARAFDKKMAKK  1376

Query  245   LA  240
             LA
Sbjct  1377  LA  1378



>ref|XP_008443675.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Cucumis 
melo]
Length=1346

 Score =   289 bits (740),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 217/308 (70%), Gaps = 4/308 (1%)
 Frame = -3

Query  1157  QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  981
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL  +G++++F   
Sbjct  1024  REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLNRIGIELNFDFV  1083

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  804
             P    F ++A +++NV  +ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1084  PYERPFRVDAHKLINVGHVES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1141

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             D+VLDYA+T H Y++YPG+ P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1142  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1201

Query  623   IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE  444
             I+  + N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   + VF  IRP+LE
Sbjct  1202  ISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEKVFGCIRPLLE  1261

Query  443   PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN  264
             P+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV  NG +   ++ + +
Sbjct  1262  PLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEVEVNGRIFKHTAISLD  1321

Query  263   RKTAKRLA  240
             R+T K++A
Sbjct  1322  RETGKKVA  1329



>ref|XP_008443676.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
 ref|XP_008443677.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X4 [Cucumis 
melo]
Length=1306

 Score =   289 bits (739),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 217/308 (70%), Gaps = 4/308 (1%)
 Frame = -3

Query  1157  QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  981
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL  +G++++F   
Sbjct  984   REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLNRIGIELNFDFV  1043

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  804
             P    F ++A +++NV  +ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1044  PYERPFRVDAHKLINVGHVES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1101

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             D+VLDYA+T H Y++YPG+ P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1102  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1161

Query  623   IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE  444
             I+  + N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   + VF  IRP+LE
Sbjct  1162  ISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEKVFGCIRPLLE  1221

Query  443   PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN  264
             P+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV  NG +   ++ + +
Sbjct  1222  PLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEVEVNGRIFKHTAISLD  1281

Query  263   RKTAKRLA  240
             R+T K++A
Sbjct  1282  RETGKKVA  1289



>ref|XP_008443670.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443671.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
 ref|XP_008443672.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Cucumis 
melo]
Length=1393

 Score =   289 bits (740),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 217/308 (70%), Gaps = 4/308 (1%)
 Frame = -3

Query  1157  QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  981
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL  +G++++F   
Sbjct  1071  REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFLNRIGIELNFDFV  1130

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  804
             P    F ++A +++NV  +ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1131  PYERPFRVDAHKLINVGHVES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1188

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             D+VLDYA+T H Y++YPG+ P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1189  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1248

Query  623   IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE  444
             I+  + N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   + VF  IRP+LE
Sbjct  1249  ISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEKVFGCIRPLLE  1308

Query  443   PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN  264
             P+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV  NG +   ++ + +
Sbjct  1309  PLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEVEVNGRIFKHTAISLD  1368

Query  263   RKTAKRLA  240
             R+T K++A
Sbjct  1369  RETGKKVA  1376



>ref|XP_010508928.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X3 [Camelina 
sativa]
Length=1355

 Score =   288 bits (738),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 198/284 (70%), Gaps = 4/284 (1%)
 Frame = -3

Query  1076  EALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRLESDSLLNYT  897
             E+LIGA+LS  GE+AAL F+ W+G+ IDF    +    P+ AE++VNV  +ES  LL Y 
Sbjct  1064  ESLIGAYLSEGGELAALLFMNWVGITIDFTTTKMERESPIQAEKLVNVGYMES--LLKYK  1121

Query  896   FRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELR  720
             F D SLLVEALTHGSY IP   + YQRLEFLGD+VLDY +T+H YD+YP + PG LT++R
Sbjct  1122  FEDKSLLVEALTHGSYMIPEIPRCYQRLEFLGDSVLDYLITKHLYDKYPCMTPGLLTDMR  1181

Query  719   SESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWV  540
             S SVNN CYA  +VKA LH +ILH+S  L   I+  V   E+SS  STFGW    SFP V
Sbjct  1182  SASVNNECYAQVAVKANLHKHILHASHDLHKHISRTVSEFERSSLQSTFGWESDVSFPKV  1241

Query  539   LADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMK  360
             L D+IES+AGAI++DSG    +VF  I+P+L  M+TPE+++L+PV+ELTELCQK ++ + 
Sbjct  1242  LGDVIESLAGAIFVDSGYNKSVVFASIKPLLGCMITPETVKLHPVRELTELCQKAQFELS  1301

Query  359   EPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM  228
                   K+GEA  T+EV A     + +S A ++K AK++A +++
Sbjct  1302  TAKGF-KNGEAYFTVEVKAKEMSFAHTSKASDKKLAKKMAYKQV  1344



>ref|XP_011623569.1| PREDICTED: endoribonuclease Dicer homolog 2 [Amborella trichopoda]
Length=1378

 Score =   288 bits (738),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 200/298 (67%), Gaps = 6/298 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN  966
             L+S K Y +G++K   + +ADV EALIGAFLST GE AAL F+ W+G+ +D    P++  
Sbjct  1062  LSSKKTYVKGQKKFKAKVVADVVEALIGAFLSTNGEQAALLFMDWMGIKVDIFKDPLIER  1121

Query  965   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT-QSYQRLEFLGDAVL  792
                L  E+ VNV  +E+  LL Y F D SLLVEALTHGSY    T  SYQRLEFLGD+VL
Sbjct  1122  PHLLQPERFVNVSLIET--LLKYKFHDCSLLVEALTHGSYQVEDTLASYQRLEFLGDSVL  1179

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             DY +T+HFY+ YP + P  LT+LRS SVNN CYA  +VKAGLH +IL++S+ L S IA  
Sbjct  1180  DYLLTKHFYNMYPRISPQLLTDLRSASVNNYCYAHVAVKAGLHKHILYASSELHSQIASS  1239

Query  611   VKNIEQSSAS-STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV  435
             +K I+  S S S FGW   T FP VL D+IESIAGAI +DSG   ++V+  IRP+LEP+V
Sbjct  1240  IKCIKDLSLSASMFGWEADTEFPKVLGDVIESIAGAILVDSGFNKEVVWRSIRPILEPLV  1299

Query  434   TPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             T E++++ PV+EL ELC KR Y+ KE      DG    T  V  +G   S + SARNR
Sbjct  1300  TLETVKIEPVRELEELCSKRSYK-KEKSFSVADGLTYATFTVKVDGVSYSNTCSARNR  1356



>gb|ERN06445.1| hypothetical protein AMTR_s00016p00258500 [Amborella trichopoda]
Length=1424

 Score =   288 bits (738),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 200/298 (67%), Gaps = 6/298 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN  966
             L+S K Y +G++K   + +ADV EALIGAFLST GE AAL F+ W+G+ +D    P++  
Sbjct  1106  LSSKKTYVKGQKKFKAKVVADVVEALIGAFLSTNGEQAALLFMDWMGIKVDIFKDPLIER  1165

Query  965   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT-QSYQRLEFLGDAVL  792
                L  E+ VNV  +E+  LL Y F D SLLVEALTHGSY    T  SYQRLEFLGD+VL
Sbjct  1166  PHLLQPERFVNVSLIET--LLKYKFHDCSLLVEALTHGSYQVEDTLASYQRLEFLGDSVL  1223

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             DY +T+HFY+ YP + P  LT+LRS SVNN CYA  +VKAGLH +IL++S+ L S IA  
Sbjct  1224  DYLLTKHFYNMYPRISPQLLTDLRSASVNNYCYAHVAVKAGLHKHILYASSELHSQIASS  1283

Query  611   VKNIEQSSAS-STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV  435
             +K I+  S S S FGW   T FP VL D+IESIAGAI +DSG   ++V+  IRP+LEP+V
Sbjct  1284  IKCIKDLSLSASMFGWEADTEFPKVLGDVIESIAGAILVDSGFNKEVVWRSIRPILEPLV  1343

Query  434   TPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR  261
             T E++++ PV+EL ELC KR Y+ KE      DG    T  V  +G   S + SARNR
Sbjct  1344  TLETVKIEPVRELEELCSKRSYK-KEKSFSVADGLTYATFTVKVDGVSYSNTCSARNR  1400



>emb|CDO96788.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   279 bits (713),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 213/314 (68%), Gaps = 18/314 (6%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E + T   +Y+R +R + N+T+ADV EALIG F+ T  E AAL+F++W+G ++DF+ 
Sbjct  414   LRKEVLSTRIIVYAREKRTIKNKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFVY  473

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  810
                      N E++V+++  +S  LLN Y+FRD SLLVEALTHGSY+ P    SY+ LEF
Sbjct  474   VQYKRPVAANPEKLVDLRFFKS--LLNQYSFRDASLLVEALTHGSYVRPESPTSYEHLEF  531

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T+HF++++P L  G LT+LRS SVNN C A ++++AGLH +ILH S  L+
Sbjct  532   LGDAVLDYLITKHFHNEHPNLSSGLLTDLRSASVNNDCCARTAIRAGLHKHILHDSQDLQ  591

Query  629   SSIADFVKNIEQSSASSTFGW----VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
               I    +N EQSS  STFGW    V+K     +LADII+S+AGAIY+DSG    +VF+ 
Sbjct  592   RRILAIAENFEQSSRDSTFGWESEPVIK-----ILADIIKSLAGAIYVDSGYDKGVVFQS  646

Query  461   IRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSC  282
             I+P+LEP+ TPE+L+L PV+EL E C K+ + M +  V +++GE    +   ANG   + 
Sbjct  647   IKPLLEPLPTPETLKLQPVRELEEFCAKQHFDMNKS-VTYENGE----VSANANGVPCAR  701

Query  281   SSSARNRKTAKRLA  240
               +A N+KTA++ A
Sbjct  702   RLTAANKKTARKTA  715



>ref|XP_010549776.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Tarenaya 
hassleriana]
Length=1350

 Score =   285 bits (730),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 211/309 (68%), Gaps = 4/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L ++ +  S  +Y   +R +  +++AD  EALIGA+L   GE+ A+ F+ W+G++++F +
Sbjct  1028  LTEDSLSDSRNIYVVRKRNVKRKSVADAVEALIGAYLCEGGEVQAVMFMDWVGINVNFAN  1087

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P       +AE+++NV  +ES  LLNY F+D SLLVEALTHGSY +P   + YQRLEFL
Sbjct  1088  VPYQRELLPSAEKLLNVFYIES--LLNYKFQDRSLLVEALTHGSYMLPEIPRCYQRLEFL  1145

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T++ YD+YP L PG LT++RS SVNN  YA +++KA LH +ILH+S  L  
Sbjct  1146  GDSVLDYVITKYLYDKYPFLSPGLLTDMRSASVNNDHYARAAMKAKLHKHILHASHDLHK  1205

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              +   V   E   + STFGW  +TSFP VL D+IES+AGAI +DSG  T+ VF  I+P+L
Sbjct  1206  HMTRTVDEFEHLPSDSTFGWEAETSFPKVLGDVIESLAGAILVDSGYNTEAVFASIQPLL  1265

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
               MVTPE+L+++PV+ELTELCQK  + +K+     K+G+A  T+EV AN      +S A 
Sbjct  1266  GCMVTPETLKIHPVRELTELCQKEHFEIKKEKGF-KNGKAYFTVEVKANRETFVHTSKAP  1324

Query  266   NRKTAKRLA  240
             ++ TAKRLA
Sbjct  1325  HKDTAKRLA  1333



>ref|XP_010549772.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549773.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549775.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Tarenaya 
hassleriana]
Length=1395

 Score =   285 bits (730),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 211/309 (68%), Gaps = 4/309 (1%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L ++ +  S  +Y   +R +  +++AD  EALIGA+L   GE+ A+ F+ W+G++++F +
Sbjct  1073  LTEDSLSDSRNIYVVRKRNVKRKSVADAVEALIGAYLCEGGEVQAVMFMDWVGINVNFAN  1132

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
              P       +AE+++NV  +ES  LLNY F+D SLLVEALTHGSY +P   + YQRLEFL
Sbjct  1133  VPYQRELLPSAEKLLNVFYIES--LLNYKFQDRSLLVEALTHGSYMLPEIPRCYQRLEFL  1190

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GD+VLDY +T++ YD+YP L PG LT++RS SVNN  YA +++KA LH +ILH+S  L  
Sbjct  1191  GDSVLDYVITKYLYDKYPFLSPGLLTDMRSASVNNDHYARAAMKAKLHKHILHASHDLHK  1250

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
              +   V   E   + STFGW  +TSFP VL D+IES+AGAI +DSG  T+ VF  I+P+L
Sbjct  1251  HMTRTVDEFEHLPSDSTFGWEAETSFPKVLGDVIESLAGAILVDSGYNTEAVFASIQPLL  1310

Query  446   EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR  267
               MVTPE+L+++PV+ELTELCQK  + +K+     K+G+A  T+EV AN      +S A 
Sbjct  1311  GCMVTPETLKIHPVRELTELCQKEHFEIKKEKGF-KNGKAYFTVEVKANRETFVHTSKAP  1369

Query  266   NRKTAKRLA  240
             ++ TAKRLA
Sbjct  1370  HKDTAKRLA  1378



>gb|AFW68290.1| hypothetical protein ZEAMMB73_539070 [Zea mays]
Length=707

 Score =   278 bits (710),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 196/295 (66%), Gaps = 4/295 (1%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  942
             R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  392   RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  451

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  452   INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  509

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
              QYP   P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +
Sbjct  510   HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFS  569

Query  584   SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV  405
               + GW    S P VL D++ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PV
Sbjct  570   GPSHGWEAGISLPKVLGDVVESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPV  629

Query  404   KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             KEL E C  + Y + E  V   +G +    EV   G     + +  ++  AK+LA
Sbjct  630   KELQEFCDSKGYTL-EYTVTRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  683



>emb|CDO96789.1| unnamed protein product [Coffea canephora]
Length=801

 Score =   277 bits (708),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/287 (50%), Positives = 198/287 (69%), Gaps = 13/287 (5%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L +E + T   +Y+R +R +  +T+ADV EALIG F+ T  E AAL+F++W+G ++DF+ 
Sbjct  446   LREEVLSTRTIVYAREKRMIKIKTVADVIEALIGVFICTTSERAALAFMKWMGFEVDFVY  505

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLN-YTFRDPSLLVEALTHGSYI-PHGTQSYQRLEF  810
                      N E++V+++  +S  LLN Y+FRD SLLVEALTHGSY+ P    SY+RLEF
Sbjct  506   VQYKRPVAANPEKLVDLRFFKS--LLNQYSFRDASLLVEALTHGSYVRPESPTSYKRLEF  563

Query  809   LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR  630
             LGDAVLDY +T H ++++P L  G LT+LRS SVNN CYA ++++AGLH +ILH S  L+
Sbjct  564   LGDAVLDYLITMHLHNEHPNLSSGLLTDLRSASVNNDCYARTAIRAGLHKHILHGSQDLQ  623

Query  629   SSIADFVKNIEQSSASSTFGW----VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
               I   V+N EQSS  STFGW    V+K     +LADIIES+AGAIY+DSG   ++VF  
Sbjct  624   RRILAIVENFEQSSQDSTFGWESEPVIK-----ILADIIESLAGAIYVDSGYDKEVVFRS  678

Query  461   IRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACT  321
             I+P+LEP+VTPE+L+L PV+EL ELC K ++ M + V       +C+
Sbjct  679   IKPLLEPLVTPETLKLQPVRELEELCAKEQFVMNKAVRYENACLSCS  725



>ref|XP_010088523.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
 gb|EXB36440.1| Endoribonuclease Dicer-2-like protein [Morus notabilis]
Length=1077

 Score =   277 bits (708),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 202/303 (67%), Gaps = 10/303 (3%)
 Frame = -3

Query  1130  LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNA  951
             +Y  GRR++  +T+ADV EALIGA L+T GE+ AL F+  +G+++DF   P   +  +++
Sbjct  764   VYISGRREVGYKTVADVVEALIGALLTTGGELPALKFMSLIGMEVDFNQVPYETHISMHS  823

Query  950   EQMVNVKR----LESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDY  786
             E++V +++    LES     Y+F DPSLLVEAL HGSY +    +SYQRLEFLGDAVLDY
Sbjct  824   EKLVRIRQNLSCLESKL---YSFHDPSLLVEALKHGSYKLQEIPRSYQRLEFLGDAVLDY  880

Query  785   AVTRHFYDQYPG-LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  609
              +++H YD++P  + PG LT++RS SVNN CYA  +VKAGLH +IL  S  L ++I   V
Sbjct  881   LISKHLYDEHPDQMLPGLLTDMRSASVNNECYARCAVKAGLHEHILRDSRELDNNIVATV  940

Query  608   KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP  429
              N  + S+ S FGW  +T F  VLAD IES+AGAI++DSG   DIVF+ IRP+LEP VTP
Sbjct  941   NNFGKLSSESIFGWESETYFTEVLADFIESVAGAIFIDSGYNKDIVFQSIRPLLEPFVTP  1000

Query  428   ESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAK  249
             ++L+LNP +EL ELC K+ +   +     ++G   TT+EV ANG      S    +   +
Sbjct  1001  KTLKLNPTRELRELCTKKGFPTNQSKKC-ENGAYSTTVEVEANGSTFKGMSMVSGKDLRE  1059

Query  248   RLA  240
             R+A
Sbjct  1060  RIA  1062



>gb|ABK24820.1| unknown [Picea sitchensis]
Length=330

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 142/303 (47%), Positives = 193/303 (64%), Gaps = 8/303 (3%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAEQ  945
             +G R M  + +ADV EALIGA L T GE  ALSF++WLG+DID   + P           
Sbjct  19    KGYRMMKTKNVADVVEALIGACLETGGETVALSFVKWLGMDIDIPQEMPFTRKLDTGFVS  78

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYAVTRHF  768
              VNV+ LES  LL Y+FR  +L+VE++TH SY  P  +  YQRLEFLGDAVLDY +T +F
Sbjct  79    NVNVRYLES--LLKYSFRVHTLVVESVTHASYKEPSFSGCYQRLEFLGDAVLDYLITLYF  136

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             Y  YPGL PG LT+LRS +VNN CYA ++VK  LH  + H+S+ L + I +F K I  SS
Sbjct  137   YKTYPGLSPGLLTDLRSAAVNNDCYAQAAVKCNLHQQLRHASSELHNQITEFAKLISSSS  196

Query  587   ASST--FGW-VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
             AS    FGW   + + P VL D+IESIAGA+ +DS   T +V+  ++P+LEP+VTP++++
Sbjct  197   ASGDHFFGWTTTEVAVPKVLGDLIESIAGAVLVDSEFDTQLVWNAMKPLLEPLVTPKTIK  256

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
               PV+EL ELCQK  Y         ++G +   +EV   G     +  A N++TAK+LA 
Sbjct  257   YQPVRELQELCQKEFYTCCFD-DSQEEGTSTVKVEVRVKGDSYIETCEASNKRTAKKLAA  315

Query  236   ERM  228
             E++
Sbjct  316   EKV  318



>ref|XP_008681081.1| PREDICTED: uncharacterized protein LOC100192986 isoform X1 [Zea 
mays]
Length=1408

 Score =   276 bits (707),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 196/295 (66%), Gaps = 4/295 (1%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  942
             R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  1093  RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  1152

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  1153  INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  1210

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
              QYP   P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +
Sbjct  1211  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFS  1270

Query  584   SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV  405
               + GW    S P VL D++ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PV
Sbjct  1271  GPSHGWEAGISLPKVLGDVVESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPV  1330

Query  404   KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             KEL E C  + Y + E  V   +G +    EV   G     + +  ++  AK+LA
Sbjct  1331  KELQEFCDSKGYTL-EYTVTRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  1384



>ref|XP_008681082.1| PREDICTED: uncharacterized protein LOC100192986 isoform X2 [Zea 
mays]
Length=1401

 Score =   276 bits (707),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 196/295 (66%), Gaps = 4/295 (1%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  942
             R  RK+ ++ IAD  EALIGA+LSTAGE AA  FL+ LG+DI+F   PI     + AE+ 
Sbjct  1086  RSLRKLKSKRIADSVEALIGAYLSTAGEQAAYIFLKSLGMDIEFHKMPIERVITIKAEEF  1145

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             +NVK LE   LL+Y+F DPSLL+EALTHGSY I   T  YQRLEFLGDAVLD+  T +FY
Sbjct  1146  INVKSLEL--LLDYSFNDPSLLMEALTHGSYQIAGTTPCYQRLEFLGDAVLDHIFTDYFY  1203

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
              QYP   P  LT+LRS SVNN+CYA ++VKAGLH ++LHSS+AL   +AD++   EQS +
Sbjct  1204  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHVLHSSSALHKRMADYLDKFEQSFS  1263

Query  584   SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV  405
               + GW    S P VL D++ESIAGAIY+D+     +V+  ++ +LEP+VTP++L+ +PV
Sbjct  1264  GPSHGWEAGISLPKVLGDVVESIAGAIYIDAKHDKGVVWRSMKRILEPLVTPDTLQNDPV  1323

Query  404   KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             KEL E C  + Y + E  V   +G +    EV   G     + +  ++  AK+LA
Sbjct  1324  KELQEFCDSKGYTL-EYTVTRDNGVSSVVAEVRTEGTTYKATRTGFSKLDAKKLA  1377



>ref|XP_007147294.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
 gb|ESW19288.1| hypothetical protein PHAVU_006G111800g [Phaseolus vulgaris]
Length=754

 Score =   266 bits (681),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 208/317 (66%), Gaps = 8/317 (3%)
 Frame = -3

Query  1163  LDQECVLTSGK--LYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF  990
             L +E +++SG+  +Y   +R ++ + +ADV EALIGAF+ST  E AALSF+ W+G+D+D 
Sbjct  430   LLKEELVSSGRTSMYVGRKRNIEVKKVADVVEALIGAFISTKDEKAALSFINWIGIDVDT  489

Query  989   IDAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLE  813
                P   +   + E +V+VK LES   L Y F+DP LLVEALTH S    G  + Y+RLE
Sbjct  490   KIMPYERHLSTHPENLVDVKFLESQ--LKYKFKDPYLLVEALTHSSCKRSGISTCYERLE  547

Query  812   FLGDAVLDYAVTRHFYDQY--PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSST  639
             FLGDAVLD  +T HFY++Y      P  LT +RS SVNN CYALS++KA LH +IL    
Sbjct  548   FLGDAVLDNVMTMHFYEEYYNEKCSPEFLTTMRSISVNNECYALSAIKAELHKHIL-CDP  606

Query  638   ALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI  459
              +  +I + +K++E  S  STFGW L+T F  VL D+IESIAGAI++DSG + +IVF+ I
Sbjct  607   VVEKNIKETIKSVENLSLESTFGWELETYFCPVLGDVIESIAGAIFVDSGYKKEIVFKSI  666

Query  458   RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCS  279
             RP+LEP+VTPE+ R +P+  L ELCQK +Y+M+    V  +     TI+V AN      +
Sbjct  667   RPLLEPLVTPETARRHPISVLQELCQKNQYKMEVQSPVSDNDGTLVTIKVKANRITYQHT  726

Query  278   SSARNRKTAKRLACERM  228
             + A N+  A+++A + +
Sbjct  727   AKASNKDKARKVASKEL  743



>ref|XP_002464290.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
 gb|EER91288.1| hypothetical protein SORBIDRAFT_01g015670 [Sorghum bicolor]
Length=1385

 Score =   273 bits (697),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 142/295 (48%), Positives = 193/295 (65%), Gaps = 4/295 (1%)
 Frame = -3

Query  1121  RGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM  942
             R  RK+ ++ IAD  EALIGA+LS AGE AA  FL+ LG+DI+F   P+     +NAE  
Sbjct  1070  RSLRKLKSKRIADSVEALIGAYLSAAGEQAAYLFLKSLGMDIEFHKMPVERKITINAENF  1129

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFLGDAVLDYAVTRHFY  765
             +N++ LE   +L+Y F DPSLL+EALTHGSY   GT + YQRLEFLGDAVLD+  T +FY
Sbjct  1130  INLRSLEL--MLDYNFSDPSLLLEALTHGSYQIAGTTACYQRLEFLGDAVLDHIFTDYFY  1187

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
              QYP   P  LT+LRS SVNN+CYA ++VKAGLH +ILHSS+AL   +AD++   EQS +
Sbjct  1188  HQYPECTPELLTDLRSASVNNSCYAHAAVKAGLHKHILHSSSALHKKMADYLDKFEQSFS  1247

Query  584   SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV  405
               + GW      P VL D+IESIAGAIY+D+     +V+ K++ +LEP+ TP++L ++PV
Sbjct  1248  GPSHGWEAGICLPKVLGDVIESIAGAIYIDTKNDKKVVWRKMKRLLEPLATPDTLEIDPV  1307

Query  404   KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             KEL E C  +   +K   V  +D      +EV   G     + +   ++ AK+LA
Sbjct  1308  KELHEFCDPKTCSIKY-TVAREDRVTSVAVEVQTKGTTYKATRTGLTKRDAKKLA  1361



>ref|XP_010233062.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010233066.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X2 
[Brachypodium distachyon]
Length=1144

 Score =   270 bits (691),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 198/308 (64%), Gaps = 5/308 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L+S  +YS  +  + ++ IAD  EALIGA+LS AGE AA  F+  LG+DI F  + PI  
Sbjct  815   LSSNGMYSLRKISIKSKRIADTVEALIGAYLSAAGEQAAFLFINSLGMDIGFHSEIPIER  874

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVL  792
             N  +  E+ +N++ LE   +L Y F+DP LL+EALTHGSY I   T  YQRLEFLGDAVL
Sbjct  875   NIVIKPEEFINIRSLEI--ILGYNFKDPLLLIEALTHGSYQIAGPTACYQRLEFLGDAVL  932

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+ VT ++Y+ YP   P  LT+LRS SVNN CYA +SVKAGL+ +ILHSST L   +A +
Sbjct  933   DHLVTVYYYNTYPECTPALLTDLRSASVNNNCYAHASVKAGLNKHILHSSTELHRKMAYY  992

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++N  Q+    + GW      P VL D+IESIAGAIYLDS    ++V+  ++P+LEP+ T
Sbjct  993   LENFGQAFTGPSHGWEAGIGLPKVLGDVIESIAGAIYLDSKYDKEMVWRSMKPLLEPLAT  1052

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVKEL E C +R Y  +     H+ G +    EV   G + S + S R++  A
Sbjct  1053  PETVERDPVKELQEFCDRRSYS-RSYTKTHEGGVSSVVAEVQVEGTIYSATRSGRDKTVA  1111

Query  251   KRLACERM  228
             ++LA + +
Sbjct  1112  QKLAVKSL  1119



>ref|XP_010233057.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Brachypodium distachyon]
Length=1248

 Score =   270 bits (691),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 198/308 (64%), Gaps = 5/308 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L+S  +YS  +  + ++ IAD  EALIGA+LS AGE AA  F+  LG+DI F  + PI  
Sbjct  919   LSSNGMYSLRKISIKSKRIADTVEALIGAYLSAAGEQAAFLFINSLGMDIGFHSEIPIER  978

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLGDAVL  792
             N  +  E+ +N++ LE   +L Y F+DP LL+EALTHGSY I   T  YQRLEFLGDAVL
Sbjct  979   NIVIKPEEFINIRSLEI--ILGYNFKDPLLLIEALTHGSYQIAGPTACYQRLEFLGDAVL  1036

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+ VT ++Y+ YP   P  LT+LRS SVNN CYA +SVKAGL+ +ILHSST L   +A +
Sbjct  1037  DHLVTVYYYNTYPECTPALLTDLRSASVNNNCYAHASVKAGLNKHILHSSTELHRKMAYY  1096

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++N  Q+    + GW      P VL D+IESIAGAIYLDS    ++V+  ++P+LEP+ T
Sbjct  1097  LENFGQAFTGPSHGWEAGIGLPKVLGDVIESIAGAIYLDSKYDKEMVWRSMKPLLEPLAT  1156

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVKEL E C +R Y  +     H+ G +    EV   G + S + S R++  A
Sbjct  1157  PETVERDPVKELQEFCDRRSYS-RSYTKTHEGGVSSVVAEVQVEGTIYSATRSGRDKTVA  1215

Query  251   KRLACERM  228
             ++LA + +
Sbjct  1216  QKLAVKSL  1223



>ref|XP_003553782.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X1 [Glycine 
max]
Length=756

 Score =   265 bits (677),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 206/318 (65%), Gaps = 11/318 (3%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L Q+   +  ++Y R  R++D   IADV EALIGAF+ST  E AALSF+ W+G+++D   
Sbjct  429   LKQKLDSSRTRVYVRKTREIDLGIIADVVEALIGAFISTEDEKAALSFINWIGINVDTNI  488

Query  983   APIVGNFPLN---AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRL  816
              P      ++    E++V  K L+S   LNY+F+DP LLVEALTH S   P     Y+RL
Sbjct  489   MPYENERHISIIAPEELVKAKLLKSR--LNYSFKDPYLLVEALTHSSGKRPEIRTCYERL  546

Query  815   EFLGDAVLDYAVTRHFYDQYPG--LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  642
             EFLGDAVLDY +T HFY +Y          T +RS SVNN CYALS++KA L  +IL  S
Sbjct  547   EFLGDAVLDYVITMHFYKEYSNDKFSAEFFTNMRSISVNNECYALSAIKAKLDEHILCDS  606

Query  641   TALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
               ++++IA  ++ ++  S  STFGW L+T F  VLAD+IESIAGAI++DSG + ++VF+ 
Sbjct  607   -VVKNNIAQTMEGVKNLSLESTFGWELETYFCQVLADVIESIAGAIFVDSGYKKEVVFQS  665

Query  461   IRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSC  282
             I+P+LEP+VTPE+ R +P+ EL ELCQK+ Y+MK    V  +GE   TIEV  NG     
Sbjct  666   IKPLLEPLVTPETARRHPISELHELCQKKGYKMKVYPPVRVNGETSVTIEVKTNGITYKN  725

Query  281   SSSAR--NRKTAKRLACE  234
             +  A+  N  TA++LA +
Sbjct  726   NPPAKASNNDTARKLAAK  743



>ref|XP_006604892.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Glycine 
max]
Length=788

 Score =   265 bits (676),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 206/318 (65%), Gaps = 11/318 (3%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L Q+   +  ++Y R  R++D   IADV EALIGAF+ST  E AALSF+ W+G+++D   
Sbjct  429   LKQKLDSSRTRVYVRKTREIDLGIIADVVEALIGAFISTEDEKAALSFINWIGINVDTNI  488

Query  983   APIVGNFPLN---AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRL  816
              P      ++    E++V  K L+S   LNY+F+DP LLVEALTH S   P     Y+RL
Sbjct  489   MPYENERHISIIAPEELVKAKLLKSR--LNYSFKDPYLLVEALTHSSGKRPEIRTCYERL  546

Query  815   EFLGDAVLDYAVTRHFYDQYPG--LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  642
             EFLGDAVLDY +T HFY +Y          T +RS SVNN CYALS++KA L  +IL  S
Sbjct  547   EFLGDAVLDYVITMHFYKEYSNDKFSAEFFTNMRSISVNNECYALSAIKAKLDEHILCDS  606

Query  641   TALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
               ++++IA  ++ ++  S  STFGW L+T F  VLAD+IESIAGAI++DSG + ++VF+ 
Sbjct  607   -VVKNNIAQTMEGVKNLSLESTFGWELETYFCQVLADVIESIAGAIFVDSGYKKEVVFQS  665

Query  461   IRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSC  282
             I+P+LEP+VTPE+ R +P+ EL ELCQK+ Y+MK    V  +GE   TIEV  NG     
Sbjct  666   IKPLLEPLVTPETARRHPISELHELCQKKGYKMKVYPPVRVNGETSVTIEVKTNGITYKN  725

Query  281   SSSAR--NRKTAKRLACE  234
             +  A+  N  TA++LA +
Sbjct  726   NPPAKASNNDTARKLAAK  743



>gb|EMS67761.1| Endoribonuclease Dicer-like protein 2a [Triticum urartu]
Length=537

 Score =   258 bits (660),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (63%), Gaps = 5/308 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L+S  +++  +  + ++ IAD  EALIGA+L  AGE AA  FL+ LGLDI+F  + P+  
Sbjct  224   LSSNDMHTLRKMSVRSKRIADTVEALIGAYLGAAGEQAAFVFLKSLGLDIEFHSNIPLER  283

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                L +E+ +NV+ LE   +L Y F+D SLLVEALTHGSY   G T  YQRLEFLGDAVL
Sbjct  284   KIVLKSEKFINVRSLEM--ILGYEFKDTSLLVEALTHGSYQTAGATACYQRLEFLGDAVL  341

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             DY  T +FY+QYP   P  LT+LRS SVNN CYA ++ KAGL+ +ILHSS  L   +A +
Sbjct  342   DYLFTIYFYNQYPECTPELLTDLRSASVNNNCYAHAAAKAGLNKHILHSSLQLHGRMAYY  401

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
              +N +Q     + GW      P VL D+IES+AGAIYLDS    ++V++ ++ +LEP+ T
Sbjct  402   FENFKQPFTGPSHGWEAGIGLPKVLGDVIESLAGAIYLDSKYDKEVVWKSMKQLLEPLAT  461

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R Y        HKDG +    EV   G   + + +  ++  A
Sbjct  462   PETVERDPVKLLQEFCARRSYS-SSYTKAHKDGVSSVVAEVQVEGTTYTATETGPDKIVA  520

Query  251   KRLACERM  228
             K+LA + +
Sbjct  521   KKLAAKSL  528



>gb|KHN43108.1| Endoribonuclease Dicer like 2 [Glycine soja]
Length=836

 Score =   265 bits (676),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 206/318 (65%), Gaps = 11/318 (3%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L Q+   +  ++Y R  R++D   IADV EALIGAF+ST  E AALSF+ W+G+++D   
Sbjct  477   LKQKLDSSRTRVYVRKTREIDLGIIADVVEALIGAFISTEDEKAALSFINWIGINVDTNI  536

Query  983   APIVGNFPLN---AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGS-YIPHGTQSYQRL  816
              P      ++    E++V  K L+S   LNY+F+DP LLVEALTH S   P     Y+RL
Sbjct  537   MPYENERHISIIAPEELVKAKLLKSR--LNYSFKDPYLLVEALTHSSGKRPEIRTCYERL  594

Query  815   EFLGDAVLDYAVTRHFYDQYPG--LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  642
             EFLGDAVLDY +T HFY +Y          T +RS SVNN CYALS++KA L  +IL  S
Sbjct  595   EFLGDAVLDYVITMHFYKEYSNDKFSAEFFTNMRSISVNNECYALSAIKAKLDEHILCDS  654

Query  641   TALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
               ++++IA  ++ ++  S  STFGW L+T F  VLAD+IESIAGAI++DSG + ++VF+ 
Sbjct  655   -VVKNNIAQTMEGVKNLSLESTFGWELETYFCQVLADVIESIAGAIFVDSGYKKEVVFQS  713

Query  461   IRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSC  282
             I+P+LEP+VTPE+ R +P+ EL ELCQK+ Y+MK    V  +GE   TIEV  NG     
Sbjct  714   IKPLLEPLVTPETARRHPISELHELCQKKGYKMKVYPPVRVNGETSVTIEVKTNGITYKN  773

Query  281   SSSAR--NRKTAKRLACE  234
             +  A+  N  TA++LA +
Sbjct  774   NPPAKASNNDTARKLAAK  791



>ref|XP_004982513.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=1404

 Score =   268 bits (686),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 198/308 (64%), Gaps = 4/308 (1%)
 Frame = -3

Query  1160  DQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  981
             D + +L S  +YS  +  + ++ IAD  EALIGA+LS  GE AA  FL  LG+DI+F   
Sbjct  1085  DSKLILLSPNMYSVRKMSIKSKRIADSVEALIGAYLSAGGEQAAYLFLISLGMDIEFHKM  1144

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFLG  804
             P+     + +E+ +N++ LE   +L Y F DPSLLVEA+THGSY   GT + YQRLEFLG
Sbjct  1145  PVERKITIKSEEFINLRSLEV--MLGYDFNDPSLLVEAMTHGSYQIAGTTACYQRLEFLG  1202

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             DAVLD+  T +FY QYP   P  LT+LRS SVNN CYA ++VKAGLH +ILHSS+AL   
Sbjct  1203  DAVLDHIFTDYFYRQYPECTPELLTDLRSASVNNNCYAHAAVKAGLHKHILHSSSALHKR  1262

Query  623   IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE  444
             +AD+++N +QS +  + GW      P VL D+IESIAGAIY+DS    ++V+  ++ +LE
Sbjct  1263  MADYLENFKQSFSGPSHGWEAGIGLPKVLGDVIESIAGAIYIDSKCDKEVVWRSMKRLLE  1322

Query  443   PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN  264
             P+ TP++L ++PVKEL ELC +  Y +    V+ +D       EV   G     + +  +
Sbjct  1323  PLATPDTLDVDPVKELQELCGREAYSITYN-VIREDRVTSVVAEVQTKGTAFKAARTGLS  1381

Query  263   RKTAKRLA  240
             +  AK+LA
Sbjct  1382  KLDAKKLA  1389



>gb|ADT91700.1| dicer-like protein 2 [Nicotiana attenuata]
Length=239

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
              D+E ++ S K+YSRGR+K+ ++ +ADV EALIGAFLS+ GE+AALSF++WLG+DIDF+D
Sbjct  47    FDEELLMPSVKMYSRGRQKIKSKRVADVVEALIGAFLSSGGEVAALSFMKWLGVDIDFVD  106

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFL  807
             AP   +FP+NAE++VNV+ LE  SLL+Y F DPSLLVEALTHGSY +P   + YQRLEFL
Sbjct  107   APTPRHFPMNAEKLVNVRYLE--SLLDYKFHDPSLLVEALTHGSYMLPEIPRCYQRLEFL  164

Query  806   GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             GDAVLDYAVT H Y +YPGL PG +T+LRS SVNN CYA ++VKAGLH +ILH+S  L+ 
Sbjct  165   GDAVLDYAVTAHLYFKYPGLSPGFITDLRSASVNNECYAQAAVKAGLHKHILHASQDLQR  224

Query  626   SIADFVKNIEQ  594
              I + V N E+
Sbjct  225   QIVNTVLNFEK  235



>ref|XP_010229604.1| PREDICTED: LOW QUALITY PROTEIN: endoribonuclease Dicer homolog 
2a-like [Brachypodium distachyon]
Length=1398

 Score =   267 bits (683),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 195/306 (64%), Gaps = 5/306 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA-PIVG  969
             L+S  +YS     + ++ IAD  EALIGA+LS AGE AA  FL+ LG+DI++    PI  
Sbjct  1085  LSSNDMYSLRTLSLRSKRIADTVEALIGAYLSAAGEQAAFLFLKSLGMDIEYHSKIPIER  1144

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS-YQRLEFLGDAVL  792
                + +E+ +NVK LE   +L Y F+DP LL+EALTHGSY   GT S YQRLEFLGDAVL
Sbjct  1145  EIGIKSEEFINVKSLEI--ILGYDFKDPLLLMEALTHGSYQTAGTTSCYQRLEFLGDAVL  1202

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T +FY+QYP   P  LT+LRS SVNN+CYA ++VKAGL+ +ILHSS+ L   +A +
Sbjct  1203  DHIFTLYFYNQYPECTPALLTDLRSASVNNSCYAHAAVKAGLNKHILHSSSELHRKMAYY  1262

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++N  Q+    + GW      P VL D+IESIAGAIYLDS    ++V+  I+ +LEP+ T
Sbjct  1263  LENFGQTFRGPSHGWEAGIGLPKVLGDVIESIAGAIYLDSQYDKEVVWRSIKRLLEPLAT  1322

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVKEL E C  R Y M       KDG +    EV   G   S + +  ++  A
Sbjct  1323  PETVACDPVKELQEFCDHRSYSMSY-TKTQKDGVSSFVAEVQVEGTTYSATQTGHDKLVA  1381

Query  251   KRLACE  234
             K+LA +
Sbjct  1382  KKLAAK  1387



>ref|XP_008443674.1| PREDICTED: endoribonuclease Dicer homolog 2 isoform X2 [Cucumis 
melo]
Length=1365

 Score =   262 bits (670),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 201/308 (65%), Gaps = 32/308 (10%)
 Frame = -3

Query  1157  QECVLTSG-KLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA  981
             +E VL+SG K+Y R +RK+  + IADV EALIGA+LST GE AA+ FL            
Sbjct  1071  REVVLSSGRKVYVRRKRKIKGKRIADVVEALIGAYLSTGGERAAIQFL------------  1118

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSYQRLEFLG  804
                              R+ES  LL YTF D SLL+EALTHGSY +P   + YQRLEFLG
Sbjct  1119  ----------------NRIES--LLKYTFNDRSLLLEALTHGSYMLPEIPRCYQRLEFLG  1160

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             D+VLDYA+T H Y++YPG+ P  LT++RS SVNN CY+ +++KA LH  ILH S  L   
Sbjct  1161  DSVLDYAITVHLYNKYPGMTPELLTDMRSASVNNDCYSRTALKAQLHKSILHCSHDLHKH  1220

Query  623   IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE  444
             I+  + N E  S+ +T+GW  + SFP VL D+IES+AGAIY+DSG   + VF  IRP+LE
Sbjct  1221  ISSTLHNFEMLSSEATYGWESEISFPKVLGDVIESLAGAIYVDSGYDKEKVFGCIRPLLE  1280

Query  443   PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARN  264
             P+V+PE+L+ +P +EL ELCQK KY +K+ V    +G +  T+EV  NG +   ++ + +
Sbjct  1281  PLVSPETLKKHPRRELNELCQKEKYNLKKTVTSRVNGRSHVTVEVEVNGRIFKHTAISLD  1340

Query  263   RKTAKRLA  240
             R+T K++A
Sbjct  1341  RETGKKVA  1348



>ref|XP_006651573.1| PREDICTED: endoribonuclease Dicer homolog 2a-like [Oryza brachyantha]
Length=1348

 Score =   254 bits (650),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 191/304 (63%), Gaps = 5/304 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    LYS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1027  LAPNGLYSQRKISIKSKRIADSVEALIGAYLSTAGEKAAFLMMKSLGMNIEFYTEIPVER  1086

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ +NV+ LE   +L Y F DPSLL+EALTHGSY   G T  YQRLEFLGDAVL
Sbjct  1087  KLSIKAEEFINVRTLEV--MLGYKFNDPSLLLEALTHGSYQTSGPTACYQRLEFLGDAVL  1144

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ YILHSS+ L   ++ +
Sbjct  1145  DHLFTVYYYSKYPECTPELLTDLRSASVNNNCYAHAAVKSGLNKYILHSSSELHRKMSYY  1204

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++N  QS    + GW      P VL D+IESIAGAIY+DS    D+V+  ++ +LEP+ T
Sbjct  1205  LENFGQSFTGPSHGWEAGIGLPKVLGDVIESIAGAIYVDSRSNKDVVWRSMKRLLEPLAT  1264

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +  Y++      H DG +     V A G   S + S   +  A
Sbjct  1265  PETIEPDPVKGLQEFCDRGAYKITYE-ETHVDGVSSVIARVKAGGTTYSATKSGPTKLVA  1323

Query  251   KRLA  240
             K+LA
Sbjct  1324  KKLA  1327



>ref|XP_008392375.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=731

 Score =   247 bits (630),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 170/246 (69%), Gaps = 7/246 (3%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +     +Y  G RK+D + +ADV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  458   LNEELLFDKRSIYVGGTRKIDAKIVADVVEALIGAFLSTGGELDAIYFMNWVGIEVDLDH  517

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  804
                  +  + +E  V+V  LE  SLL+Y F+DPSLLVEAL+HGSYIP G   YQRLEFLG
Sbjct  518   IRYERHLQVQSEIPVDVGHLE--SLLDYKFQDPSLLVEALSHGSYIPGG---YQRLEFLG  572

Query  803   DAVLDYAVTRHFYDQYPGLF-PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             DAVLDY +T +FYD+YP +  PG LT LRS SVNN CYALS+VKAGLH +IL S    R 
Sbjct  573   DAVLDYMITTYFYDKYPEMMSPGILTILRSASVNNKCYALSAVKAGLHKHILASDIVHR-  631

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
             +I   V N    S  ST G   +T F  VLADI+E++AGAIY+DSG    IVF+ IRP+L
Sbjct  632   NIDRTVNNFGSLSKESTSGLKSETYFSNVLADIVEALAGAIYIDSGYNKQIVFQSIRPLL  691

Query  446   EPMVTP  429
             EP+V+P
Sbjct  692   EPLVSP  697



>ref|XP_008351646.1| PREDICTED: endoribonuclease Dicer homolog 2-like [Malus domestica]
Length=730

 Score =   246 bits (629),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 170/246 (69%), Gaps = 7/246 (3%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +     +Y  G RK+D + +ADV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  457   LNEELLFDKRSIYVGGTRKIDAKIVADVVEALIGAFLSTGGELDAIYFMNWVGIEVDLDH  516

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  804
                  +  + +E  V+V  LE  SLL+Y F+DPSLLVEAL+HGSYIP G   YQRLEFLG
Sbjct  517   IRYERHLQVQSEIPVDVGHLE--SLLDYKFQDPSLLVEALSHGSYIPGG---YQRLEFLG  571

Query  803   DAVLDYAVTRHFYDQYPGLF-PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             DAVLDY +T +FYD+YP +  PG LT LRS SVNN CYALS+VKAGLH +IL S    R 
Sbjct  572   DAVLDYMITTYFYDKYPEMMSPGILTILRSASVNNKCYALSAVKAGLHKHILASDIVHR-  630

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL  447
             +I   V N    S  ST G   +T F  VLADI+E++AGAIY+DSG    IVF+ IRP+L
Sbjct  631   NIDRTVNNFGSLSKESTSGLKSETYFSNVLADIVEALAGAIYIDSGYNKQIVFQSIRPLL  690

Query  446   EPMVTP  429
             EP+V+P
Sbjct  691   EPLVSP  696



>gb|AAS07189.1| putative ribonuclease III, 5'-partial (with alternative splicing) 
[Oryza sativa Japonica Group]
Length=1017

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 5/304 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  697   LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  756

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  757   KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  814

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  815   DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  874

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++   QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct  875   LEEFGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT  934

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R +++      H DG +     V A     S + S   +  A
Sbjct  935   PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPCKLVA  993

Query  251   KRLA  240
             K+LA
Sbjct  994   KKLA  997



>gb|EEC75643.1| hypothetical protein OsI_12390 [Oryza sativa Indica Group]
Length=1318

 Score =   244 bits (623),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 5/304 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  998   LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1057

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1058  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1115

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1116  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1175

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++   QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct  1176  LEEFGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT  1235

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R +++      H DG +     V A     S + S   +  A
Sbjct  1236  PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPCKLVA  1294

Query  251   KRLA  240
             K+LA
Sbjct  1295  KKLA  1298



>ref|NP_001050564.1| Os03g0583900 [Oryza sativa Japonica Group]
 sp|Q10HL3.1|DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2a; AltName: Full=Dicer-like 
protein 2a; Short=OsDCL2a [Oryza sativa Japonica 
Group]
 gb|AAT76309.1| putative RNA helicase/RNAseIII protein, C-terminus truncated 
[Oryza sativa Japonica Group]
 gb|ABF97330.1| Type III restriction enzyme, res subunit family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12478.1| Os03g0583900 [Oryza sativa Japonica Group]
 dbj|BAG92928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1410

 Score =   244 bits (623),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 5/304 (2%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1090  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1149

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1150  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1207

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1208  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1267

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
             ++   QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct  1268  LEEFGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT  1327

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R +++      H DG +     V A     S + S   +  A
Sbjct  1328  PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPCKLVA  1386

Query  251   KRLA  240
             K+LA
Sbjct  1387  KKLA  1390



>gb|EEE59414.1| hypothetical protein OsJ_11564 [Oryza sativa Japonica Group]
Length=1371

 Score =   236 bits (601),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 188/304 (62%), Gaps = 9/304 (3%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1055  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1114

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1115  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1172

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1173  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1232

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
                + QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct  1233  ---LGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT  1289

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R +++      H DG +     V A     S + S    K A
Sbjct  1290  PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPC-KLA  1347

Query  251   KRLA  240
             K+LA
Sbjct  1348  KKLA  1351



>sp|Q69LX2.2|DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 2b; AltName: Full=Dicer-like 
protein 2b; Short=OsDCL2b [Oryza sativa Japonica 
Group]
Length=1377

 Score =   234 bits (597),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 188/304 (62%), Gaps = 9/304 (3%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1061  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1120

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ ++V+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1121  KISMKAEEFIDVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1178

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1179  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1238

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
                + QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct  1239  ---LGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT  1295

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R +++      H DG +     V A     S + S    K A
Sbjct  1296  PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPC-KLA  1353

Query  251   KRLA  240
             K+LA
Sbjct  1354  KKLA  1357



>dbj|BAD34005.1| CAF protein-like [Oryza sativa Japonica Group]
 dbj|BAD36404.1| CAF protein-like [Oryza sativa Japonica Group]
Length=1375

 Score =   234 bits (596),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/304 (43%), Positives = 188/304 (62%), Gaps = 9/304 (3%)
 Frame = -3

Query  1145  LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG  969
             L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct  1059  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER  1118

Query  968   NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL  792
                + AE+ ++V+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct  1119  KISMKAEEFIDVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL  1176

Query  791   DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct  1177  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY  1236

Query  611   VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
                + QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct  1237  ---LGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT  1293

Query  431   PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA  252
             PE++  +PVK L E C +R +++      H DG +     V A     S + S    K A
Sbjct  1294  PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPC-KLA  1351

Query  251   KRLA  240
             K+LA
Sbjct  1352  KKLA  1355



>ref|XP_004982511.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Setaria italica]
Length=719

 Score =   228 bits (580),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 191/311 (61%), Gaps = 10/311 (3%)
 Frame = -3

Query  1148  VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIV  972
             +L +  +YS     M ++ IAD  EALIGA+LS +GE AA  F++ LG+ ++   +    
Sbjct  405   LLPTNNMYSLKAISMKSKRIADTVEALIGAYLSASGEQAAFHFIKSLGMGVELHSEMQEE  464

Query  971   GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVL  792
                   +E++++V+ LE+  +L+Y F D SLL+EALTH SY   G   Y+RLEFLGDAVL
Sbjct  465   RKIITKSEEIIDVRSLET--MLDYVFNDRSLLIEALTHSSYNIAGP-CYERLEFLGDAVL  521

Query  791   DYAVTRHFYD-QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIAD  615
             D+ +T +FY   YPG  P  LT LR  SVNN CYA ++VKAGLH +ILHSS+  +  I D
Sbjct  522   DHIITDYFYKLYYPGCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS--KQMIND  579

Query  614   FVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV  435
              ++N   S +  + GW      P  LAD+IESIAGAIYLDS  + ++V+  +R +LEP+ 
Sbjct  580   -LENSGWSFSGPSHGWEPGIGLPEDLADLIESIAGAIYLDSKHKKEVVWRAMRRLLEPLA  638

Query  434   TPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTI--EVMANGGVRSCSSSARNR  261
             TP+++ + PV EL E+C++RKY          DG   T +  +V A G V   +   RN+
Sbjct  639   TPKTVEVYPVSELKEICERRKYPKPSYSPTRDDGVGVTRVVAKVKAAGKVYYGTGEGRNQ  698

Query  260   KTAKRLACERM  228
             K AK LA + +
Sbjct  699   KVAKILAAKAL  709



>gb|AFW68291.1| hypothetical protein ZEAMMB73_565304 [Zea mays]
Length=462

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  150   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  209

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  210   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  267

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  268   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  324

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  325   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  384

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  385   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  443

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  444   AEVLAAKAL  452



>ref|XP_004982509.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Setaria italica]
Length=755

 Score =   227 bits (579),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 191/311 (61%), Gaps = 10/311 (3%)
 Frame = -3

Query  1148  VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIV  972
             +L +  +YS     M ++ IAD  EALIGA+LS +GE AA  F++ LG+ ++   +    
Sbjct  441   LLPTNNMYSLKAISMKSKRIADTVEALIGAYLSASGEQAAFHFIKSLGMGVELHSEMQEE  500

Query  971   GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVL  792
                   +E++++V+ LE+  +L+Y F D SLL+EALTH SY   G   Y+RLEFLGDAVL
Sbjct  501   RKIITKSEEIIDVRSLET--MLDYVFNDRSLLIEALTHSSYNIAGP-CYERLEFLGDAVL  557

Query  791   DYAVTRHFYD-QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIAD  615
             D+ +T +FY   YPG  P  LT LR  SVNN CYA ++VKAGLH +ILHSS+  +  I D
Sbjct  558   DHIITDYFYKLYYPGCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS--KQMIND  615

Query  614   FVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV  435
              ++N   S +  + GW      P  LAD+IESIAGAIYLDS  + ++V+  +R +LEP+ 
Sbjct  616   -LENSGWSFSGPSHGWEPGIGLPEDLADLIESIAGAIYLDSKHKKEVVWRAMRRLLEPLA  674

Query  434   TPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTI--EVMANGGVRSCSSSARNR  261
             TP+++ + PV EL E+C++RKY          DG   T +  +V A G V   +   RN+
Sbjct  675   TPKTVEVYPVSELKEICERRKYPKPSYSPTRDDGVGVTRVVAKVKAAGKVYYGTGEGRNQ  734

Query  260   KTAKRLACERM  228
             K AK LA + +
Sbjct  735   KVAKILAAKAL  745



>ref|XP_008644683.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X8 
[Zea mays]
Length=479

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  167   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  226

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  227   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  284

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  285   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  341

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  342   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  401

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  402   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  460

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  461   AEVLAAKAL  469



>ref|XP_008644682.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X7 
[Zea mays]
Length=486

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  174   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  233

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  234   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  291

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  292   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  348

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  349   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  408

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  409   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  467

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  468   AEVLAAKAL  476



>ref|XP_008644680.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X5 
[Zea mays]
Length=674

 Score =   221 bits (563),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA-PIVGNF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      +    
Sbjct  362   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  421

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  422   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  479

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  480   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  536

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  537   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  596

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  597   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  655

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  656   AEVLAAKAL  664



>ref|XP_008644679.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X4 
[Zea mays]
Length=682

 Score =   220 bits (561),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  370   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  429

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  430   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  487

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  488   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  544

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  545   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  604

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  605   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  663

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  664   AEVLAAKAL  672



>ref|XP_008644678.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X3 
[Zea mays]
Length=717

 Score =   220 bits (561),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  405   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  464

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  465   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  522

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  523   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  579

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  580   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  639

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  640   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  698

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  699   AEVLAAKAL  707



>ref|XP_008644677.1| PREDICTED: uncharacterized protein LOC103626078 isoform X2 [Zea 
mays]
Length=737

 Score =   221 bits (562),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  425   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  484

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  485   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  542

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  543   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  599

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  600   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  659

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  660   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  718

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  719   AEVLAAKAL  727



>ref|XP_008644676.1| PREDICTED: endoribonuclease Dicer homolog 2a-like isoform X1 
[Zea mays]
Length=751

 Score =   220 bits (561),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 129/309 (42%), Positives = 188/309 (61%), Gaps = 11/309 (4%)
 Frame = -3

Query  1139  SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NF  963
             +  +YS  +  + ++ IAD  EAL GA+LST GE+AA+ F++ LG+D++      V    
Sbjct  439   TNNMYSLKKISIKSKRIADTVEALTGAYLSTCGELAAVHFIKALGMDVELHSKMQVERTI  498

Query  962   PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDY  786
                +E++++ + L++  +L Y F D SLLVEALTH SY   G T   +RLEFLGDAVLDY
Sbjct  499   TTKSEELIDAESLQT--MLKYVFYDTSLLVEALTHSSYNITGITACNERLEFLGDAVLDY  556

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T +FY +YP   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+     + + ++
Sbjct  557   ILTYYFYRKYPNCTPALLTNLRKASVNNCCYAHAAVKAGLHKHILHSSS---KQMVNDLE  613

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
             N  +S +  + GW    S P  LAD+ E+IAGAIY+DSG   ++V+  IR +LEP+ TP 
Sbjct  614   NSGRSFSGPSHGWEAGISLPEDLADLFEAIAGAIYVDSGNDKEVVWSAIRRLLEPLATPG  673

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTT---IEVMANGGVRSCSSSARNRKT  255
             ++  +PV EL ELC+ + Y  K      +D  A  T    +V A   V S + + RN+  
Sbjct  674   TMEPDPVSELKELCEHKHYP-KPSYSPTRDSVAGVTRVVAQVTAARTVYSGTGTGRNQDV  732

Query  254   AKRLACERM  228
             A+ LA + +
Sbjct  733   AEVLAAKAL  741



>gb|AJA90756.1| Dicer-like 3 [Cycas revoluta]
Length=1876

 Score =   214 bits (545),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 188/316 (59%), Gaps = 12/316 (4%)
 Frame = -3

Query  1148  VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDA  981
             V+  GK   +G R M ++TI+D  EALI A L   G IAAL  ++W+ +D++F    ++A
Sbjct  1207  VVKIGKACGKGHRWMCSKTISDAVEALIAAHLVGGGPIAALELMKWMNMDVEFEPDLVEA  1266

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLG  804
                  F      + +   L  +SLL YTF++  LLVEA+TH S   P G   YQRLEFLG
Sbjct  1267  AFQRAFVYPC-VLRSTNLLGLESLLGYTFQNKGLLVEAITHASQQDPEGGCCYQRLEFLG  1325

Query  803   DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS  624
             D+VLD  +TRH +  +PGL PG LT+LRS +VNN  +A  +VK  +  Y+ H S AL + 
Sbjct  1326  DSVLDLLITRHLFSMHPGLTPGVLTDLRSAAVNNENFARVAVKQNIQKYLRHGSGALLTQ  1385

Query  623   IADFVKNIEQ-SSASSTF-GWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPV  450
             I +FVK ++Q       F  +      P VL D++ES+AGA+ +D+    D V+E ++P+
Sbjct  1386  ITEFVKAVDQVKDGECRFSSFGGGLGGPKVLGDLVESLAGALLVDTRFDLDRVWEIMKPI  1445

Query  449   LEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGE-ACTTIEV-MANGGVRSCSS  276
             L P+V+PE+L L+P++EL ELC ++ Y +       K G+    ++EV + +  V   + 
Sbjct  1446  LSPIVSPETLNLHPLRELLELCYQKGYCISWKFT--KQGKLTVASVEVQLEDSSVIVGTG  1503

Query  275   SARNRKTAKRLACERM  228
             S  N+KTAK++A E +
Sbjct  1504  SKMNKKTAKKVAAEHI  1519



>ref|XP_002464289.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
 gb|EER91287.1| hypothetical protein SORBIDRAFT_01g015666 [Sorghum bicolor]
Length=462

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 164/263 (62%), Gaps = 13/263 (5%)
 Frame = -3

Query  1142  TSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF  963
             T+  +YS     + ++ IAD  EAL GA+LS  GE+AA+ F++ LG+D++      V   
Sbjct  149   TTNDMYSLDEIPIKSKRIADTVEALTGAYLSACGELAAVHFIKSLGMDVELHSKMQVERI  208

Query  962   -PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLD  789
                 +E+ ++V+ L++  ++ Y F D SLL+EALTH SY   G T   +RLEFLGDAVLD
Sbjct  209   VSTKSEEFIDVESLQT--IIGYVFDDSSLLIEALTHSSYNTAGITTCNERLEFLGDAVLD  266

Query  788   YAVTRHFYDQY-PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF  612
             Y +T +FY +Y P   P  LT LR  SVNN CYA ++VKAGLH +ILHSS+         
Sbjct  267   YILTDYFYRKYYPKCTPALLTNLRKASVNNWCYAHAAVKAGLHKHILHSSSK------QM  320

Query  611   VKNIEQSSASS--TFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM  438
             +K++E S   S  + GW      P  LAD+ E+IAGAIY+DSG   + V+  +R +L P+
Sbjct  321   IKDLESSGPFSGPSHGWEPGIGLPEDLADLFEAIAGAIYVDSGNDKEAVWRAMRRLLVPL  380

Query  437   VTPESLRLNPVKELTELCQKRKY  369
              TPE++ L+PV EL ELC+ + Y
Sbjct  381   ATPETILLDPVSELKELCEHKNY  403



>gb|AIE15763.1| Dicer-like protein 1 [Salvia miltiorrhiza]
Length=1927

 Score =   212 bits (540),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 182/299 (61%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGN-FPLNAE  948
             R +  +T+ADV EALIG +    G+ AA   +RW G+DIDF    I+  IV N  P N  
Sbjct  1523  RVLSGKTLADVVEALIGVYYVEGGKHAANHLMRWTGIDIDFDLKEINYSIVPNSVPDNIL  1582

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+   LE   +LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1583  RTVDFDALEK--VLNMQFSDKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1640

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE---  597
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1641  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVQVEL  1700

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LD+G  T +V++  +P+L+PMVTPE+L 
Sbjct  1701  SKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDAGCNTALVWKVFQPLLDPMVTPETLP  1759

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  +G     + +A+ +K A++LA
Sbjct  1760  MHPVRELQERCQQQAEGLEYKAT--RSGN-LATVEVYVDGVQVGVAHNAQ-KKMAQKLA  1814



>gb|AFD22618.1| dicer-like 1 protein, partial [Nicotiana attenuata]
Length=1690

 Score =   211 bits (538),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 182/301 (60%), Gaps = 14/301 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF     +  I   + P N  
Sbjct  1287  RVLSSKTMADVVEALIGVYYVDGGKYAANHFMKWIGVEVDFDFKETEYSIRPYSIPENVL  1346

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+  +L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1347  RSVDFDKLQG--ALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1404

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF---VKNIE  597
             +  Y  L PG LT+LR+ +VNN  +A  +VK GLH ++ H S+AL   I DF   VKN  
Sbjct  1405  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFVIEVKNEL  1464

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L 
Sbjct  1465  SKPGFNSFG-LGDCKAPKVLGDIFESIAGAIFLDSGCDTAVVWKVFQPLLHPMVTPETLP  1523

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
             ++PV+EL E CQ++   ++      + G    T+EV  +G     + + + RK A+++ C
Sbjct  1524  MHPVRELQERCQQQAQGLE--YKASRSGN-IATVEVYVDGIQVGMAQNPQKRKMAQKVGC  1580

Query  236   E  234
             +
Sbjct  1581  Q  1581


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  1105  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMIGYPVPALKILEALTAASC--QETFCYE  1162

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1163  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1218



>ref|XP_010934026.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Elaeis 
guineensis]
Length=1847

 Score =   210 bits (535),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 121/297 (41%), Positives = 178/297 (60%), Gaps = 12/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1440  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1499

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              V+   LE+   LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1500  SVDFDALEA--ALNIQFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1557

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK++    +
Sbjct  1558  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVHDELS  1617

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++
Sbjct  1618  KPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDNGLDTSIVWGVFQPLLHPMVTPETLPMH  1677

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1678  PVRELQERCQQQAEGLEYKATRTGN---IATVEVFID-GVQMGVAQNPQKKMAQKLA  1730



>ref|XP_010934025.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Elaeis 
guineensis]
Length=1933

 Score =   210 bits (535),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 121/297 (41%), Positives = 178/297 (60%), Gaps = 12/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1526  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1585

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              V+   LE+   LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1586  SVDFDALEA--ALNIQFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1643

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK++    +
Sbjct  1644  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVHDELS  1703

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++
Sbjct  1704  KPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDNGLDTSIVWGVFQPLLHPMVTPETLPMH  1763

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1764  PVRELQERCQQQAEGLEYKATRTGN---IATVEVFID-GVQMGVAQNPQKKMAQKLA  1816



>dbj|BAD94606.1| CAF protein [Arabidopsis thaliana]
Length=690

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/253 (44%), Positives = 159/253 (63%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  276   RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  335

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++  RLE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  336   KSIDFVRLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  393

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct  394   FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES  453

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct  454   SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM  513

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  514   HPVRELQERCQQQ  526



>ref|XP_010686530.1| PREDICTED: endoribonuclease Dicer homolog 1 [Beta vulgaris subsp. 
vulgaris]
Length=1972

 Score =   209 bits (533),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 160/254 (63%), Gaps = 11/254 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPI-VGNFPLNAE  948
             R + ++T+ADV EALIG      G++AA  F++W+G+DI+F    ID P    N P    
Sbjct  1569  RVLSSKTLADVVEALIGIHYVEGGKLAANHFMKWIGIDIEFNPEDIDRPKRPSNVPEGVL  1628

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+   LE    LN  FRD + L+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1629  RSVDFDTLEG--ALNIKFRDRTFLIEAITHASRPSSGVACYQRLEFVGDAVLDHLITRHL  1686

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             + +Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFVK  +   
Sbjct  1687  FFRYTDLPPGRLTDLRAAAVNNENFARVAVKHRLHVHLRHGSTALEKQIRDFVKEAQNEL  1746

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V+    P+L+PMVTPE+L 
Sbjct  1747  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGHDTAVVWRVFEPLLQPMVTPETLP  1805

Query  416   LNPVKELTELCQKR  375
             ++PV+EL E CQ++
Sbjct  1806  MHPVRELQERCQQQ  1819


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKR--------LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G     A+++ ++ R        +E  +++NY     S ++EALT  S     T  Y
Sbjct  1387  PLPGELVRGAQRLPSIMRRVESMLLAIELKNIINYPV-PASKILEALTAASC--QETFCY  1443

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1444  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQKMVSNMVLYHHALEKGLQSYI  1500



>gb|AIO05700.1| putative endoribonuclease dicer-like protein 1, partial [Cocos 
nucifera]
Length=1720

 Score =   209 bits (532),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 179/297 (60%), Gaps = 12/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1313  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELSCPKPHNIPESIMR  1372

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              V+   LE+   L+  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1373  SVDFDALEA--ALSIKFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1430

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   +
Sbjct  1431  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELS  1490

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++
Sbjct  1491  KPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDNGLDTSIVWRVFQPLLHPMVTPETLPMH  1550

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1551  PVRELQERCQQQAEGLEYKATRIGN---IATVEVFID-GVQMGVAQNPQKKMAQKLA  1603



>gb|AJA90772.1| Dicer-like 3 [Ginkgo biloba]
Length=1815

 Score =   209 bits (531),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 179/315 (57%), Gaps = 10/315 (3%)
 Frame = -3

Query  1148  VLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG  969
             V+  GK   +G R M ++T+AD  EALIGA+L   G  AA  F+ W+ +++    A + G
Sbjct  1221  VVKIGKTCDKGHRWMCSKTVADSVEALIGAYLVGGGLTAAFKFMSWMNIEVALEPALVEG  1280

Query  968   NFP---LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGD  801
              F    ++A  + N      +S L YTF + +LLVEA+TH S     G   YQRLEFLGD
Sbjct  1281  AFKHASVHAHVLRNTNLHALESQLGYTFHNKALLVEAITHASQQDSEGGCCYQRLEFLGD  1340

Query  800   AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI  621
             +VLD+ +TRH +  +  L PG LT+LRS +VNN  +A  +VK  L  Y+ H S AL   I
Sbjct  1341  SVLDFLITRHLFSAHTDLSPGVLTDLRSAAVNNENFAQVAVKHNLQQYLRHGSGALLGQI  1400

Query  620   ADFVKNIEQ----SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRP  453
               F+K ++Q     S  ++FG  +K   P VL D+IESIAGAI +DS    + V+E ++P
Sbjct  1401  TAFIKAVQQCKENKSHCTSFGGGIKG--PKVLGDLIESIAGAILVDSRFDLEQVWEIMKP  1458

Query  452   VLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSS  273
             +L P+VTPE+L L+P++E+ ELC    Y +       +      T+EV            
Sbjct  1459  ILSPIVTPETLDLHPLREVCELCHLNGYSIIWNKSTQQGKLTVVTVEVKLEDCTIYGKGC  1518

Query  272   ARNRKTAKRLACERM  228
               N+KTAK+ A +++
Sbjct  1519  KLNKKTAKKEAAQQI  1533



>ref|XP_009411416.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1558

 Score =   208 bits (529),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 179/297 (60%), Gaps = 12/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    GE+AA   ++W+G+ +D     I  P   N P +  +
Sbjct  1153  RVLSSKTLADVVEALIGVYYVEGGEVAANHLMKWIGIQVDIDPRDIPCPKPYNIPESIMR  1212

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              V+   LE    LN  FRD  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1213  SVDFDALEG--ALNVKFRDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1270

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   +
Sbjct  1271  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELS  1330

Query  584   SSTFGW--VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
              + F +  +     P VL DI+ESIAGAI+LD+     IV++  +P+L PMVTPE+L ++
Sbjct  1331  RTGFNYFGLGDCKAPKVLGDIVESIAGAIFLDNEHDASIVWKVFQPLLHPMVTPETLPMH  1390

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1391  PVRELQERCQQQAEGLEYKAT--RTGN-IATVEVFID-GVQIGIAQNPQKKMAQKLA  1443



>ref|XP_008783544.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Phoenix 
dactylifera]
Length=1932

 Score =   208 bits (530),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 179/297 (60%), Gaps = 12/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    +  P   N P +  +
Sbjct  1527  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMRWIGIQVEFDPQELPCPKPHNIPESIMR  1586

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              V+   LE+  ++   F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1587  SVDFDALEAALIIK--FKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1644

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   +
Sbjct  1645  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELS  1704

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LD+GL T IV+   +P+L PMVTPE+L ++
Sbjct  1705  KPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDNGLDTSIVWRVFQPLLHPMVTPETLPMH  1764

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1765  PVRELQERCQQQAEGLEYKATRTGN---VATVEVFID-GVQMGVAQNPQKKMAQKLA  1817



>ref|XP_009411415.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1926

 Score =   208 bits (529),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 179/297 (60%), Gaps = 12/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    GE+AA   ++W+G+ +D     I  P   N P +  +
Sbjct  1521  RVLSSKTLADVVEALIGVYYVEGGEVAANHLMKWIGIQVDIDPRDIPCPKPYNIPESIMR  1580

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              V+   LE    LN  FRD  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1581  SVDFDALEG--ALNVKFRDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1638

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFVK+++   +
Sbjct  1639  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEAQIRDFVKDVQDELS  1698

Query  584   SSTFGW--VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
              + F +  +     P VL DI+ESIAGAI+LD+     IV++  +P+L PMVTPE+L ++
Sbjct  1699  RTGFNYFGLGDCKAPKVLGDIVESIAGAIFLDNEHDASIVWKVFQPLLHPMVTPETLPMH  1758

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1759  PVRELQERCQQQAEGLEYKAT--RTGN-IATVEVFID-GVQIGIAQNPQKKMAQKLA  1811



>ref|XP_006650986.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Oryza brachyantha]
Length=1855

 Score =   207 bits (527),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 122/300 (41%), Positives = 183/300 (61%), Gaps = 18/300 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD   I  P   N P +  +
Sbjct  1448  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPQDIPPPKPYNIPESIMK  1507

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              +N   LE   +L+  F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1508  SINFDTLEG--VLDIKFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1565

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ---  594
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++   
Sbjct  1566  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELL  1625

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
                 ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1626  KPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPM  1684

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1685  HPVRELQERCQQQAEGLE-----YKASRAGNVATVEVFVD-GVQIGIAQNPQKKMAQKLA  1738



>gb|EYU35897.1| hypothetical protein MIMGU_mgv1a000073mg [Erythranthe guttata]
Length=1905

 Score =   207 bits (527),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 182/299 (61%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVN-  936
             R +  +T+ADV EALIG +    G+ AA   ++W+G+DI+F    I  N+ +    + + 
Sbjct  1501  RVLSGKTLADVVEALIGVYYVEGGKTAANHLMKWIGIDIEFDLKEI--NYSIRPSSVPDS  1558

Query  935   -VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
              ++ ++ D+L   LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H 
Sbjct  1559  VLRTIDFDALEGCLNVKFNDKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHL  1618

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  SVK  LH ++ H S+AL   I DFVK +E   
Sbjct  1619  FFTYTDLPPGRLTDLRAAAVNNENFARVSVKHNLHTHLRHGSSALEKQIRDFVKEVESEL  1678

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LD+G  T +V++  +P+L+PMVTPE+L 
Sbjct  1679  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDTGCNTAVVWKVFQPLLDPMVTPETLP  1737

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1738  MHPVRELQERCQQQAEGLEYKAT--RSGN-LATVEVYVD-GVQVGLAHNPQKKMAQKLA  1792


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1319  PLPGSLVRGAQRLPSIMRRIESMLLAVQLKEIINYPV-PASKILEALTAASC--QETFCY  1375

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1376  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNVVLYQFALDKGLQSYI  1432



>ref|XP_010229289.1| PREDICTED: endoribonuclease Dicer homolog 1 [Brachypodium distachyon]
Length=1930

 Score =   207 bits (527),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 119/299 (40%), Positives = 181/299 (61%), Gaps = 16/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD   I  P + N P +  +
Sbjct  1522  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPQEIPPPKIYNIPDSIMR  1581

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              +N   LES  ++   F++   LVEA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1582  SINFDTLES--IMGIKFQNKGFLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1639

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++ +  +
Sbjct  1640  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVREEIS  1699

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
              S F    +     P VL DIIESIAGAI+LDSG  T  V++  +P+L+PMVTPE+L ++
Sbjct  1700  KSGFNSFGLGDCKAPKVLGDIIESIAGAIFLDSGYDTSAVWKVFQPLLDPMVTPETLPMH  1759

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             P++EL E CQ++   ++     +K   A    T+EV  + G++   +    +K A++LA
Sbjct  1760  PIRELQERCQQQAEGLE-----YKASRAGNVATVEVFVD-GIQIGVAQNPQKKMAQKLA  1812



>ref|XP_012083084.1| PREDICTED: endoribonuclease Dicer homolog 1 [Jatropha curcas]
 gb|KDP28399.1| hypothetical protein JCGZ_14170 [Jatropha curcas]
Length=1986

 Score =   206 bits (525),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/298 (40%), Positives = 178/298 (60%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPI-VGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ +DF    ID+ I   N P +  
Sbjct  1583  RVLSSKTLADVVEALIGVYYVEDGKNAANHLMKWIGIQVDFDREEIDSAIRPSNVPESVL  1642

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1643  RSIDFDTLEG--ALNIMFKDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1700

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1701  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFVKEVQDEL  1760

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1761  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPM  1820

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++       +     T+EV  + G++   +    +K A++LA
Sbjct  1821  HPVRELQERCQQQAEGLEYKATRSGN---LATVEVFID-GIQIGVAQNPQKKMAQKLA  1874


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 10/136 (7%)
 Frame = -3

Query  1040  EIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PS  882
             EI   ++  +L L++  +  P+ G+    A+++ ++ R     LL    +D        S
Sbjct  1382  EILDKTYYVFLPLELCLVH-PLPGSLVRGAQRLPSIMRRVESMLLAIQLKDIINYPVPAS  1440

Query  881   LLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNN  702
              ++EALT  S     T  Y+R E LGDA L + V+R  + +YP    G LT +R + V+N
Sbjct  1441  KILEALTAASC--QETFCYERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSN  1498

Query  701   ACYALSSVKAGLHNYI  654
                   ++  GL +YI
Sbjct  1499  MVLYQYALNKGLQSYI  1514



>ref|XP_009794783.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nicotiana sylvestris]
Length=1178

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/299 (41%), Positives = 181/299 (61%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF     +  I   + P N  
Sbjct  777   RVLSSKTMADVVEALIGVYYVDGGKYAANHFMKWIGVEVDFDFKETEYSIRPYSIPENVL  836

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+  +L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  837   RSVDFDKLQG--ALNISFNDKGLLLEAMTHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  894

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF---VKNIE  597
             +  Y  L PG LT+LR+ +VNN  +A  +VK GLH ++ H S+AL   I DF   VKN  
Sbjct  895   FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHGLHLHLRHGSSALEKQIRDFVSEVKNEL  954

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L 
Sbjct  955   SKPGFNSFG-LGDCKAPKVLGDIFESIAGAIFLDSGCDTAVVWKVFQPLLHPMVTPETLP  1013

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + G++   +    +K A++LA
Sbjct  1014  MHPVRELQERCQQQAQGLE--YKASRSGN-IATVEVYVD-GIQVGMAQNPQKKMAQKLA  1068


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = -3

Query  980  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  822
            P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  595  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMIGYPVPALKILEALTAASC--QETFCYE  652

Query  821  RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
            R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  653  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQLVSNMVLYQYALNKGLQSYI  708



>gb|KFK42493.1| hypothetical protein AALP_AA1G000600 [Arabis alpina]
Length=1791

 Score =   205 bits (522),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 161/255 (63%), Gaps = 12/255 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  951
             R + ++T+ADV EALIG +    G+IAA   ++W+G+D++  D   +       N P + 
Sbjct  1376  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIDVEEDDPEEIEGTVKPANVPESV  1435

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  771
              + ++   LE    L + F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1436  LKSIDFVGLEK--ALKFEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRH  1493

Query  770   FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS  591
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  
Sbjct  1494  LFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHFYLRHGSSALEKQIRDFVKEVQTE  1553

Query  590   SAS---STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
             S+    ++FG +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L
Sbjct  1554  SSKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETL  1612

Query  419   RLNPVKELTELCQKR  375
              ++PV+EL E CQ++
Sbjct  1613  PMHPVRELQERCQQQ  1627


 Score = 52.0 bits (123),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        SL++Y     S ++EALT  S     T  Y
Sbjct  1199  PLSGSLVRGAQRLPSIMRRVESMLLAVQLKSLISYPI-PTSKILEALTAASC--QETFCY  1255

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1256  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1312



>ref|XP_002448150.1| hypothetical protein SORBIDRAFT_06g022180 [Sorghum bicolor]
 gb|EES12478.1| hypothetical protein SORBIDRAFT_06g022180 [Sorghum bicolor]
Length=698

 Score =   201 bits (511),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 176/296 (59%), Gaps = 9/296 (3%)
 Frame = -3

Query  1106  MDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFPLNAEQM  942
             +  +TIADV E+L+GAFL   G  AA +FLRW+G+ +DF ++ +       +  L+    
Sbjct  190   LHRKTIADVVESLLGAFLVECGFKAAFAFLRWIGIKVDFENSALYRVLDASSTNLSLMNY  249

Query  941   VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
             +N+  LE   L+ YTF+   LL++A  H S+  H    YQR+EFLGDAVLDY +  + Y 
Sbjct  250   MNISELEE--LIGYTFKHKGLLLQAFVHPSFNKHSGGCYQRMEFLGDAVLDYLMASYLYS  307

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              YP L PG LT+L+S ++NN  +A  +VK  +H Y++  S +L ++I  F   +  SS+ 
Sbjct  308   AYPDLKPGQLTDLKSLALNNNSFAYVAVKKSIHKYLIKDSKSLTAAINKFQNYVNLSSSE  367

Query  581   STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVK  402
                  + + + P VL DI+ES  GA+ LDSG   + V++ +  +L+P+++   + ++P++
Sbjct  368   KDL--LEEPTCPKVLGDIVESCVGAVLLDSGFNLNHVWKLMLMLLKPILSFCGMHIDPMR  425

Query  401   ELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE  234
             EL E+CQ   + +  P     +GE    +EV  +G + SC+++ RN K A+++A +
Sbjct  426   ELREICQYNGFELGLPKPTEDNGEFHVKVEVNIDGKMISCTAANRNSKDARKVAAQ  481



>ref|XP_002515097.1| dicer-1, putative [Ricinus communis]
 gb|EEF47081.1| dicer-1, putative [Ricinus communis]
Length=1543

 Score =   204 bits (519),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 178/299 (60%), Gaps = 13/299 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPI-VGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   +RW+G+ ++F    ID+ I   N P +  
Sbjct  1140  RVLSSKTLADVVEALIGIYYVEGGKTAANHLMRWIGIKVEFDHEEIDSAIRPSNVPESIL  1199

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1200  RSIDFDALEG--ALNIKFQDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1257

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +V   LH ++ H S+AL   I DFV+ ++   
Sbjct  1258  FFTYTNLPPGRLTDLRAAAVNNENFARVAVNHKLHVHLRHGSSALEKQIRDFVREVQDEL  1317

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1318  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPM  1377

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
             +PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1378  HPVRELQERCQQQAEGLEYKAT--RSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLAA  1432


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  958   PLPGSLVRGAQRLPSIMRRVESMLLAIQLKDIIHYSVPALKILEALTAASC--QETFCYE  1015

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1016  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALIKGLQSYI  1071



>ref|XP_011071730.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Sesamum 
indicum]
Length=1572

 Score =   204 bits (519),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 122/298 (41%), Positives = 176/298 (59%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIV-GNFPLNAE  948
             R +  +T+ADV EALIG +    G+ AA   ++W+G++IDF    I+  I     P N  
Sbjct  1169  RVLSGKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEIDFDLKEINYSIKPSTVPDNIL  1228

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1229  RTIDFDALEGS--LNVKFTDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1286

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1287  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVQNEL  1346

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L +
Sbjct  1347  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGCNTAAVWKVFQPLLNPMVTPETLPM  1406

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++      ++G    T+EV  + GV+   +    +K A++LA
Sbjct  1407  HPVRELQERCQQQAEGLE--YKASRNGN-LATVEVYVD-GVQVGVAHNPQKKMAQKLA  1460


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  987   PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDIISYPVPASKILEALTAASC--QETFCYE  1044

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1045  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNIVLYQYALNKGLQSYI  1100



>ref|XP_010054144.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Eucalyptus 
grandis]
Length=1954

 Score =   204 bits (519),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/298 (40%), Positives = 177/298 (59%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID-----APIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA  F++W+G+ ++F +     A    N P +  
Sbjct  1554  RVLSSKTLADVVEALIGVYYVEGGKNAANHFMKWVGIRVEFDNDEKECAIRPSNVPESIL  1613

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LES   LN  F D   L+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1614  RSVNFDALES--ALNLKFNDRGFLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1671

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1672  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIRDFVKEVQDEL  1731

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTP+ L +
Sbjct  1732  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGHDTAVVWKAFQPLLHPMVTPDRLPM  1791

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++      ++G    T+EV  + GV+   +    +K A++LA
Sbjct  1792  HPVRELQERCQQQAEGLE--YKASRNGN-LATVEVFVD-GVQVGVAQNPQKKMAQKLA  1845



>gb|EAZ25399.1| hypothetical protein OsJ_09217 [Oryza sativa Japonica Group]
Length=1883

 Score =   204 bits (518),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 183/300 (61%), Gaps = 18/300 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD + I  P   + P +  +
Sbjct  1475  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPEEIPPPKPYDIPESIMR  1534

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              +N   L+   +L   F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1535  SINFDTLKG--VLGIEFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1592

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ---  594
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++   
Sbjct  1593  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELL  1652

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
                 ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1653  KPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPM  1711

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1712  HPVRELQERCQQQAEGLE-----YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLA  1765



>gb|EAY88320.1| hypothetical protein OsI_09779 [Oryza sativa Indica Group]
Length=1883

 Score =   204 bits (518),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 183/300 (61%), Gaps = 18/300 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD + I  P   + P +  +
Sbjct  1475  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPEEIPPPKPYDIPESIMR  1534

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              +N   L+   +L   F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1535  SINFDTLKG--VLGIEFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1592

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ---  594
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++   
Sbjct  1593  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELL  1652

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
                 ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1653  KPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPM  1711

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1712  HPVRELQERCQQQAEGLE-----YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLA  1765



>sp|Q8LMR2.1|DCL1_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 1; AltName: Full=Dicer-like 
protein 1; Short=OsDCL1 [Oryza sativa Japonica Group]
 gb|AAM52322.1|AC105363_11 Putative CAF protein [Oryza sativa Japonica Group]
 gb|ABF93701.1| DEAD/DEAH box helicase carpel factory, putative, expressed [Oryza 
sativa Japonica Group]
Length=1883

 Score =   204 bits (518),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 183/300 (61%), Gaps = 18/300 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD + I  P   + P +  +
Sbjct  1475  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPEEIPPPKPYDIPESIMR  1534

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              +N   L+   +L   F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1535  SINFDTLKG--VLGIEFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1592

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ---  594
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++   
Sbjct  1593  FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELL  1652

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
                 ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1653  KPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPM  1711

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1712  HPVRELQERCQQQAEGLE-----YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLA  1765



>ref|XP_007220573.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
 gb|EMJ21772.1| hypothetical protein PRUPE_ppa000070mg [Prunus persica]
Length=1971

 Score =   204 bits (518),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 155/253 (61%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI-----DAPIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G++++F        P     P N  
Sbjct  1568  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEVEFNPDGVESTPKSSTVPENVL  1627

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN  F+D  LLVEA++H S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1628  RSVNFDALEG--ALNSKFKDRGLLVEAISHASRPSAGVSCYQRLEFVGDAVLDHLITRHL  1685

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1686  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIHDFVKEVQNEL  1745

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1746  SKPGFNSFGLGDCKAPKVLGDIFESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPM  1805

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1806  HPVRELQERCQQQ  1818


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    RD        S ++EALT  S     T  Y+
Sbjct  1389  PLPGSLVRGAQRLPSIMRRVESMLLAVELRDIINYPIPASKILEALTAASC--QETFCYE  1446

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1447  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1502



>ref|XP_010054145.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Eucalyptus 
grandis]
Length=1930

 Score =   204 bits (518),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/298 (40%), Positives = 177/298 (59%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID-----APIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA  F++W+G+ ++F +     A    N P +  
Sbjct  1530  RVLSSKTLADVVEALIGVYYVEGGKNAANHFMKWVGIRVEFDNDEKECAIRPSNVPESIL  1589

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LES   LN  F D   L+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1590  RSVNFDALES--ALNLKFNDRGFLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1647

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1648  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIRDFVKEVQDEL  1707

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTP+ L +
Sbjct  1708  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGHDTAVVWKAFQPLLHPMVTPDRLPM  1767

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++      ++G    T+EV  + GV+   +    +K A++LA
Sbjct  1768  HPVRELQERCQQQAEGLE--YKASRNGN-LATVEVFVD-GVQVGVAQNPQKKMAQKLA  1821



>ref|XP_011071729.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Sesamum 
indicum]
Length=1934

 Score =   203 bits (517),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/299 (41%), Positives = 179/299 (60%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIV-GNFPLNAE  948
             R +  +T+ADV EALIG +    G+ AA   ++W+G++IDF    I+  I     P N  
Sbjct  1531  RVLSGKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEIDFDLKEINYSIKPSTVPDNIL  1590

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1591  RTIDFDALEGS--LNVKFTDRGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1648

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1649  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALEKQIRDFVKEVQNEL  1708

Query  587   AS---STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
             +    ++FG +     P VL DI+ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L 
Sbjct  1709  SKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGCNTAAVWKVFQPLLNPMVTPETLP  1767

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      ++G    T+EV  + GV+   +    +K A++LA
Sbjct  1768  MHPVRELQERCQQQAEGLE--YKASRNGN-LATVEVYVD-GVQVGVAHNPQKKMAQKLA  1822


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1349  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDIISYPVPASKILEALTAASC--QETFCYE  1406

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1407  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNIVLYQYALNKGLQSYI  1462



>gb|EPS58332.1| hypothetical protein M569_16483, partial [Genlisea aurea]
Length=554

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/268 (41%), Positives = 163/268 (61%), Gaps = 7/268 (3%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGR--RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             +E  +  G+L S     R +  +T+ADV EALIG +    G+ AA   +RW+G++IDF  
Sbjct  187   EESEMEDGELESDSSSYRVLSGKTLADVVEALIGIYYVEGGKNAANHLMRWIGIEIDFDL  246

Query  983   APIVGNFPLNAEQMVNVKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLE  813
               I  +   +    + ++ ++ ++L   LN  F+D   L+EA+TH S    G   YQRLE
Sbjct  247   DEIGPSIKPSCVPDIILRSVDFEALEGSLNARFKDRGFLIEAITHASRPSSGVSCYQRLE  306

Query  812   FLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTAL  633
             F+GDAVLD+ +TRH +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL
Sbjct  307   FVGDAVLDHLITRHLFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHAHLRHGSSAL  366

Query  632   RSSIADFVKNIEQSSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI  459
                I DFVK +++  +   F    +     P VL DI+ES+AGAI+LD G  T  V++  
Sbjct  367   DKQIRDFVKEVQKELSEPGFNSFGLGDCKAPKVLGDIVESVAGAIFLDGGCNTRDVWKVF  426

Query  458   RPVLEPMVTPESLRLNPVKELTELCQKR  375
             +P+L+PMVTPE+L ++PV+EL E CQ +
Sbjct  427   QPLLDPMVTPETLPMHPVRELQERCQHQ  454


 Score = 51.6 bits (122),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
            P+ G+    A+++ ++ R     LL    +D        + ++EALT  S     T  Y+
Sbjct  26   PLSGSLVRGAQRLPSIMRRIESMLLAVQLKDTINYPVPATKILEALTAASC--QETFCYE  83

Query  821  RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
            R E LGDA L + V++  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  84   RAELLGDAYLKWVVSKFLFLKYPQKHEGQLTRMRQQMVSNVVLYQYALQKGLQSYI  139



>ref|XP_008373031.1| PREDICTED: endoribonuclease Dicer homolog 2-like isoform X2 [Malus 
domestica]
Length=665

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 140/209 (67%), Gaps = 7/209 (3%)
 Frame = -3

Query  1163  LDQECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID  984
             L++E +     +Y  G RK+D + + DV EALIGAFLST GE+ A+ F+ W+G+++D   
Sbjct  461   LNEELLFNKRSIYVGGTRKIDTKVVGDVVEALIGAFLSTGGELDAIYFMNWVGIEVDXDH  520

Query  983   APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG  804
                  + P+  E++++V  LE  SLL Y F DPSLLVEAL+HGSY+P G   YQRLEFLG
Sbjct  521   IRYERHLPVQPEKLIDVGHLE--SLLGYKFCDPSLLVEALSHGSYMPGG---YQRLEFLG  575

Query  803   DAVLDYAVTRHFYDQYPGLF-PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS  627
             DAVLDY +T +FY +YPG+  PG LT++RS SVNN CYA S+VKAGLH +IL S    R 
Sbjct  576   DAVLDYMITTYFYYKYPGMMSPGFLTDMRSASVNNDCYARSAVKAGLHEHILASDIVHR-  634

Query  626   SIADFVKNIEQSSASSTFGWVLKTSFPWV  540
             +I   V N    S  STFG+  +TSF  V
Sbjct  635   NIDSTVNNFGLLSTESTFGFESETSFTSV  663



>ref|NP_001184881.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
 gb|AEE27221.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
Length=1910

 Score =   203 bits (516),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 158/253 (62%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1496  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1555

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1556  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1613

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct  1614  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES  1673

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct  1674  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM  1733

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1734  HPVRELQERCQQQ  1746



>ref|NP_171612.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
 sp|Q9SP32.2|DCL1_ARATH RecName: Full=Endoribonuclease Dicer homolog 1; AltName: Full=Dicer-like 
protein 1; Short=AtDCL1; AltName: Full=Protein ABNORMAL 
SUSPENSOR 1; AltName: Full=Protein CARPEL FACTORY; AltName: 
Full=Protein SHORT INTEGUMENTS 1; AltName: Full=Protein 
SUSPENSOR 1 [Arabidopsis thaliana]
 gb|AAG38019.1|AF292940_1 short integuments 1 [Arabidopsis thaliana]
 gb|AAG38020.1|AF292941_1 short integuments 1 [Arabidopsis thaliana]
 gb|AEE27220.1| endoribonuclease Dicer-like 1 [Arabidopsis thaliana]
Length=1909

 Score =   203 bits (516),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 158/253 (62%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1554

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1555  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1612

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct  1613  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES  1672

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct  1673  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM  1732

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1733  HPVRELQERCQQQ  1745



>gb|AAF03534.1|AF187317_1 CAF protein [Arabidopsis thaliana]
Length=1909

 Score =   203 bits (516),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 158/253 (62%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1554

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1555  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1612

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct  1613  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES  1672

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct  1673  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM  1732

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1733  HPVRELQERCQQQ  1745



>ref|XP_010474687.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Camelina 
sativa]
Length=1907

 Score =   203 bits (516),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 157/251 (63%), Gaps = 5/251 (2%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  939
             R + ++T+ADV EALIG +    G+IAA   ++W+G+ ++     + G   P N  + + 
Sbjct  1494  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDEPEEVEGTIKPANVPESIL  1553

Query  938   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
              ++  +  +  LN+ F++   LVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1554  KSIDFVGLERALNFEFKEKGFLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1613

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+ 
Sbjct  1614  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSK  1673

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++P
Sbjct  1674  PGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHP  1733

Query  407   VKELTELCQKR  375
             V+EL E CQ++
Sbjct  1734  VRELQERCQQQ  1744



>ref|XP_010474688.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Camelina 
sativa]
Length=1908

 Score =   203 bits (516),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 157/251 (63%), Gaps = 5/251 (2%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  939
             R + ++T+ADV EALIG +    G+IAA   ++W+G+ ++     + G   P N  + + 
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDEPEEVEGTIKPANVPESIL  1554

Query  938   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
              ++  +  +  LN+ F++   LVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1555  KSIDFVGLERALNFEFKEKGFLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1614

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+ 
Sbjct  1615  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSK  1674

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++P
Sbjct  1675  PGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHP  1734

Query  407   VKELTELCQKR  375
             V+EL E CQ++
Sbjct  1735  VRELQERCQQQ  1745



>ref|XP_010661522.1| PREDICTED: endoribonuclease Dicer homolog 1 [Vitis vinifera]
Length=1974

 Score =   203 bits (516),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/298 (40%), Positives = 175/298 (59%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F    IV      N P +  
Sbjct  1571  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIQVEFDPEDIVCATGPCNVPESIL  1630

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN  F +  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1631  RSVNFDTLEG--ALNIKFNNRGLLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1688

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1689  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHIHLRHGSSALEKQIRDFVKEVQDEL  1748

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1749  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPM  1808

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1809  HPVRELQERCQQQAEGLEYKATRSGN---LATVEVFID-GVQIGIAQNPQKKMAQKLA  1862


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+   +A+++ ++ R     LL    +D        + ++EALT  S     T  Y+
Sbjct  1389  PLPGSLVRSAQRLPSIMRRVESMLLAVQLKDVINYPVPAAKILEALTAASC--QETFCYE  1446

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N     S++  GL +YI
Sbjct  1447  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQSALCKGLQSYI  1502



>gb|AEZ02177.1| Dicer [Arabidopsis thaliana]
Length=1886

 Score =   202 bits (515),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 158/253 (62%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct  1472  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL  1531

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1532  KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1589

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct  1590  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES  1649

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct  1650  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM  1709

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1710  HPVRELQERCQQQ  1722



>gb|EMT07624.1| Endoribonuclease Dicer-1-like protein [Aegilops tauschii]
Length=1724

 Score =   202 bits (515),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 179/299 (60%), Gaps = 16/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   +RW+G    LD   I  P   N P +  +
Sbjct  1319  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMRWIGIHAELDPQEIPPPKPYNIPESILK  1378

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              ++ + LE   +L   F++   L+EA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1379  GIDFETLEG--VLGMKFQNKGFLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1436

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +V+  LH ++ H S+AL   I +FVK++ +  +
Sbjct  1437  FTYTDLPPGRLTDLRAAAVNNENFARVAVRRKLHGHLRHGSSALEKQIREFVKDVREEIS  1496

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
              S F    +     P VL DIIESIAGA++LDSG  T  V++  +P+LEP+VTPE+L ++
Sbjct  1497  KSGFNSFGLGDCKAPKVLGDIIESIAGAVFLDSGYDTSAVWKVFQPLLEPLVTPETLPMH  1556

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             P++EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1557  PIRELQERCQQQAEGLE-----YKASRAGNVATVEVFVD-GVQIGVAQNPQKKMAQKLA  1609



>gb|KHG02896.1| Endoribonuclease Dicer -like protein [Gossypium arboreum]
Length=1962

 Score =   202 bits (515),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 180/301 (60%), Gaps = 19/301 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL-------DIDFIDAPIVGNFPLN  954
             R + ++T+ADV EALIG +    G+ AA   ++W+G+       D+D I  P   N P +
Sbjct  1559  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIQVESDPDDMDSIVKP--SNVPES  1616

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
               + VN + LE    LN  F++ +LLVEA+TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1617  ILRSVNFEALEG--ALNIEFKNRALLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1674

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++ 
Sbjct  1675  HLFFTYTNLPPGRLTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFVKEVQD  1734

Query  593   ---SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
                    ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+
Sbjct  1735  ELLKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPET  1793

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL  243
             L ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++L
Sbjct  1794  LPMHPVRELQERCQQQAEGLE--YKASRSGN-LATVEVFID-GVQVGVAQNPQKKMAQKL  1849

Query  242   A  240
             A
Sbjct  1850  A  1850



>ref|XP_002961233.1| hypothetical protein SELMODRAFT_74321, partial [Selaginella moellendorffii]
 gb|EFJ38772.1| hypothetical protein SELMODRAFT_74321, partial [Selaginella moellendorffii]
Length=1291

 Score =   202 bits (513),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 176/309 (57%), Gaps = 12/309 (4%)
 Frame = -3

Query  1136  GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN---  966
             GK   +G R M ++T +D  EALIGA+    G   AL F++ L +D+DF    I  +   
Sbjct  971   GKTCGQGHRWMCSKTTSDALEALIGAYAVGGGFDGALEFMKALQVDVDFDSGLIAASQHR  1030

Query  965   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLD  789
               PL+A Q      L  +  L YTF++ +LL+EA+TH S  P     YQRLEF+GDAVLD
Sbjct  1031  PVPLDAVQFHMPALLSLEKELCYTFQNKALLLEAITHAS-TPDTVFCYQRLEFIGDAVLD  1089

Query  788   YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  609
             + VTRH +  +PGL PG L++LRS SVNN C A  +VK  LH+Y+ H S  LR+ I  F+
Sbjct  1090  FLVTRHLFTSHPGLSPGLLSDLRSASVNNDCLARVAVKHRLHSYLRHGSAELRAKITSFL  1149

Query  608   KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP  429
               +++    S        S P  LADI+ES+AGAI +DSG   + ++  ++ +L P VTP
Sbjct  1150  DVLDRDPECSVMFGFKALSGPKALADIVESVAGAILVDSGFDFEKLWVVLKRLLSPFVTP  1209

Query  428   ESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCS--SSARNRKT  255
              +L  +PV+E  ELC  + +  +   V    G    T E++   G +  +  SS +N+K 
Sbjct  1210  ATLSFHPVREFHELCSYKSWEFE--WVQSSSG---ATAEILLKAGEQRFTEVSSIKNKKD  1264

Query  254   AKRLACERM  228
             A++   E++
Sbjct  1265  ARKDVAEKL  1273



>tpg|DAA43005.1| TPA: hypothetical protein ZEAMMB73_941906 [Zea mays]
Length=1307

 Score =   201 bits (512),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 181/296 (61%), Gaps = 10/296 (3%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNV  933
             R + ++T+ADV EALIG +    G+IA    ++W+G++ +     I  + P N  + + +
Sbjct  902   RVLSSKTLADVVEALIGVYYVAGGKIATNHLMKWIGINAELDPQEIPSSKPYNIPESI-I  960

Query  932   KRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
             K +  D+L   L   F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H + 
Sbjct  961   KSINFDTLEGALGIKFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLFF  1020

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++  + 
Sbjct  1021  TYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELSK  1080

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI ESIAGAI+LDSG  T +V++  +P+L+PMVTP++L ++P
Sbjct  1081  PGFNSFGLGDCKAPKVLGDIFESIAGAIFLDSGCATSVVWKVFQPLLDPMVTPDTLPMHP  1140

Query  407   VKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             V+EL E CQ++   ++      + G    T+EV+ + G++   +    +K A++LA
Sbjct  1141  VRELQERCQQQAEGLE--YKASRTGNV-ATVEVLVD-GIQIGVAQNPQKKMAQKLA  1192



>gb|ERN08097.1| hypothetical protein AMTR_s00018p00015000 [Amborella trichopoda]
Length=2044

 Score =   202 bits (514),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/299 (40%), Positives = 183/299 (61%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNV  933
             R + ++T+ADV EALIG +     E AA   + W+G+ ++F D   +G+     +   +V
Sbjct  1642  RVLSSKTLADVVEALIGVYYVEGDEKAANHLMNWIGIQVEF-DPKEIGHELKGCQVSESV  1700

Query  932   KR-LESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              R ++ DSL   LN  F++ SLLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1701  MRSIDFDSLEGALNIKFKERSLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1760

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL S I +FV++++   +
Sbjct  1761  FTYTDLPPGRLTDLRAAAVNNENFARVAVKRKLHVHLRHGSSALESQIRNFVRDVQDELS  1820

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI++DSGL T +V++  +P+L PMVTPE+L ++
Sbjct  1821  KPGFNSFGLGDCKAPKVLGDIVESIAGAIFMDSGLNTAVVWKVFQPLLHPMVTPETLPMH  1880

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++     +K   A    T++V  + G+   ++    +K A++LA
Sbjct  1881  PVRELQERCQQQAEGLE-----YKASRAGNLATVQVFVD-GIEIGTAQNPQKKMAQKLA  1933


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDP-------SLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S+++EALT  S     T  Y+
Sbjct  1459  PLSGSLVRGAQRLPSIMRRIESMLLAIELKDKINYPVPSSMILEALTAASC--QETFCYE  1516

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1517  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQKIVSNIVLYQYALSKGLQSYI  1572



>ref|NP_001289827.1| endoribonuclease Dicer homolog 1 [Solanum lycopersicum]
 gb|AGN12837.1| dicer-like protein 1 [Solanum lycopersicum]
Length=1914

 Score =   202 bits (514),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/298 (40%), Positives = 177/298 (59%), Gaps = 11/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVN-  936
             R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF        + + +  +   
Sbjct  1511  RVLSSKTMADVVEALIGVYYVEGGKYAANHFMKWIGVEVDFDFNFKETEYSIRSCSIPEN  1570

Query  935   -VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
              +K +E D+L   LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1571  VLKSVEFDALQGALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1630

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH +  H S+AL   I DFV  ++   
Sbjct  1631  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHSLHLHFRHGSSALEKQIRDFVNEVKNEL  1690

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T  V+E  +P+L PMVTPE+L +
Sbjct  1691  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGCNTKSVWEVFQPLLHPMVTPETLPM  1750

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1751  HPVRELQERCQQQAQGLEYKAT--RSGNM-ATVEVYVD-GVQVGMAQNPQKKMAQKLA  1804


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    ++      P+L ++EALT  S     T  Y+
Sbjct  1329  PLPGSLVRGAQRLPSIMRRIESMLLAVQLKEMIGYPVPALKILEALTAASC--QETFCYE  1386

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N     +++  G+ +YI
Sbjct  1387  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQMVSNMVLYQNALSKGIQSYI  1442



>ref|XP_011624219.1| PREDICTED: endoribonuclease Dicer homolog 1 [Amborella trichopoda]
Length=2045

 Score =   202 bits (514),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/299 (40%), Positives = 183/299 (61%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNV  933
             R + ++T+ADV EALIG +     E AA   + W+G+ ++F D   +G+     +   +V
Sbjct  1643  RVLSSKTLADVVEALIGVYYVEGDEKAANHLMNWIGIQVEF-DPKEIGHELKGCQVSESV  1701

Query  932   KR-LESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              R ++ DSL   LN  F++ SLLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1702  MRSIDFDSLEGALNIKFKERSLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1761

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL S I +FV++++   +
Sbjct  1762  FTYTDLPPGRLTDLRAAAVNNENFARVAVKRKLHVHLRHGSSALESQIRNFVRDVQDELS  1821

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI++DSGL T +V++  +P+L PMVTPE+L ++
Sbjct  1822  KPGFNSFGLGDCKAPKVLGDIVESIAGAIFMDSGLNTAVVWKVFQPLLHPMVTPETLPMH  1881

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++     +K   A    T++V  + G+   ++    +K A++LA
Sbjct  1882  PVRELQERCQQQAEGLE-----YKASRAGNLATVQVFVD-GIEIGTAQNPQKKMAQKLA  1934


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRDP-------SLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S+++EALT  S     T  Y+
Sbjct  1460  PLSGSLVRGAQRLPSIMRRIESMLLAIELKDKINYPVPSSMILEALTAASC--QETFCYE  1517

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1518  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQKIVSNIVLYQYALSKGLQSYI  1573



>ref|XP_008437750.1| PREDICTED: endoribonuclease Dicer homolog 1 [Cucumis melo]
Length=1990

 Score =   202 bits (514),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 122/300 (41%), Positives = 178/300 (59%), Gaps = 17/300 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  951
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F DA  V       N P + 
Sbjct  1587  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIKVEF-DAGEVECGTRQSNLPESI  1645

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  771
              + V+   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1646  LRSVDFDALEG--ALNIKFQDRGLLVEAITHASRPSCGVSCYQRLEFVGDAVLDHLITRH  1703

Query  770   FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ-  594
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++  
Sbjct  1704  LFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQDE  1763

Query  593   --SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
                   ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L
Sbjct  1764  LLKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETL  1822

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              ++PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1823  PMHPVRELQERCQQQAEGLEYKATRIGN---LATVEVFID-GVQIGVAQNPQKKMAQKLA  1878



>ref|XP_011468880.1| PREDICTED: endoribonuclease Dicer homolog 1 [Fragaria vesca subsp. 
vesca]
Length=1932

 Score =   202 bits (514),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/254 (45%), Positives = 163/254 (64%), Gaps = 11/254 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF--PLNAEQMV  939
             R + ++T+ADV EALIG +    G+ AA   ++W+G+D++F +A  + N   P N    V
Sbjct  1528  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWVGIDVEF-NADEIENTTRPCNVPDSV  1586

Query  938   NVKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
              ++ ++ D+L   LN  FRD  LLVEA++H S    G   YQRLEF+GDAVLD+ +T+H 
Sbjct  1587  -LRSIDFDALEGALNIKFRDKGLLVEAISHASRPSSGVACYQRLEFVGDAVLDHLITKHL  1645

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK---NIE  597
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK   N  
Sbjct  1646  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHLHLRHGSSALERQIHDFVKEAANEL  1705

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DIIESIAGAI+LDSG  T +V++   P+L+PMVTPE+L 
Sbjct  1706  TKPGLNSFG-LGDCKAPKVLGDIIESIAGAIFLDSGRNTAVVWKVFEPLLQPMVTPETLP  1764

Query  416   LNPVKELTELCQKR  375
             ++PV+EL E CQ++
Sbjct  1765  MHPVRELQERCQQQ  1778


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (53%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ KR+ES         ++NY     S ++EALT  S     T  Y
Sbjct  1349  PLSGSLVRGAQRLPSIMKRVESMLLAVELKEIINYPV-PASKILEALTAASC--QETFCY  1405

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1406  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQKVSNMVLYHHALERGLQSYI  1462



>ref|XP_011650612.1| PREDICTED: endoribonuclease Dicer homolog 1 [Cucumis sativus]
 gb|KGN56328.1| hypothetical protein Csa_3G116650 [Cucumis sativus]
Length=1989

 Score =   202 bits (514),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 159/255 (62%), Gaps = 13/255 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  951
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F DA  V       N P + 
Sbjct  1586  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIKVEF-DAGEVECGTRQSNLPESI  1644

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  771
              + V+   LE    LN  F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1645  LRSVDFDALEG--ALNIKFQDRGLLVEAITHASRPSCGVSCYQRLEFVGDAVLDHLITRH  1702

Query  770   FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ-  594
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++  
Sbjct  1703  LFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHIHLRHGSSALEKQIRDFVKEVQDE  1762

Query  593   --SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
                   ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L
Sbjct  1763  LLKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETL  1821

Query  419   RLNPVKELTELCQKR  375
              ++PV+EL E CQ++
Sbjct  1822  PMHPVRELQERCQQQ  1836



>ref|XP_002969464.1| hypothetical protein SELMODRAFT_91347, partial [Selaginella moellendorffii]
 gb|EFJ29552.1| hypothetical protein SELMODRAFT_91347, partial [Selaginella moellendorffii]
Length=1255

 Score =   201 bits (511),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 176/309 (57%), Gaps = 12/309 (4%)
 Frame = -3

Query  1136  GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN---  966
             GK   +G R M ++T +D  EALIGA+    G   AL F++ L +D+DF    I  +   
Sbjct  935   GKTCGQGHRWMCSKTTSDALEALIGAYTVGGGFDGALEFMKALQVDVDFDSGLIAASQHR  994

Query  965   -FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLD  789
               PL+A Q      L  +  L YTF++ +LL+EA+TH S  P     YQRLEF+GDAVLD
Sbjct  995   PVPLDAVQFHMPALLSLEKELCYTFQNKALLLEAITHAS-TPDTVFCYQRLEFIGDAVLD  1053

Query  788   YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV  609
             + VTRH +  +PGL PG L++LRS SVNN C A  +VK  LH+Y+ H S  LR+ I  F+
Sbjct  1054  FLVTRHLFTSHPGLSPGLLSDLRSASVNNDCLARVAVKHRLHSYLRHGSAELRAKINSFL  1113

Query  608   KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP  429
               +++    S        S P  LADI+ES+AGAI +DSG   + ++  ++ +L P VTP
Sbjct  1114  DVLDRDPECSVMFGFKALSGPKALADIVESVAGAILVDSGFDFEKLWVVLKRLLSPFVTP  1173

Query  428   ESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCS--SSARNRKT  255
              +L  +PV+E  ELC  + +  +   V    G    T E++   G +  +  SS +N+K 
Sbjct  1174  ATLSFHPVREFHELCSYKSWEFE--WVQSSSG---ATAEILLKAGEQRFTEVSSIKNKKD  1228

Query  254   AKRLACERM  228
             A++   E++
Sbjct  1229  ARKDVAEKL  1237



>ref|XP_008244191.1| PREDICTED: endoribonuclease Dicer homolog 1 [Prunus mume]
Length=1953

 Score =   202 bits (514),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 154/253 (61%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFI-----DAPIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G++++F        P     P N  
Sbjct  1550  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEVEFNPDGVESTPKSSTVPENVL  1609

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN  F+D   LVEA++H S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1610  RSVNFDALEV--ALNIKFKDRGFLVEAISHASRPSAGVSCYQRLEFVGDAVLDHLITRHL  1667

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1668  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEKQIHDFVKEVQNEL  1727

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1728  SKPGFNSFGLGDCKAPKVLGDIFESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPM  1787

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1788  HPVRELQERCQQQ  1800


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1371  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDIINYPIPASKILEALTAASC--QETFCYE  1428

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1429  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1484



>ref|XP_006306578.1| hypothetical protein CARUB_v10008073mg [Capsella rubella]
 gb|EOA39476.1| hypothetical protein CARUB_v10008073mg [Capsella rubella]
Length=1906

 Score =   202 bits (513),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 156/251 (62%), Gaps = 5/251 (2%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  939
             R + ++T+ADV EALIG +    G+IAA   + W+G+ ++     + G   P N  + V 
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMTWIGIHVEDDPEEVEGTVKPANVPESVL  1554

Query  938   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
              ++  +  +  L + F+D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1555  KSIDFVGLERALKFEFQDKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1614

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+ 
Sbjct  1615  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSK  1674

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++P
Sbjct  1675  PGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRDTTAAWKVFQPLLQPMVTPETLPMHP  1734

Query  407   VKELTELCQKR  375
             V+EL E CQ++
Sbjct  1735  VRELQERCQQQ  1745



>ref|XP_006352611.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Solanum tuberosum]
Length=1914

 Score =   202 bits (513),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 177/300 (59%), Gaps = 15/300 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF------IDAPIVG-NFPLN  954
             R + ++T+ADV EALIG +    G+ AA  F++W+G+++DF       +  I   + P N
Sbjct  1511  RVLSSKTMADVVEALIGVYYVEGGKYAANHFMKWIGVEVDFDFNFKETEYSIRSCSIPEN  1570

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
               + V+   L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1571  VLKSVDFDALQG--ALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1628

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H+S+AL   I DFV  ++ 
Sbjct  1629  HLFFTYTDLPPGRLTDLRAAAVNNENFARVAVKHSLHLHLRHASSALEKQIRDFVNEVKN  1688

Query  593   SSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               +   F    +     P VL DI+ESIAGAI+LDSG  T  V+E  +P+L PMVTPE+L
Sbjct  1689  ELSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGCNTKSVWEVFQPLLHPMVTPETL  1748

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              ++PV+EL E CQ+    ++      + G    T+EV  + G++   +    +K A++LA
Sbjct  1749  PMHPVRELQERCQQEAQGLEYKAT--RSGNM-ATVEVYVD-GLQVGMAQNPQKKMAQKLA  1804


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (53%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    ++      P+L ++EALT  S     T  Y+
Sbjct  1329  PLPGSLVRGAQRLPSIMRRIESMLLAVQLKEMIGYPVPALKILEALTAASC--QETFCYE  1386

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N     +++  G+ +YI
Sbjct  1387  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQMVSNMVLYQNALSKGIQSYI  1442



>ref|XP_010457181.1| PREDICTED: endoribonuclease Dicer homolog 1 [Camelina sativa]
Length=1908

 Score =   202 bits (513),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 157/251 (63%), Gaps = 5/251 (2%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNF-PLNAEQMV-  939
             R + ++T+ADV EALIG +    G+IAA   ++W+G+ ++     + G   P N  + + 
Sbjct  1495  RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDEPEEVEGTIKPANVPESIL  1554

Query  938   -NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
              ++  +  +  L + F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH + 
Sbjct  1555  KSIDFVGLERALKFEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLFF  1614

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK ++  S+ 
Sbjct  1615  TYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVQTESSK  1674

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L ++P
Sbjct  1675  PGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPMHP  1734

Query  407   VKELTELCQKR  375
             V+EL E CQ++
Sbjct  1735  VRELQERCQQQ  1745



>ref|XP_010240123.1| PREDICTED: endoribonuclease Dicer homolog 4 [Brachypodium distachyon]
Length=1625

 Score =   201 bits (511),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 175/300 (58%), Gaps = 9/300 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFP  960
             ++    +  +TIADV E+L+GAFL   G  AA +FL W+G+D+DF D+ +       +  
Sbjct  1108  TKSHHWLHKKTIADVVESLLGAFLVEGGFKAAFAFLHWVGIDVDFEDSALYRVLNASSIN  1167

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             L+   ++NV  LE   L+ Y F+   L++EA  H S+  H    YQ+LEFLGDAVL+Y +
Sbjct  1168  LSLMNLINVAELEE--LIGYKFKHKGLIIEAFVHPSFNKHSGGCYQKLEFLGDAVLEYLM  1225

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T + Y  YP L PG +T+L+S +V N  +A  +++  +H YI+  S  L  +++ F   I
Sbjct  1226  TSYLYSAYPDLKPGEITDLKSLAVCNDSFAYVAIQKCIHKYIIKDSNHLTKAVSKFENYI  1285

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
             +  ++      V + + P VL DI+ES   A+ LDSG   + V++ +  +L+P+++   +
Sbjct  1286  KLPNSEKDL--VEEPACPKVLGDIVESCVAAVLLDSGFNLNYVWKLVLMLLKPVLSFSGM  1343

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +NP++E+ ELCQ  +  +  P  +  DGE    +EV  N  + SC+++ RN K A++LA
Sbjct  1344  HMNPMREIRELCQCNELELGLPKPMKADGEYHVKVEVNINSTMISCTAANRNSKVARKLA  1403



>ref|XP_007139041.1| hypothetical protein PHAVU_009G260000g [Phaseolus vulgaris]
 gb|ESW11035.1| hypothetical protein PHAVU_009G260000g [Phaseolus vulgaris]
Length=1950

 Score =   201 bits (512),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 157/254 (62%), Gaps = 11/254 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAE----  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+F  D       P N      
Sbjct  1549  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIQIEFDPDTLECARKPFNVPDSIL  1608

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1609  RSVNFDTLEG--ALNINFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1666

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   
Sbjct  1667  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQDEL  1726

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L 
Sbjct  1727  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTSVVWKVFQPLLHPMVTPETLP  1785

Query  416   LNPVKELTELCQKR  375
             ++PV+EL E CQ++
Sbjct  1786  MHPVRELQERCQQQ  1799



>ref|XP_006386668.1| Endoribonuclease Dicer family protein [Populus trichocarpa]
 gb|ERP64465.1| Endoribonuclease Dicer family protein [Populus trichocarpa]
Length=1967

 Score =   201 bits (512),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 177/297 (60%), Gaps = 11/297 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-NFPLNAEQMVN  936
             R + ++T+ADV EALIG +    G+ A    ++W+G+ ++F    I G + P N  + V 
Sbjct  1564  RVLSSKTLADVVEALIGVYYVEGGKNAVNHLMKWIGIQVEFDHEEIDGASRPFNVPESV-  1622

Query  935   VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             ++ ++ D+L   L+  F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1623  LRSVDFDTLEGALDIKFNDRGLLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1682

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV+ ++    
Sbjct  1683  FTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFVREVQDELL  1742

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++
Sbjct  1743  KPVFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWKVFQPLLHPMVTPETLPMH  1802

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1803  PVRELQERCQQQAEGLEYKATRSGN---LATVEVFID-GVQVGVAQNPQKKMAQKLA  1855


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1383  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDIINYPVPASKILEALTAASC--QETFCYE  1440

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1441  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1496



>ref|XP_008681621.1| PREDICTED: uncharacterized protein LOC100381417 isoform X1 [Zea 
mays]
Length=1801

 Score =   201 bits (511),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 181/296 (61%), Gaps = 10/296 (3%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNV  933
             R + ++T+ADV EALIG +    G+IA    ++W+G++ +     I  + P N  + + +
Sbjct  1396  RVLSSKTLADVVEALIGVYYVAGGKIATNHLMKWIGINAELDPQEIPSSKPYNIPESI-I  1454

Query  932   KRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
             K +  D+L   L   F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H + 
Sbjct  1455  KSINFDTLEGALGIKFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLFF  1514

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++  + 
Sbjct  1515  TYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELSK  1574

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI ESIAGAI+LDSG  T +V++  +P+L+PMVTP++L ++P
Sbjct  1575  PGFNSFGLGDCKAPKVLGDIFESIAGAIFLDSGCATSVVWKVFQPLLDPMVTPDTLPMHP  1634

Query  407   VKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             V+EL E CQ++   ++      + G    T+EV+ + G++   +    +K A++LA
Sbjct  1635  VRELQERCQQQAEGLE--YKASRTGNV-ATVEVLVD-GIQIGVAQNPQKKMAQKLA  1686



>gb|EMS58929.1| Endoribonuclease Dicer-like protein 1 [Triticum urartu]
Length=1577

 Score =   201 bits (511),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/299 (39%), Positives = 178/299 (60%), Gaps = 16/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ  945
             R + ++T+ADV EALIG +    G+IAA   ++W+G    LD   I  P   N P +  +
Sbjct  1172  RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPQEIPPPKPYNIPESILK  1231

Query  944   MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
              +  + LE   +L   F++   L+EA+TH S    G   YQRLEF+GDAVLD+ +T+H +
Sbjct  1232  GIEFETLEG--ILGMKFQNKGFLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLF  1289

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +V+  LH ++ H S+AL   I +FVK++ +  +
Sbjct  1290  FTYTDLPPGRLTDLRAAAVNNENFARVAVRRKLHTHLRHGSSALEKQIREFVKDVREEIS  1349

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
              S F    +     P VL DIIESIAGA++LDSG  T  V++  +P+LEP+VTPE+L ++
Sbjct  1350  KSGFNSFGLGDCKAPKVLGDIIESIAGAVFLDSGYDTSAVWKVFQPLLEPLVTPETLPMH  1409

Query  410   PVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             P++EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct  1410  PIRELQERCQQQAEGLE-----YKASRAGNVATVEVFVD-GVQIGVAQNPQKKMAQKLA  1462



>gb|KHN11363.1| Endoribonuclease Dicer like 1 [Glycine soja]
Length=1946

 Score =   201 bits (511),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/252 (43%), Positives = 158/252 (63%), Gaps = 7/252 (3%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAEQMVN  936
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+F  D       P N    + 
Sbjct  1545  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWMGIQIEFDPDTMDCTRKPFNVPDSI-  1603

Query  935   VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             ++ ++ D+L   LN  F+D  LLVE++TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1604  LRSVDFDALEGALNMKFKDRGLLVESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1663

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   +
Sbjct  1664  FTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQDELS  1723

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++
Sbjct  1724  KPGFNSFGLGDCKAPKVLGDILESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPMH  1783

Query  410   PVKELTELCQKR  375
             PV+EL E CQ++
Sbjct  1784  PVRELQERCQQQ  1795


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        +++NY  +  S ++EALT  S     T  Y
Sbjct  1365  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKNMINYPVQ-ASKILEALTAASC--QETFCY  1421

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1422  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALSKGLQSYI  1478



>ref|XP_006604922.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Glycine 
max]
 ref|XP_006604923.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Glycine 
max]
 ref|XP_006604924.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X3 [Glycine 
max]
 ref|XP_006604925.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X4 [Glycine 
max]
Length=1945

 Score =   201 bits (511),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/252 (43%), Positives = 158/252 (63%), Gaps = 7/252 (3%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAEQMVN  936
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+F  D       P N    + 
Sbjct  1544  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWMGIQIEFDPDTMDCTRKPFNVPDSI-  1602

Query  935   VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             ++ ++ D+L   LN  F+D  LLVE++TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1603  LRSVDFDALEGALNMKFKDRGLLVESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1662

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA  585
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++   +
Sbjct  1663  FTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQDELS  1722

Query  584   SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN  411
                F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++
Sbjct  1723  KPGFNSFGLGDCKAPKVLGDILESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPMH  1782

Query  410   PVKELTELCQKR  375
             PV+EL E CQ++
Sbjct  1783  PVRELQERCQQQ  1794


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 63/117 (54%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        +++NY  +  S ++EALT  S     T  Y
Sbjct  1364  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKNMINYPVQ-ASKILEALTAASC--QETFCY  1420

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1421  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALSKGLQSYI  1477



>ref|XP_011025346.1| PREDICTED: endoribonuclease Dicer homolog 1 [Populus euphratica]
Length=1970

 Score =   201 bits (510),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/299 (39%), Positives = 177/299 (59%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  948
             R + ++T+ADV EALIG +    G+ A    ++W+G++++F    + G     N P +  
Sbjct  1567  RVLSSKTLADVVEALIGVYYVEGGKNAVNHLMKWIGIEVEFDHEELDGASRPFNVPESVL  1626

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+  +LE    L+  F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1627  RSVDFDKLEG--ALDIKFNDRGLLIEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1684

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFV+ ++   
Sbjct  1685  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALEKQIRDFVREVQDEL  1744

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L 
Sbjct  1745  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTAFVWKVFQPLLHPMVTPETLP  1803

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1804  MHPVRELQERCQQQAEGLEYKATRSGN---LATVEVFID-GVQVGVAQNPQKKMAQKLA  1858


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKR--------LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ R        +E   ++NY     S ++EALT  S     T  Y
Sbjct  1386  PLPGSLVRGAQRLPSIMRRVESMLLAVELKEIINYPV-PASKILEALTAASC--QETFCY  1442

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1443  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1499



>ref|XP_010932228.1| PREDICTED: endoribonuclease Dicer homolog 4 [Elaeis guineensis]
Length=1628

 Score =   200 bits (509),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/302 (39%), Positives = 172/302 (57%), Gaps = 9/302 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQ  945
             ++    +  +TIADV EALIGAFL  +G  AA++FLRW+G+ +DF  + +     L+   
Sbjct  1115  TKSHHWLHKKTIADVVEALIGAFLVESGFKAAIAFLRWIGIQVDFEVSDVYRACELSKSN  1174

Query  944   M-----VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             M      NV  LE   LL  TFR   LL++AL H SY  H    YQ+LEFLGDAVL+Y +
Sbjct  1175  MSLIDGTNVAELEQ--LLCRTFRYKGLLMQALVHPSYNKHSGGCYQKLEFLGDAVLEYLI  1232

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T + Y  YP L PG +T+LRS +VNN  +A  +V   LH Y++  S +L  ++  F   I
Sbjct  1233  TSYLYSAYPDLKPGQITDLRSITVNNNSFAHVAVWRSLHKYLIKDSNSLTEAVNKFETFI  1292

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
                 +      + + + P VL DIIES  GA+ LD+G    +V+  +  +L+P+++  SL
Sbjct  1293  RLPESERDL--LEEPACPKVLGDIIESCVGAVLLDTGFNLKLVWRLMITLLKPVLSFSSL  1350

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +LNPV+EL ELCQ   + +  P            +EV A G   SC+++ +N K A+R+A
Sbjct  1351  QLNPVRELRELCQCYDFELGLPDPTKIKEGYFVKVEVDAKGNPLSCTATNKNSKAARRMA  1410

Query  239   CE  234
              +
Sbjct  1411  AQ  1412



>ref|XP_011083770.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X6 [Sesamum 
indicum]
Length=1572

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 180/313 (58%), Gaps = 14/313 (4%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  990
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1162  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1221

Query  989   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  816
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1222  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1279

Query  815   EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  636
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1280  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1339

Query  635   LRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIR  456
             L S I++FVK++   +  ST      T  P VL D++ESIAGAI +DS L  D V++  +
Sbjct  1340  LESQISEFVKHV---ADMSTTVLTPDTKGPKVLGDLVESIAGAILIDSSLNLDKVWKVFK  1396

Query  455   PVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC-TTIEVMANGGVRSCS  279
             P+L P+VTP+ L L P +EL ELC    Y +KE      DG+     +++     +    
Sbjct  1397  PLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFAA--DGDIVRAELKLQLEDVLLEAQ  1454

Query  278   SSARNRKTAKRLA  240
              S  NRK +K +A
Sbjct  1455  GSGPNRKASKGMA  1467



>ref|XP_011083691.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X5 [Sesamum 
indicum]
Length=1586

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 180/313 (58%), Gaps = 14/313 (4%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  990
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1162  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1221

Query  989   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  816
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1222  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1279

Query  815   EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  636
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1280  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1339

Query  635   LRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIR  456
             L S I++FVK++   +  ST      T  P VL D++ESIAGAI +DS L  D V++  +
Sbjct  1340  LESQISEFVKHV---ADMSTTVLTPDTKGPKVLGDLVESIAGAILIDSSLNLDKVWKVFK  1396

Query  455   PVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC-TTIEVMANGGVRSCS  279
             P+L P+VTP+ L L P +EL ELC    Y +KE      DG+     +++     +    
Sbjct  1397  PLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFAA--DGDIVRAELKLQLEDVLLEAQ  1454

Query  278   SSARNRKTAKRLA  240
              S  NRK +K +A
Sbjct  1455  GSGPNRKASKGMA  1467



>ref|XP_011083615.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X4 [Sesamum 
indicum]
Length=1616

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 180/313 (58%), Gaps = 14/313 (4%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  990
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1125  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1184

Query  989   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  816
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1185  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1242

Query  815   EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  636
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1243  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1302

Query  635   LRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIR  456
             L S I++FVK++   +  ST      T  P VL D++ESIAGAI +DS L  D V++  +
Sbjct  1303  LESQISEFVKHV---ADMSTTVLTPDTKGPKVLGDLVESIAGAILIDSSLNLDKVWKVFK  1359

Query  455   PVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC-TTIEVMANGGVRSCS  279
             P+L P+VTP+ L L P +EL ELC    Y +KE      DG+     +++     +    
Sbjct  1360  PLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFAA--DGDIVRAELKLQLEDVLLEAQ  1417

Query  278   SSARNRKTAKRLA  240
              S  NRK +K +A
Sbjct  1418  GSGPNRKASKGMA  1430



>ref|XP_011083398.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X1 [Sesamum 
indicum]
Length=1653

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 180/313 (58%), Gaps = 14/313 (4%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  990
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1162  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1221

Query  989   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  816
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1222  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1279

Query  815   EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  636
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1280  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1339

Query  635   LRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIR  456
             L S I++FVK++   +  ST      T  P VL D++ESIAGAI +DS L  D V++  +
Sbjct  1340  LESQISEFVKHV---ADMSTTVLTPDTKGPKVLGDLVESIAGAILIDSSLNLDKVWKVFK  1396

Query  455   PVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC-TTIEVMANGGVRSCS  279
             P+L P+VTP+ L L P +EL ELC    Y +KE      DG+     +++     +    
Sbjct  1397  PLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFAA--DGDIVRAELKLQLEDVLLEAQ  1454

Query  278   SSARNRKTAKRLA  240
              S  NRK +K +A
Sbjct  1455  GSGPNRKASKGMA  1467



>ref|XP_011083472.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X2 [Sesamum 
indicum]
Length=1651

 Score =   200 bits (508),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 180/313 (58%), Gaps = 14/313 (4%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  990
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1160  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1219

Query  989   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  816
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1220  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1277

Query  815   EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  636
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1278  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1337

Query  635   LRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIR  456
             L S I++FVK++   +  ST      T  P VL D++ESIAGAI +DS L  D V++  +
Sbjct  1338  LESQISEFVKHV---ADMSTTVLTPDTKGPKVLGDLVESIAGAILIDSSLNLDKVWKVFK  1394

Query  455   PVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC-TTIEVMANGGVRSCS  279
             P+L P+VTP+ L L P +EL ELC    Y +KE      DG+     +++     +    
Sbjct  1395  PLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFAA--DGDIVRAELKLQLEDVLLEAQ  1452

Query  278   SSARNRKTAKRLA  240
              S  NRK +K +A
Sbjct  1453  GSGPNRKASKGMA  1465



>ref|XP_011083544.1| PREDICTED: endoribonuclease Dicer homolog 3a isoform X3 [Sesamum 
indicum]
Length=1641

 Score =   200 bits (508),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 180/313 (58%), Gaps = 14/313 (4%)
 Frame = -3

Query  1157  QECVLTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLD----IDF  990
             ++  L  GK   RG R M ++TI+D  EALIGA+    G  AALS ++WLG++    +  
Sbjct  1150  EDAKLLLGKTCDRGHRWMGSKTISDCVEALIGAYYVGGGLTAALSLMKWLGVEAEVELSL  1209

Query  989   IDAPI-VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRL  816
             ID  I V +    A +  ++  LES   L Y F    LL+EA+TH +    G +  YQRL
Sbjct  1210  IDDAIRVASLYSYAPKAEDIFILESK--LGYIFSTKGLLLEAITHATEPDQGVRYCYQRL  1267

Query  815   EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA  636
             EFLGDAVLD  +T H Y+ +  + PG LT+LRS SVNN  +A+++VK  LH+++ H S  
Sbjct  1268  EFLGDAVLDILITLHLYENHKNVDPGDLTDLRSASVNNDNFAIAAVKRNLHSHLQHGSFY  1327

Query  635   LRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIR  456
             L S I++FVK++   +  ST      T  P VL D++ESIAGAI +DS L  D V++  +
Sbjct  1328  LESQISEFVKHV---ADMSTTVLTPDTKGPKVLGDLVESIAGAILIDSSLNLDKVWKVFK  1384

Query  455   PVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEAC-TTIEVMANGGVRSCS  279
             P+L P+VTP+ L L P +EL ELC    Y +KE      DG+     +++     +    
Sbjct  1385  PLLSPIVTPDKLELPPSRELMELCDSLGYFIKEHFAA--DGDIVRAELKLQLEDVLLEAQ  1442

Query  278   SSARNRKTAKRLA  240
              S  NRK +K +A
Sbjct  1443  GSGPNRKASKGMA  1455



>ref|XP_010241057.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nelumbo nucifera]
Length=2035

 Score =   200 bits (508),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 178/299 (60%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN-----FPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++F    I  +      P +  
Sbjct  1632  RVLSSKTLADVVEALIGVYYVEGGKQAANHLMKWIGIQVEFDPKEIESSNKPRAIPESIL  1691

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN + LE    LN  F+D  LLVE++TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1692  RSVNFEALEG--ALNIKFKDRGLLVESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1749

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I DFV +++   
Sbjct  1750  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHLHLRHGSSALEAQIRDFVNDVQDEL  1809

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L 
Sbjct  1810  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGGDTSVVWRVFQPLLHPMVTPETLP  1868

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++       +     T+EV  + GV+   +    +K A++LA
Sbjct  1869  MHPVRELQERCQQQAEGLEYKATRSGN---LATVEVYID-GVQVGIAQNPQKKMAQKLA  1923


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1450  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMINYPVLASKILEALTAASC--QETFCYE  1507

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1508  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKGLQSYI  1563



>ref|XP_009358497.1| PREDICTED: dicer-like protein 4 [Pyrus x bretschneideri]
Length=1624

 Score =   199 bits (507),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 179/305 (59%), Gaps = 16/305 (5%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGN--  966
             S+G   +  +TIADV EAL+GAF+  +G IAA +FL+W+G+ +DF      +A I  +  
Sbjct  1128  SKGHHWLYKKTIADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEACIASSRY  1187

Query  965   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  786
              PL+A   +N+  LE+  LL Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1188  IPLSA--CMNIAALEN--LLGYKFLHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDY  1243

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S++L  +I  +V 
Sbjct  1244  LITSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLISDSSSLSEAIESYVG  1303

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
              IE  +A+S  G +     P  L D++ES  GAI LD+G   + V+E +   L+P+++  
Sbjct  1304  FIE--TAASDRGLLDGPKCPKALGDLVESCLGAILLDTGFNLNRVWEIMLSFLKPIMSFS  1361

Query  425   SLRLNPVKELTELCQKRKYRMK-EPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAK  249
             SL+L+P++EL ELCQ   + ++  P  + K    C T+    N    S S+++ N+K   
Sbjct  1362  SLQLSPIRELRELCQAHSWGLEFVPTKMGKKYSVCATVN--GNNVCVSASTTSLNKKDGI  1419

Query  248   RLACE  234
             R+  +
Sbjct  1420  RICAQ  1424


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 69/164 (42%), Gaps = 32/164 (20%)
 Frame = -3

Query  830   SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNY--  657
             S +RLE LGDA L +AV RHF+ ++  L  G LT  RS  VNN+     + ++ L  Y  
Sbjct  1021  SLERLEILGDAFLKFAVGRHFFLRHGSLDEGGLTRKRSNVVNNSNLFKLATRSNLQVYIR  1080

Query  656   ------------------ILHSSTALRSSIADFVKNIEQSSASST-----FGWVLKTSFP  546
                               I +  T       D    +  +SAS         W+ K +  
Sbjct  1081  DQPFEPSQFFALGRPCPRICNEETVGAIHFHDLSGEVNHTSASEVRCSKGHHWLYKKT--  1138

Query  545   WVLADIIESIAGAIYLDSGLRTDIVFEK---IRPVLEPMVTPES  423
               +AD++E++ GA  +DSG      F K   I+   EP    E+
Sbjct  1139  --IADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEA  1180



>gb|ABV31244.1| dicer-like 1 [Physcomitrella patens]
Length=1662

 Score =   199 bits (507),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI---VGNFPLN  954
             S   R + ++T+ADV EA IG +    G+ AA   + W+G+ ++F DA     +G   + 
Sbjct  1253  SSAYRVLSSKTLADVVEAFIGIYYVEGGQDAATHLMNWIGIPVEFDDAEAELAIGGCEVP  1312

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
                M+++     ++ + + FR  SLLVEA+TH S    G   YQRLEF+GDAVLDY +TR
Sbjct  1313  ETVMLSIDFDSLEASIGHKFRKRSLLVEAITHASRPSSGVPGYQRLEFVGDAVLDYLITR  1372

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE-  597
               + +Y  L PG LT+LR+ +VNN  +A  +VK   H ++ H S+AL + I +FV +I+ 
Sbjct  1373  FLFFKYTDLPPGRLTDLRAAAVNNENFARVAVKHSFHLHLRHGSSALETQIRNFVNDIQT  1432

Query  596   --QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
                    ++FG +     P VL DI+ESIAGA++LD+ L TD V++   P+L+PMVTPE+
Sbjct  1433  ELDKPGVNSFG-LGDFKAPKVLGDILESIAGALFLDACLETDHVWKVFEPLLQPMVTPET  1491

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAK  249
             L ++PV+EL E CQ++   ++     +K   A    T+EV  + GV+  S+    +K A+
Sbjct  1492  LPMHPVRELQERCQQQAEALE-----YKASRAGNVATVEVYVD-GVQIGSAQNAQKKMAQ  1545

Query  248   RLA  240
             +LA
Sbjct  1546  KLA  1548


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLESDSL---LNYTFRDP---SLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ +V +R+ES  L   L +    P   S ++EALT  S     T SY+
Sbjct  1068  PLPGSLVRGAQRLPSVMRRVESMLLAIQLKHQIDYPIAASKVLEALTAASC--QETFSYE  1125

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N+     ++  GL +YI
Sbjct  1126  RAELLGDAYLKWVVSRRLFLKYPCKHEGQLTRMRQQIVSNSVLYQYALDKGLQSYI  1181



>gb|KHN16394.1| Endoribonuclease Dicer like 1 [Glycine soja]
Length=1948

 Score =   199 bits (507),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 159/253 (63%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAEQMVN  936
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+F  D       P N    + 
Sbjct  1547  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIQIEFDPDTMECTKKPFNVPDSI-  1605

Query  935   VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             ++ ++ D+L   LN  F D  LLVE++TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1606  LRSVDFDALEGALNMKFNDRGLLVESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1665

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE---Q  594
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++    
Sbjct  1666  FTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQVELS  1725

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
                 ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1726  KPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPM  1784

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1785  HPVRELQERCQQQ  1797



>ref|XP_006577359.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Glycine max]
Length=1947

 Score =   199 bits (507),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 159/253 (63%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVGNFPLNAEQMVN  936
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+F  D       P N    + 
Sbjct  1546  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIQIEFDPDTMECTKKPFNVPDSI-  1604

Query  935   VKRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY  765
             ++ ++ D+L   LN  F D  LLVE++TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct  1605  LRSVDFDALEGALNMKFNDRGLLVESITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF  1664

Query  764   DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE---Q  594
               Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++    
Sbjct  1665  FTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSSALEKQIKEFVKEVQVELS  1724

Query  593   SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
                 ++FG +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L +
Sbjct  1725  KPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTTVVWKVFQPLLHPMVTPETLPM  1783

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1784  HPVRELQERCQQQ  1796



>ref|XP_009606996.1| PREDICTED: endoribonuclease Dicer homolog 1 [Nicotiana tomentosiformis]
Length=1907

 Score =   199 bits (507),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 179/299 (60%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVG-NFPLNAE  948
             R + ++T+ADV E+LIG +    G+ AA  F++W+G+++DF     +  I   + P N  
Sbjct  1506  RVLSSKTMADVVESLIGVYYVDGGKYAANHFMKWIGVEVDFDFKETEYSIRPYSIPENVL  1565

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+  +L+    LN +F D  LL+EA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1566  RSVDFDKLQG--ALNISFNDKGLLLEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1623

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF---VKNIE  597
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DF   VKN  
Sbjct  1624  FFTYTDLPPGRLTDLRAAAVNNENFARVAVKHSLHLHLRHGSSALEKQIRDFVSEVKNEL  1683

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI ESIAGAI+LDSG  T  V++  +P+L PMVTPE+L 
Sbjct  1684  SKPGFNSFG-LGDCKAPKVLGDIFESIAGAIFLDSGCDTAAVWKVFQPLLHPMVTPETLP  1742

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + G++   +    +K A++LA
Sbjct  1743  MHPVRELQERCQQQAQGLE--YKASRSGN-IATVEVYVD-GIQVGMAQNPQKKMAQKLA  1797


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 60/116 (52%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD------PSL-LVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D      P+L ++EALT  S     T  Y+
Sbjct  1324  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDMIGYPVPALKILEALTAASC--QETFCYE  1381

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1382  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQLVSNMVLYQYALNKGLQSYI  1437



>ref|XP_001757950.1| dsRNA-specific nuclease dicer and related ribonuclease [Physcomitrella 
patens]
 gb|EDQ77192.1| dsRNA-specific nuclease dicer and related ribonuclease [Physcomitrella 
patens]
Length=1662

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 181/303 (60%), Gaps = 15/303 (5%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI---VGNFPLN  954
             S   R + ++T+ADV EA IG +    G+ AA   + W+G+ ++F DA     +G   + 
Sbjct  1253  SSAYRVLSSKTLADVVEAFIGIYYVEGGQDAATHLMNWIGIPVEFDDAEAELAIGGCEVP  1312

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
                M+++     ++ + + FR  SLLVEA+TH S    G   YQRLEF+GDAVLDY +TR
Sbjct  1313  ETVMLSIDFDSLEASIGHKFRKRSLLVEAITHASRPSSGVPCYQRLEFVGDAVLDYLITR  1372

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE-  597
               + +Y  L PG LT+LR+ +VNN  +A  +VK   H ++ H S+AL + I +FV +I+ 
Sbjct  1373  FLFFKYTDLPPGRLTDLRAAAVNNENFARVAVKHSFHLHLRHGSSALETQIRNFVNDIQT  1432

Query  596   --QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
                    ++FG +     P VL DI+ESIAGA++LD+ L TD V++   P+L+PMVTPE+
Sbjct  1433  ELDKPGVNSFG-LGDFKAPKVLGDILESIAGALFLDACLETDHVWKVFEPLLQPMVTPET  1491

Query  422   LRLNPVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAK  249
             L ++PV+EL E CQ++   ++     +K   A    T+EV  + GV+  S+    +K A+
Sbjct  1492  LPMHPVRELQERCQQQAEALE-----YKASRAGNVATVEVYVD-GVQIGSAQNAQKKMAQ  1545

Query  248   RLA  240
             +LA
Sbjct  1546  KLA  1548


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLESDSL---LNYTFRDP---SLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ +V +R+ES  L   L +    P   S ++EALT  S     T SY+
Sbjct  1068  PLPGSLVRGAQRLPSVMRRVESMLLAIQLKHQIDYPIAASKVLEALTAASC--QETFSYE  1125

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N+     ++  GL +YI
Sbjct  1126  RAELLGDAYLKWVVSRRLFLKYPCKHEGQLTRMRQQIVSNSVLYQYALDKGLQSYI  1181



>ref|XP_002892088.1| hypothetical protein ARALYDRAFT_333551 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68347.1| hypothetical protein ARALYDRAFT_333551 [Arabidopsis lyrata subsp. 
lyrata]
Length=1962

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 158/253 (62%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE  948
             R + ++T+ADV EALIG +    G++AA   ++W+G+    D D ++  +   N P +  
Sbjct  1548  RVLSSKTLADVVEALIGVYYVEGGKVAANHLMKWIGIHVEDDPDEVEGTVKNVNVPESVL  1607

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + ++   LE    L + F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1608  KSIDFVGLER--ALKFEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1665

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct  1666  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES  1725

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct  1726  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM  1785

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1786  HPVRELQERCQQQ  1798


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct  1371  PLSGSLVRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE  1428

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R+ + +YP    G LT +R + V+N      ++  GL +YI
Sbjct  1429  RAELLGDAYLKWVVSRYLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI  1484



>ref|XP_002991516.1| hypothetical protein SELMODRAFT_448444 [Selaginella moellendorffii]
 gb|EFJ07438.1| hypothetical protein SELMODRAFT_448444 [Selaginella moellendorffii]
Length=1719

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 118/305 (39%), Positives = 179/305 (59%), Gaps = 16/305 (5%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF----IDAPIVGNFPL  957
             + G R +  + +ADV EALIGA+L+T+G  +A+  ++ LG+DI+F    + +    + P 
Sbjct  1392  ANGHRGIRRKALADVVEALIGAYLATSGPPSAMELMKQLGIDIEFDIGLLASARQASLPA  1451

Query  956   NAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVT  777
              + Q +       +  L Y F++ SLLVEA+TH S  P+    YQRLEFLGD VLD+ V+
Sbjct  1452  ESFQHLQASLESLEHKLQYKFQNRSLLVEAITHASQ-PNCLLCYQRLEFLGDGVLDFLVS  1510

Query  776   RHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  597
             RH ++ +PGL PG LT+LRS +VNN  +A   ++ GLH ++ H S  L   I  FV+N++
Sbjct  1511  RHLFETHPGLPPGTLTDLRSAAVNNKWFARLVLRHGLHQHLQHGSVELDCEIRKFVQNVK  1570

Query  596   QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
             +   +S F      S P VL D++ESI GAI++D+    + ++  + P+L P+VTP +LR
Sbjct  1571  EKPDASCFE---DLSAPKVLGDLLESITGAIFVDTNFDLEKLWRVVLPLLSPLVTPATLR  1627

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSC--SSSARNRKTAKRL  243
              +PV+ L ELC ++  +     V     EA TT EV    G  S   +S  + RK+AK  
Sbjct  1628  FHPVRILMELCARKGMK-----VSFFRTEA-TTTEVRVTFGEESLVETSQEKPRKSAKID  1681

Query  242   ACERM  228
             A  +M
Sbjct  1682  AALKM  1686



>gb|AES82838.2| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1880

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 156/255 (61%), Gaps = 13/255 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-------IDAPIVGNFPLN  954
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+        I  P   N P +
Sbjct  1478  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIHIEIDPDEMECITKP--SNVPDS  1535

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
               + V+   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1536  ILRSVDFDALEG--ALNIKFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1593

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++ 
Sbjct  1594  HLFFSYTDLPPGRLTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQD  1653

Query  593   SSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L
Sbjct  1654  ELSKPGFNSFGLGDCKAPKVLGDILESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETL  1713

Query  419   RLNPVKELTELCQKR  375
              ++PV+EL E CQ++
Sbjct  1714  PMHPVRELQERCQQQ  1728


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 11/118 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        +++NY  +  S ++EALT  S     T  Y
Sbjct  1299  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKNMINYPVQ-ASKILEALTAASC--QETFCY  1355

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL  651
             +R E LGDA L + V+R  + ++P    G LT +R + V+N      ++  GL +YIL
Sbjct  1356  ERAELLGDAYLKWVVSRFLFLKHPQKHEGQLTRMRQQMVSNMVLYRYALSKGLQSYIL  1413



>gb|KEH24704.1| endoribonuclease dicer-like protein [Medicago truncatula]
Length=1841

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 156/255 (61%), Gaps = 13/255 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-------IDAPIVGNFPLN  954
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+        I  P   N P +
Sbjct  1439  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIHIEIDPDEMECITKP--SNVPDS  1496

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
               + V+   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1497  ILRSVDFDALEG--ALNIKFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1554

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++ 
Sbjct  1555  HLFFSYTDLPPGRLTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQD  1614

Query  593   SSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L
Sbjct  1615  ELSKPGFNSFGLGDCKAPKVLGDILESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETL  1674

Query  419   RLNPVKELTELCQKR  375
              ++PV+EL E CQ++
Sbjct  1675  PMHPVRELQERCQQQ  1689


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 11/118 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        +++NY  +  S ++EALT  S     T  Y
Sbjct  1260  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKNMINYPVQ-ASKILEALTAASC--QETFCY  1316

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL  651
             +R E LGDA L + V+R  + ++P    G LT +R + V+N      ++  GL +YIL
Sbjct  1317  ERAELLGDAYLKWVVSRFLFLKHPQKHEGQLTRMRQQMVSNMVLYRYALSKGLQSYIL  1374



>ref|NP_001266210.1| dicer-like protein 4 [Solanum lycopersicum]
 gb|AFO53518.1| dicer-like protein 4 [Solanum lycopersicum]
Length=1620

 Score =   199 bits (505),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 175/306 (57%), Gaps = 18/306 (6%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-------N  966
             S+    +  +TIAD+ EAL+GAF+  +G  AA++FL+W+G+  DF +  +          
Sbjct  1124  SKYHHWLRKKTIADIVEALVGAFVVDSGFKAAIAFLKWIGIHTDFKEPQLKSICSASKVF  1183

Query  965   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  786
              PL  E    +  L  + LL Y+F    LL++A  H SY  HG   YQRLEFLGDAVLDY
Sbjct  1184  MPLADE----IDVLGIERLLGYSFIHKGLLIQAFIHPSYNRHGGGCYQRLEFLGDAVLDY  1239

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +T + Y  YP L PG LT+LRS SVNN  +A+ +V+   H++IL  S+ LR SI  +V 
Sbjct  1240  LITSYLYSVYPKLKPGQLTDLRSISVNNNTFAVVAVRQSFHSHILCDSSDLRESITRYVN  1299

Query  605   NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE  426
              I      ST GWV     P  L D++ES  GAI LD+G   +  ++ I   L+P+++  
Sbjct  1300  FI--GRPDSTRGWVKSHLVPKALGDLVESCMGAILLDTGFDLNRAWQIILSFLKPVMSFT  1357

Query  425   SLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR--NRKTA  252
              L+LNP +EL ELCQ   + +K  +   KDG     +E   NG   S ++SA   N+K+A
Sbjct  1358  RLQLNPTRELYELCQSFGWNLKF-LPSKKDGN--FLVEARVNGENVSAAASALNINKKSA  1414

Query  251   KRLACE  234
             +R+A +
Sbjct  1415  QRMAAQ  1420


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 73/162 (45%), Gaps = 29/162 (18%)
 Frame = -3

Query  878   LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNA  699
             ++EALT  +   H + S +RLE LGDA L +AV RH +  +     G LT  RS +VNN+
Sbjct  1005  VLEALTTENC--HESFSLERLEVLGDAFLKFAVGRHLFLLHDAFDEGQLTRKRSNAVNNS  1062

Query  698   CYALSSVKAGLHNYILHSS-----------TALRSSIADFVKNIEQSSASSTFG------  570
                + ++K  L  YI   S               +      KNI     S T G      
Sbjct  1063  NLYMVAIKKNLQAYIRDQSFEPDHFYVVGRPCPVTCNKQTEKNIHGLCGSGTDGIKTEVR  1122

Query  569   ------WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK  462
                   W+ K +    +ADI+E++ GA  +DSG +  I F K
Sbjct  1123  CSKYHHWLRKKT----IADIVEALVGAFVVDSGFKAAIAFLK  1160



>gb|ABD32724.1| Helicase, C-terminal; Argonaute and Dicer protein, PAZ; Ribonuclease 
III, bacterial [Medicago truncatula]
Length=1939

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/255 (43%), Positives = 156/255 (61%), Gaps = 13/255 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-------IDAPIVGNFPLN  954
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+        I  P   N P +
Sbjct  1537  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIHIEIDPDEMECITKP--SNVPDS  1594

Query  953   AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR  774
               + V+   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+ +TR
Sbjct  1595  ILRSVDFDALEG--ALNIKFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDHLITR  1652

Query  773   HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ  594
             H +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++ 
Sbjct  1653  HLFFSYTDLPPGRLTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVKEVQD  1712

Query  593   SSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L
Sbjct  1713  ELSKPGFNSFGLGDCKAPKVLGDILESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETL  1772

Query  419   RLNPVKELTELCQKR  375
              ++PV+EL E CQ++
Sbjct  1773  PMHPVRELQERCQQQ  1787



>ref|XP_003626620.1| Endoribonuclease Dicer-like protein [Medicago truncatula]
Length=1965

 Score =   199 bits (506),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 157/259 (61%), Gaps = 13/259 (5%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-------IDAPIVGN  966
             S   R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+        I  P   N
Sbjct  1559  SSSYRVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIHIEIDPDEMECITKP--SN  1616

Query  965   FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY  786
              P +  + V+   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+
Sbjct  1617  VPDSILRSVDFDALEG--ALNIKFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDH  1674

Query  785   AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK  606
              +TRH +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK
Sbjct  1675  LITRHLFFSYTDLPPGRLTDLRAAAVNNENFARVTVKHNLHLHLRHGSSALEKQIKDFVK  1734

Query  605   NIEQSSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT  432
              ++   +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVT
Sbjct  1735  EVQDELSKPGFNSFGLGDCKAPKVLGDILESIAGAIFLDSGRNTAVVWKVFQPLLHPMVT  1794

Query  431   PESLRLNPVKELTELCQKR  375
             PE+L ++PV+EL E CQ++
Sbjct  1795  PETLPMHPVRELQERCQQQ  1813


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 11/118 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        +++NY  +  S ++EALT  S     T  Y
Sbjct  1384  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKNMINYPVQ-ASKILEALTAASC--QETFCY  1440

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL  651
             +R E LGDA L + V+R  + ++P    G LT +R + V+N      ++  GL +YIL
Sbjct  1441  ERAELLGDAYLKWVVSRFLFLKHPQKHEGQLTRMRQQMVSNMVLYRYALSKGLQSYIL  1498



>gb|ABR17101.1| unknown [Picea sitchensis]
Length=685

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 157/246 (64%), Gaps = 10/246 (4%)
 Frame = -3

Query  1097  ETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNVKRL--  924
             +TIADV EALIGA+L  +G  AAL+FL+W+G++IDF D  +VG   + +   +++ +   
Sbjct  163   KTIADVVEALIGAYLVDSGFGAALAFLKWIGIEIDF-DTSLVGEVCIRSRNNLSLIKCID  221

Query  923   --ESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPG  750
               E + LL Y F    LL+EA  H S+  H    YQRLEFLGDAVLDY +T + Y  YP 
Sbjct  222   IDELERLLGYNFSYKGLLLEAFAHPSFNEHNGGCYQRLEFLGDAVLDYIITSYLYSVYPD  281

Query  749   LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA---DFVKNIEQSSASS  579
             + PG LT++RS +VNN  +A  +V+ GL+ Y++  S +L S++    DF+K +  +   S
Sbjct  282   MKPGYLTDMRSMTVNNESFACVAVRHGLYMYLIQKSDSLSSAVTKYVDFMKALFTADRDS  341

Query  578   TFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE  399
                   K   P VL DI+ES AGA+ +D+G   D V++ +  +L+P+VTPE+L L PV+E
Sbjct  342   CDEPEPKC--PKVLGDIVESFAGALVIDTGFDLDCVWKLMLNILQPIVTPETLCLQPVRE  399

Query  398   LTELCQ  381
             L+E+CQ
Sbjct  400   LSEVCQ  405



>ref|XP_007051387.1| Helicase, C-terminal, Argonaute and Dicer protein, PAZ, Ribonuclease 
III, bacterial isoform 2 [Theobroma cacao]
 gb|EOX95544.1| Helicase, C-terminal, Argonaute and Dicer protein, PAZ, Ribonuclease 
III, bacterial isoform 2 [Theobroma cacao]
Length=1610

 Score =   199 bits (505),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 180/300 (60%), Gaps = 15/300 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIV-GNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+    D D +++ +   + P +  
Sbjct  1207  RVLSSKTLADVVEALIGIYYVEGGKNAANHLMKWIGIQVESDPDEMESMVTPSSVPESIL  1266

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN  F++ +LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1267  RSVNFDALEG--ALNIKFKNRALLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1324

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1325  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFVKEVQDEL  1384

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L 
Sbjct  1385  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTSVVWRVFQPLLHPMVTPETLP  1443

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC  237
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA 
Sbjct  1444  MHPVRELQERCQQQAEGLE--YKASRSGN-LATVEVFID-GVQIGVAQNPQKKMAQKLAA  1499



>ref|XP_004976180.1| PREDICTED: endoribonuclease Dicer homolog 4-like isoform X2 [Setaria 
italica]
Length=1327

 Score =   198 bits (503),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 174/302 (58%), Gaps = 9/302 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFP  960
             ++    +  +TIADV E+L+GAF+  +G  AA +FL W+G+++DF D  +       +  
Sbjct  812   TKSHHWLHRKTIADVVESLLGAFIVESGFKAAFAFLNWMGINVDFKDDALYRVLDASSAN  871

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             L+    +N+  LE   L+ Y F+   LL++A  H S+  H    YQR+EFLGDAVL+Y +
Sbjct  872   LSLMDYINISELEE--LIGYKFKHKGLLLQAFVHPSFNKHSGGCYQRMEFLGDAVLEYLM  929

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
               + Y  YP L PG +T+L+S +VNN  +A  ++K  +H Y++  S  L +++  F    
Sbjct  930   VSYLYSAYPDLKPGQITDLKSLAVNNTSFAYVAIKKSMHKYLIKDSKYLMAAVNKFENYF  989

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               S++        + + P VL DI+ES  GA+ LDSG   +  ++ +  +L+P+++   +
Sbjct  990   NLSNSEKDLSE--EPACPKVLGDIVESCVGAVLLDSGFNLNHAWKLMLMLLKPILSFCDM  1047

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +NP++EL ELCQ   + +  P  +  DGE    +EV  NG + SC+++ +N K A++LA
Sbjct  1048  HINPLRELRELCQCNGFDLGLPKPIKADGEFHVKVEVNVNGKMISCTAANQNSKHARKLA  1107

Query  239   CE  234
              +
Sbjct  1108  AQ  1109



>gb|KJB09575.1| hypothetical protein B456_001G150400 [Gossypium raimondii]
Length=1892

 Score =   198 bits (504),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 180/299 (60%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIV-GNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+    D D +D+ +   N P +  
Sbjct  1548  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIQVESDPDEMDSIVKPSNVPESIL  1607

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN + LE    L   F++ +LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1608  RSVNFEALEG--ALKIEFKNRALLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1665

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1666  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHLLHVHLRHGSSALEKQIRDFVKEVQDEL  1725

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L 
Sbjct  1726  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLP  1784

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1785  MHPVRELQERCQQQAEGLE--YKASRSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLA  1839



>gb|KJB09576.1| hypothetical protein B456_001G150400 [Gossypium raimondii]
Length=1950

 Score =   198 bits (504),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 180/299 (60%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIV-GNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+    D D +D+ +   N P +  
Sbjct  1548  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIQVESDPDEMDSIVKPSNVPESIL  1607

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN + LE    L   F++ +LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1608  RSVNFEALEG--ALKIEFKNRALLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1665

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1666  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHLLHVHLRHGSSALEKQIRDFVKEVQDEL  1725

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L 
Sbjct  1726  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTAVVWRVFQPLLHPMVTPETLP  1784

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1785  MHPVRELQERCQQQAEGLE--YKASRSGN-LATVEVFID-GVQVGVAQNPQKKMAQKLA  1839



>ref|XP_007051386.1| Dicer-like 1 isoform 1 [Theobroma cacao]
 gb|EOX95543.1| Dicer-like 1 isoform 1 [Theobroma cacao]
Length=2007

 Score =   198 bits (504),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 180/299 (60%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIV-GNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+    D D +++ +   + P +  
Sbjct  1604  RVLSSKTLADVVEALIGIYYVEGGKNAANHLMKWIGIQVESDPDEMESMVTPSSVPESIL  1663

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN  F++ +LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1664  RSVNFDALEG--ALNIKFKNRALLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1721

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK ++   
Sbjct  1722  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHQLHVHLRHGSSALEKQIRDFVKEVQDEL  1781

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDSG  T +V+   +P+L PMVTPE+L 
Sbjct  1782  LKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSGRDTSVVWRVFQPLLHPMVTPETLP  1840

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1841  MHPVRELQERCQQQAEGLE--YKASRSGN-LATVEVFID-GVQIGVAQNPQKKMAQKLA  1895



>ref|XP_009335261.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=1971

 Score =   198 bits (504),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 172/298 (58%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDA-----PIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G++I+         P   + P +  
Sbjct  1569  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEIELDPNGLECIPKPSSVPESVL  1628

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN+ F D   LVEA++H S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1629  RSVNFDALEG--ALNFKFSDRGFLVEAISHASRPSAGVSCYQRLEFVGDAVLDHLITRHL  1686

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFVK +    
Sbjct  1687  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHNLHVHLRHGSTALEKQIHDFVKEVGNEL  1746

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI ESIAGA++LDSG  T  V++  +P+L+PMVTPE+L +
Sbjct  1747  SKPGFNSFGLGDCKAPKVLGDIFESIAGAVFLDSGRDTGAVWKVFQPLLQPMVTPETLPM  1806

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ+    ++      + G    T+EV  + G++   +    +K A++LA
Sbjct  1807  HPVRELQERCQQLAEGLEYKAT--RSGNV-ATVEVFID-GIQMAIAQNPQKKMAQKLA  1860


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1390  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDMINYSVPASKILEALTAASC--QETFCYE  1447

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1448  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1503



>ref|XP_010107130.1| Endoribonuclease Dicer-1-like protein [Morus notabilis]
 gb|EXC13651.1| Endoribonuclease Dicer-1-like protein [Morus notabilis]
Length=1941

 Score =   198 bits (503),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 156/253 (62%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G++++F    I       N P +  
Sbjct  1539  RVLSSKTLADVVEALIGVYYVEGGKKAANHLMKWIGIEVEFDPDEIECTRRPSNVPDSVL  1598

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+   LE    LN  F D  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H 
Sbjct  1599  RSVDFGALEG--ALNIRFEDRVLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHL  1656

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +V+  LH ++ H S+AL   I DFVK ++   
Sbjct  1657  FFSYTNLPPGRLTDLRAAAVNNENFARVAVRHNLHVHLRHGSSALEKQIRDFVKEVQSEL  1716

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI+ESIAGAI+LDSG  + +V++   P+L+PMVTPE+L +
Sbjct  1717  SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRDSAVVWKVFEPLLQPMVTPETLPM  1776

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1777  HPVRELQERCQQQ  1789


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 63/122 (52%), Gaps = 9/122 (7%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLESDSL---LNYTFRDP---SLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ +R+ES  L   L +    P   S ++EALT  S     T  Y+
Sbjct  1357  PLPGSLVRGAQRLPSIMRRVESMLLAIQLKHIINHPVPASKILEALTASSC--QETFCYE  1414

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSS  642
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI   S
Sbjct  1415  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQKVSNMVLYQYALGKGLQSYIQADS  1474

Query  641   TA  636
              A
Sbjct  1475  FA  1476



>ref|XP_004976179.1| PREDICTED: endoribonuclease Dicer homolog 4-like isoform X1 [Setaria 
italica]
Length=1632

 Score =   198 bits (503),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 174/302 (58%), Gaps = 9/302 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFP  960
             ++    +  +TIADV E+L+GAF+  +G  AA +FL W+G+++DF D  +       +  
Sbjct  1117  TKSHHWLHRKTIADVVESLLGAFIVESGFKAAFAFLNWMGINVDFKDDALYRVLDASSAN  1176

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             L+    +N+  LE   L+ Y F+   LL++A  H S+  H    YQR+EFLGDAVL+Y +
Sbjct  1177  LSLMDYINISELEE--LIGYKFKHKGLLLQAFVHPSFNKHSGGCYQRMEFLGDAVLEYLM  1234

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
               + Y  YP L PG +T+L+S +VNN  +A  ++K  +H Y++  S  L +++  F    
Sbjct  1235  VSYLYSAYPDLKPGQITDLKSLAVNNTSFAYVAIKKSMHKYLIKDSKYLMAAVNKFENYF  1294

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               S++        + + P VL DI+ES  GA+ LDSG   +  ++ +  +L+P+++   +
Sbjct  1295  NLSNSEKDLSE--EPACPKVLGDIVESCVGAVLLDSGFNLNHAWKLMLMLLKPILSFCDM  1352

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +NP++EL ELCQ   + +  P  +  DGE    +EV  NG + SC+++ +N K A++LA
Sbjct  1353  HINPLRELRELCQCNGFDLGLPKPIKADGEFHVKVEVNVNGKMISCTAANQNSKHARKLA  1412

Query  239   CE  234
              +
Sbjct  1413  AQ  1414



>ref|XP_009366581.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Pyrus x bretschneideri]
Length=1974

 Score =   197 bits (502),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 155/253 (61%), Gaps = 9/253 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID-----APIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA+  ++W+G++I+         P   + P +  
Sbjct  1573  RVLSSKTLADVVEALIGVYYVEGGKNAAIHLMKWIGIEIELDPDGLECIPKPSSVPESVL  1632

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN+ F D   L+EA++H S +  G   YQRLEF+GDA+LD+ +TRH 
Sbjct  1633  RSVNFDALEG--ALNFKFNDRGFLIEAMSHASRLSAGVCCYQRLEFVGDAILDHLITRHL  1690

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I DFVK +    
Sbjct  1691  FFTYTILPPGRLTDLRAAAVNNENFAHVAVKHNLHVHLRHGSSALEKQINDFVKEVGNEL  1750

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI ESIAGAI+LDSG  T  V++  +P+L+PMVTPE+L +
Sbjct  1751  SKPGFNSFGLGDCKAPKVLGDIFESIAGAIFLDSGRNTTAVWKVFQPLLQPMVTPETLPM  1810

Query  413   NPVKELTELCQKR  375
             +PV+EL E CQ++
Sbjct  1811  HPVRELQERCQQQ  1823


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1394  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDMINHPVPASKILEALTAASC--QETFCYE  1451

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1452  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1507



>ref|XP_008352221.1| PREDICTED: dicer-like protein 4 [Malus domestica]
Length=549

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 171/302 (57%), Gaps = 11/302 (4%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  960
             S+G   + N+TIADV EAL+GAF+  +G IAA +FL+W+G+ +DF      +A I  +  
Sbjct  54    SKGHHWLYNKTIADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEACIASSRY  113

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             +     +++  LE+   L Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  114   IPLSACMDIAALENS--LGYKFLHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDYLI  171

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S +L  +I  +V  I
Sbjct  172   TSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLISDSCSLSEAIESYVGFI  231

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
             E   A+S  G +     P  L D++ES  GAI LD+G   + V+E +   L+P+++  SL
Sbjct  232   E---AASDRGLLDGPKCPKALGDLVESCLGAILLDTGFNLNRVWEIMLSFLKPIMSFSSL  288

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +L+P++EL ELCQ   + + E V      +      V  N    S S+++ N+K   R+ 
Sbjct  289   QLSPIRELRELCQAHSWGL-EFVPTKMGKKYSVRATVNXNNVCVSASTTSLNKKDGIRIC  347

Query  239   CE  234
              +
Sbjct  348   AQ  349



>ref|XP_008337203.1| PREDICTED: dicer-like protein 4 [Malus domestica]
Length=549

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 171/302 (57%), Gaps = 11/302 (4%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  960
             S+G   + N+TIADV EAL+GAF+  +G IAA +FL+W+G+ +DF      +A I  +  
Sbjct  54    SKGHHWLYNKTIADVVEALVGAFVVDSGFIAATAFLKWIGIQVDFEPSQVTEACIASSRY  113

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             +     +++  LE+   L Y F    LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  114   IPLSACMDIAALENS--LGYKFLHRGLLLQAFVHPSYNKHGGGCYQRLEFLGDAVLDYLI  171

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T + Y  YP L PG LT+LRS SVNN  +A  +V    H +++  S +L  +I  +V  I
Sbjct  172   TSYLYSVYPKLKPGQLTDLRSVSVNNKAFANVAVDRSFHKFLISDSCSLSEAIESYVGFI  231

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
             E   A+S  G +     P  L D++ES  GAI LD+G   + V+E +   L+P+++  SL
Sbjct  232   E---AASDRGLLDGPKCPKALGDLVESCLGAILLDTGFNLNRVWEIMLSFLKPIMSFSSL  288

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +L+P++EL ELCQ   + + E V      +      V  N    S S+++ N+K   R+ 
Sbjct  289   QLSPIRELRELCQAHSWGL-EFVPTKMGKKYSVRATVNXNNVCVSASTTSLNKKDGIRIC  347

Query  239   CE  234
              +
Sbjct  348   AQ  349



>ref|XP_008358840.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Malus domestica]
Length=1969

 Score =   197 bits (501),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/298 (39%), Positives = 171/298 (57%), Gaps = 13/298 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFID-----APIVGNFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G++I+         P   + P +  
Sbjct  1567  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIEIELDPDGLECIPKPSSVPESVL  1626

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + VN   LE    LN+ F D   LVEA++H S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1627  RSVNFDALEG--ALNFKFSDRGFLVEAISHASRPSAGVSCYQRLEFVGDAVLDHLITRHL  1684

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS  588
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H STAL   I DFVK +    
Sbjct  1685  FFTYTNLPPGRLTDLRAAAVNNENFARVAVKHYLHVHLRHGSTALEKQIHDFVKEVGNEL  1744

Query  587   ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL  414
             +   F    +     P VL DI ESIAGA++LDSG  T  V++  +P+L+PMVTPE+L +
Sbjct  1745  SKPGFNSFGLGDCKAPKVLGDIFESIAGAVFLDSGRDTGAVWKVFQPLLQPMVTPETLPM  1804

Query  413   NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +PV+EL E CQ+    ++       +     T+EV  + G++   +    +K A++LA
Sbjct  1805  HPVRELQERCQQLAEGLEYKATRSGN---VATVEVFID-GIQMAIAQNPQKKMAQKLA  1858


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKR--------LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ R        +E   ++NY+    S ++EALT  S     T  Y
Sbjct  1388  PLPGSLVRGAQRLPSIMRRVESMLLAVELKDMINYSV-PASKILEALTAASC--QETFCY  1444

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++K GL +YI
Sbjct  1445  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALKKGLQSYI  1501



>ref|XP_006418369.1| hypothetical protein EUTSA_v10006531mg [Eutrema salsugineum]
 gb|ESQ36722.1| hypothetical protein EUTSA_v10006531mg [Eutrema salsugineum]
Length=1917

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/256 (43%), Positives = 155/256 (61%), Gaps = 14/256 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP--------IVGNFPL  957
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++  D P         V N P 
Sbjct  1502  RVLSSKTLADVVEALIGVYYVEGGKTAANHLMKWIGIHVE--DDPEETEGSVKPVYNVPE  1559

Query  956   NAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVT  777
             +  + ++   LE    L Y F +  LLVEA+TH S    G   YQRLEF+GDAVLD+ +T
Sbjct  1560  SVLKSIDFVGLER--ALKYEFTEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLIT  1617

Query  776   RHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIE  597
             RH +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I DFVK + 
Sbjct  1618  RHLFFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIRDFVKEVL  1677

Query  596   QSSASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES  423
               S+   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+
Sbjct  1678  TESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPET  1737

Query  422   LRLNPVKELTELCQKR  375
             L ++PV+EL E CQ++
Sbjct  1738  LPMHPVRELQERCQQQ  1753



>ref|XP_004985932.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Setaria italica]
Length=1933

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/300 (38%), Positives = 177/300 (59%), Gaps = 18/300 (6%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQMVNV  933
             R + ++T+ADV EALIG +    G++AA   +RW+G+  +     I  + P    + + +
Sbjct  1526  RVLSSKTLADVVEALIGVYYVAGGKMAANHLMRWIGIHAELDPQEIPPSKPYIIPESI-M  1584

Query  932   KRLESDSL---LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD  762
             K +  D+L   L   F+   LLVEA+TH S    G   YQRLEF+GDAVLD+ +T+H + 
Sbjct  1585  KSINFDTLEGALGIKFQSKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITKHLFF  1644

Query  761   QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS  582
              Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++  + 
Sbjct  1645  TYTHLPPGRLTDLRAAAVNNENFARIAVKHKLHVHLRHGSSALETQIREFVKDVQEELSK  1704

Query  581   STFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP  408
               F    +     P VL DI ESIAGAI+LDSG  T IV++  +P+L+PMVTP++L ++P
Sbjct  1705  PGFNSFGLGDCKAPKVLGDIFESIAGAIFLDSGYNTSIVWKVFQPLLDPMVTPDTLPMHP  1764

Query  407   VKELTELCQKR----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             V+EL E CQ++    +Y+      V        T+EV  + G++        +K A++LA
Sbjct  1765  VRELQERCQQQAEGLEYKASRTANV-------ATVEVFVD-GIQIGVGQNPQKKMAQKLA  1816



>emb|CDX92469.1| BnaA10g15080D [Brassica napus]
Length=1642

 Score =   196 bits (498),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 118/304 (39%), Positives = 169/304 (56%), Gaps = 10/304 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-----IDAPIVGNFP  960
             S+G   +  +TIADV EAL+GAFL  +G   A+ FL+W+G+++DF      DA +     
Sbjct  1156  SKGHHWLHKKTIADVVEALVGAFLVDSGFKGAIEFLKWIGINVDFESLQVRDACVASKRF  1215

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             +      ++  LES  LL YTF    LL++A  H SY  HG   YQRLEFLGDAVLDY +
Sbjct  1216  MPLTTCFDLAALES--LLGYTFLHKGLLLQAFIHPSYNRHGGGCYQRLEFLGDAVLDYLM  1273

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T +F+  +P L PG LT+LRS SVNN   A  +V   L  ++   ST L  +I D+   +
Sbjct  1274  TSYFFSVFPKLKPGQLTDLRSLSVNNKALANVAVSFSLQRFLFCDSTYLHDAIKDYTNFV  1333

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
               S  +S  G       P VL D+IES  GA++LD G   + V+  +   L+P+    +L
Sbjct  1334  TASPLAS--GPSEGPKCPKVLGDLIESFLGALFLDCGFDLNHVWRIMLSFLDPVKNLSNL  1391

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             +L+PVKEL E CQ  K+  +E     KDG     ++V   G   + S++ RN+K + + A
Sbjct  1392  QLSPVKELLEYCQSYKWD-QEISATKKDGAFSVELKVTKKGSCLTASATGRNKKESTKKA  1450

Query  239   CERM  228
              + M
Sbjct  1451  AQLM  1454



>ref|XP_010556639.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X2 [Tarenaya 
hassleriana]
Length=1945

 Score =   196 bits (498),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 174/299 (58%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++     I G     N P +  
Sbjct  1538  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIHVEADPTEIEGTVKAANVPESVL  1597

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+   +E    LNY F +  LLVEALTH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1598  KSVDFIAIER--ALNYKFTEKGLLVEALTHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1655

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H STAL   I DF K +    
Sbjct  1656  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSTALERQIRDFEKEVVNEL  1715

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDS   T +V+    P+++PMVTPE+L 
Sbjct  1716  MKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSQKDTTVVWGVFEPLMQPMVTPETLP  1774

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1775  MHPVRELQERCQQQAEGLE--YKASRSGNMA-TVEVFID-GVQVGMAHNPQKKMAQKLA  1829


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1358  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDLINFPIPSSKILEALTAASC--QETFCYE  1415

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1416  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMILYQYALEKGLQSYI  1471



>ref|XP_010556636.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556637.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556638.1| PREDICTED: endoribonuclease Dicer homolog 1 isoform X1 [Tarenaya 
hassleriana]
Length=1946

 Score =   196 bits (498),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 174/299 (58%), Gaps = 15/299 (5%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG-----NFPLNAE  948
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ ++     I G     N P +  
Sbjct  1539  RVLSSKTLADVVEALIGVYYVEGGKHAANHLMKWIGIHVEADPTEIEGTVKAANVPESVL  1598

Query  947   QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF  768
             + V+   +E    LNY F +  LLVEALTH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct  1599  KSVDFIAIER--ALNYKFTEKGLLVEALTHASRPSSGVSCYQRLEFVGDAVLDHLITRHL  1656

Query  767   YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ--  594
             +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H STAL   I DF K +    
Sbjct  1657  FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSTALERQIRDFEKEVVNEL  1716

Query  593   -SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
                  ++FG +     P VL DI+ESIAGAI+LDS   T +V+    P+++PMVTPE+L 
Sbjct  1717  MKPGFNSFG-LGDCKAPKVLGDIVESIAGAIFLDSQKDTTVVWGVFEPLMQPMVTPETLP  1775

Query  416   LNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
             ++PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct  1776  MHPVRELQERCQQQAEGLE--YKASRSGNMA-TVEVFID-GVQVGMAHNPQKKMAQKLA  1830


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 9/116 (8%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ  822
             P+ G+    A+++ ++ R     LL    +D        S ++EALT  S     T  Y+
Sbjct  1359  PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDLINFPIPSSKILEALTAASC--QETFCYE  1416

Query  821   RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI  654
             R E LGDA L + V+R  + +YP    G LT +R + V+N      +++ GL +YI
Sbjct  1417  RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMILYQYALEKGLQSYI  1472



>gb|EMS51466.1| Endoribonuclease Dicer-like protein 4 [Triticum urartu]
Length=1512

 Score =   195 bits (496),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/302 (35%), Positives = 170/302 (56%), Gaps = 9/302 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFP  960
             ++    +  +TIAD  E+L+GAFL   G  AA +FL W+G+D+DF D+ +       +  
Sbjct  996   TKSHHWLHRKTIADAVESLVGAFLVEGGFKAAFAFLHWVGIDVDFKDSSLYRVLDASSIN  1055

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             L+     +V  LE   L+ Y F+   L++EA  H S+  H    YQ+LEFLGDAVL+Y +
Sbjct  1056  LSLTNHTDVGELEE--LIGYNFKHKGLILEAFVHPSFNKHSGGCYQKLEFLGDAVLEYLI  1113

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T + Y  YP L PG +T+L+S +V+N   A  +V+ G+H Y++  S  L S++  F   I
Sbjct  1114  TSYLYSAYPDLKPGQITDLKSLAVSNNSLAYVAVQKGIHKYLIKDSNYLSSAVNKFENYI  1173

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
                ++      V + + P VL DI+ES   A+ LDSG   + V+  +  +L+P+++   +
Sbjct  1174  RLPNSEKDL--VEEPACPKVLGDIVESCVAAVLLDSGFNLNYVWTLVLMLLKPVLSFSDM  1231

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +NP++E+ ELCQ  +  +  P  +  DGE    +EV  N  V S +++ RN K A++ A
Sbjct  1232  HMNPMREIRELCQSHELELGLPEPMKADGEYHVKVEVNINSQVISSAAANRNSKVARKFA  1291

Query  239   CE  234
              +
Sbjct  1292  AQ  1293


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 58/139 (42%), Gaps = 22/139 (16%)
 Frame = -3

Query  830   SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL  651
             S +R E LGDA L Y V RH +  Y GL  G LT  RS  VNN+     S+K  L  YI 
Sbjct  896   SLERFEVLGDAFLKYVVGRHNFLTYEGLDEGQLTSRRSAIVNNSHLYELSIKRNLQVYIR  955

Query  650   HSSTALRSSI-----------ADFVKNIEQSS-------ASSTFGWVLKTSFPWVLADII  525
                      I           AD   NI   S        + +  W+ + +    +AD +
Sbjct  956   DQHFEPTQFIALGRPCKVVCNADTEVNIHTDSRENCNLRCTKSHHWLHRKT----IADAV  1011

Query  524   ESIAGAIYLDSGLRTDIVF  468
             ES+ GA  ++ G +    F
Sbjct  1012  ESLVGAFLVEGGFKAAFAF  1030



>gb|EMT06391.1| Endoribonuclease Dicer-4-like protein [Aegilops tauschii]
Length=1493

 Score =   195 bits (496),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/302 (35%), Positives = 170/302 (56%), Gaps = 9/302 (3%)
 Frame = -3

Query  1124  SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPI-----VGNFP  960
             ++    +  +TIAD  E+L+GAFL   G  AA +FL W+G+D+DF D+ +       +  
Sbjct  977   TKSHHWLHRKTIADAVESLVGAFLVEGGFKAAFAFLHWVGIDVDFKDSSLYRVLDASSIN  1036

Query  959   LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAV  780
             L+     +V  LE   L+ Y F+   L++EA  H S+  H    YQ+LEFLGDAVL+Y +
Sbjct  1037  LSLTNHTDVDELEE--LIGYNFKHKGLILEAFVHPSFNKHSGGCYQKLEFLGDAVLEYLI  1094

Query  779   TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI  600
             T + Y  YP L PG +T+L+S +V+N   A  +V+ G+H Y++  S  L +++  F   I
Sbjct  1095  TSYLYSAYPDLKPGQITDLKSLAVSNNSLAYVAVQKGIHKYLIKDSNYLSTAVNKFENYI  1154

Query  599   EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL  420
                ++      V + + P VL DI+ES   A+ LDSG   + V+  +  +LEP+++   +
Sbjct  1155  RLPNSEKDL--VEEPACPKVLGDIVESCVAAVLLDSGFNLNYVWTLVLMLLEPVLSFSDM  1212

Query  419   RLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA  240
              +NP++E+ ELCQ  +  +  P  +  DGE    +EV  N  V S +++ RN K A++ A
Sbjct  1213  HMNPMREIRELCQCHELELGLPEPMKADGEYHVKVEVNINSQVISSAAANRNSKVARKFA  1272

Query  239   CE  234
              +
Sbjct  1273  AQ  1274


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 58/139 (42%), Gaps = 22/139 (16%)
 Frame = -3

Query  830   SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL  651
             S +R E LGDA L Y V RH +  Y GL  G LT  RS  VNN+     S+K  L  YI 
Sbjct  877   SLERFEVLGDAFLKYVVGRHNFLTYEGLDEGQLTSRRSAIVNNSHLYELSIKRNLQVYIR  936

Query  650   HSSTALRSSI-----------ADFVKNIEQSS-------ASSTFGWVLKTSFPWVLADII  525
                      I           AD   NI   S        + +  W+ + +    +AD +
Sbjct  937   DQHFEPTQFIALGRPCKVVCSADTEVNIHTDSRENCNLRCTKSHHWLHRKT----IADAV  992

Query  524   ESIAGAIYLDSGLRTDIVF  468
             ES+ GA  ++ G +    F
Sbjct  993   ESLVGAFLVEGGFKAAFAF  1011



>gb|AIE15765.1| Dicer-like protein 3 [Salvia miltiorrhiza]
Length=1654

 Score =   195 bits (496),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 176/301 (58%), Gaps = 16/301 (5%)
 Frame = -3

Query  1136  GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDID---FI--DAPIV  972
             GK   +G R + ++TI+D  EALIGA+    G  AA+S ++WLG++++   F+  DA   
Sbjct  1176  GKTCDKGHRWIVSKTISDCVEALIGAYYEGGGLTAAISLMKWLGIEVESEHFLVDDAIRT  1235

Query  971   GNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT-QSYQRLEFLGDAV  795
              +    A +  ++  LES   L Y F    LL+EA+TH +    G   SY+RLEFLGDAV
Sbjct  1236  ASLYSYAPKAEDISVLESK--LGYNFSTKGLLLEAITHAAGSEKGAGYSYERLEFLGDAV  1293

Query  794   LDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIAD  615
             LD  VTRH Y  +  + PG LT++RS SVNN  +AL++V+  LH ++ H S++L S I+ 
Sbjct  1294  LDILVTRHLYMNHREVDPGLLTDMRSASVNNDNFALAAVRQNLHPHLQHVSSSLESQIST  1353

Query  614   FVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV  435
             FV  +   S+ ST         P VL D++E IAGA+ +DS L  D V+   +P+L P+V
Sbjct  1354  FVNLV---SSMSTSALTPDIKGPKVLGDLVEGIAGAVLIDSKLNLDEVWRVFKPILSPLV  1410

Query  434   TPESLRLNPVKELTELCQKRKYRMKEPVVVHKD---GEACTTIE-VMANG-GVRSCSSSA  270
             TPE L L P +ELTELC    Y +K+  V+  D    E    +E V+ NG GV   S +A
Sbjct  1411  TPEKLELQPSRELTELCDSLGYFIKQHYVMKGDVVHAELKLQLESVLLNGNGVGPNSKAA  1470

Query  269   R  267
             +
Sbjct  1471  K  1471



>ref|XP_004494885.1| PREDICTED: endoribonuclease Dicer homolog 1-like isoform X2 [Cicer 
arietinum]
Length=1892

 Score =   195 bits (496),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 157/254 (62%), Gaps = 11/254 (4%)
 Frame = -3

Query  1112  RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIV------GNFPLNA  951
             R + ++T+ADV EALIG +    G+ AA   ++W+G+ I+ ID   +       + P + 
Sbjct  1491  RVLSSKTLADVVEALIGVYYVEGGKNAANHLMKWIGIHIE-IDPDEMECTRKPSDVPDSI  1549

Query  950   EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH  771
              + V+   LE    LN  F+D  LL+E++TH S    G   YQRLEF+GDAVLD+ +TRH
Sbjct  1550  LRSVDFDALEG--ALNIRFKDKGLLIESITHASRPSSGVSCYQRLEFVGDAVLDHLITRH  1607

Query  770   FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS  591
              +  Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL   I +FVK ++  
Sbjct  1608  LFFSYTDLPPGRLTDLRAAAVNNENFARVAVKHNLHMHLRHGSSALEKQIKEFVKEVQNE  1667

Query  590   SASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR  417
              +   F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L 
Sbjct  1668  LSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGRNTAVVWKVFQPLLHPMVTPETLP  1727

Query  416   LNPVKELTELCQKR  375
             ++PV+EL E CQ++
Sbjct  1728  MHPVRELQERCQQQ  1741


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 63/118 (53%), Gaps = 11/118 (9%)
 Frame = -3

Query  980   PIVGNFPLNAEQMVNV-KRLES-------DSLLNYTFRDPSLLVEALTHGSYIPHGTQSY  825
             P+ G+    A+++ ++ +R+ES        +++NY  +   +L EALT  S     T  Y
Sbjct  1312  PLPGSLIRGAQRLPSIMRRVESMLLAVQLKNMINYPVQSLKIL-EALTAASC--QETFCY  1368

Query  824   QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL  651
             +R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YIL
Sbjct  1369  ERAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALSKGLQSYIL  1426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3192469809513