BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8633

Length=975
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631638.1|  PREDICTED: proteasome subunit alpha type-6         491   1e-172   Nicotiana tomentosiformis
ref|XP_009797939.1|  PREDICTED: proteasome subunit alpha type-6         491   2e-172   Nicotiana sylvestris
ref|XP_011098408.1|  PREDICTED: proteasome subunit alpha type-6         489   1e-171   Sesamum indicum [beniseed]
gb|EYU19318.1|  hypothetical protein MIMGU_mgv1a012555mg                488   2e-171   Erythranthe guttata [common monkey flower]
ref|XP_004251692.1|  PREDICTED: proteasome subunit alpha type-6         488   2e-171   Solanum lycopersicum
ref|XP_011099933.1|  PREDICTED: proteasome subunit alpha type-6-like    488   4e-171   Sesamum indicum [beniseed]
ref|XP_009380029.1|  PREDICTED: proteasome subunit alpha type-6         486   2e-170   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB65226.1|  hypothetical protein B456_010G089600                    485   2e-170   Gossypium raimondii
gb|KHG01950.1|  Proteasome subunit alpha type-6                         485   3e-170   Gossypium arboreum [tree cotton]
ref|XP_010269878.1|  PREDICTED: proteasome subunit alpha type-6-like    484   6e-170   Nelumbo nucifera [Indian lotus]
ref|XP_010274570.1|  PREDICTED: proteasome subunit alpha type-6         484   8e-170   Nelumbo nucifera [Indian lotus]
gb|KJB82986.1|  hypothetical protein B456_013G223200                    484   1e-169   Gossypium raimondii
gb|ACJ11727.1|  20S proteasome subunit alpha-1                          483   2e-169   Gossypium hirsutum [American cotton]
emb|CDP03072.1|  unnamed protein product                                483   2e-169   Coffea canephora [robusta coffee]
ref|XP_007012615.1|  20S proteasome subunit PAA2 isoform 1              483   2e-169   Theobroma cacao [chocolate]
ref|XP_002271929.1|  PREDICTED: proteasome subunit alpha type-6         483   2e-169   Vitis vinifera
ref|XP_009404175.1|  PREDICTED: proteasome subunit alpha type-6-like    482   6e-169   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63192.1|  proteasome subunit alpha type-6                         481   9e-169   Genlisea aurea
gb|KJB65225.1|  hypothetical protein B456_010G089600                    481   2e-168   Gossypium raimondii
ref|XP_012077064.1|  PREDICTED: proteasome subunit alpha type-6         480   4e-168   Jatropha curcas
ref|XP_006592586.1|  PREDICTED: proteasome subunit alpha type-6-like    479   5e-168   Glycine max [soybeans]
ref|XP_008228175.1|  PREDICTED: proteasome subunit alpha type-6         479   1e-167   Prunus mume [ume]
ref|XP_010937324.1|  PREDICTED: proteasome subunit alpha type-6         479   1e-167   Elaeis guineensis
ref|XP_006842706.1|  PREDICTED: proteasome subunit alpha type-6         479   1e-167   Amborella trichopoda
gb|KJB82987.1|  hypothetical protein B456_013G223200                    479   1e-167   Gossypium raimondii
ref|XP_007215872.1|  hypothetical protein PRUPE_ppa010523mg             478   2e-167   Prunus persica
ref|XP_006381605.1|  hypothetical protein POPTR_0006s14260g             478   2e-167   Populus trichocarpa [western balsam poplar]
ref|XP_012079628.1|  PREDICTED: proteasome subunit alpha type-6-like    478   3e-167   Jatropha curcas
ref|XP_004488480.1|  PREDICTED: proteasome subunit alpha type-6-l...    477   4e-167   Cicer arietinum [garbanzo]
ref|XP_008782714.1|  PREDICTED: proteasome subunit alpha type-6         477   6e-167   Phoenix dactylifera
ref|XP_008802476.1|  PREDICTED: proteasome subunit alpha type-6-like    477   6e-167   Phoenix dactylifera
ref|XP_010064020.1|  PREDICTED: proteasome subunit alpha type-6         477   6e-167   Eucalyptus grandis [rose gum]
ref|XP_002532723.1|  proteasome subunit alpha type, putative            477   6e-167   Ricinus communis
ref|XP_007133143.1|  hypothetical protein PHAVU_011G155200g             476   1e-166   Phaseolus vulgaris [French bean]
ref|XP_008391412.1|  PREDICTED: proteasome subunit alpha type-6         475   3e-166   Malus domestica [apple tree]
ref|XP_009344472.1|  PREDICTED: proteasome subunit alpha type-6         475   3e-166   Pyrus x bretschneideri [bai li]
ref|XP_008462289.1|  PREDICTED: proteasome subunit alpha type-6         475   3e-166   Cucumis melo [Oriental melon]
gb|AFK47610.1|  unknown                                                 474   6e-166   Lotus japonicus
gb|ACJ85916.1|  unknown                                                 474   7e-166   Medicago truncatula
ref|NP_001238251.1|  proteasome subunit alpha type-6                    474   7e-166   
gb|KJB82988.1|  hypothetical protein B456_013G223200                    474   7e-166   Gossypium raimondii
gb|ABK96399.1|  unknown                                                 474   7e-166   Populus trichocarpa x Populus deltoides
gb|ACU24622.1|  unknown                                                 474   9e-166   Glycine max [soybeans]
gb|ADJ95344.1|  PAA1                                                    473   1e-165   Carica papaya [mamon]
ref|XP_002323091.1|  Proteasome subunit alpha type 6-1 family pro...    473   2e-165   Populus trichocarpa [western balsam poplar]
ref|XP_010557672.1|  PREDICTED: proteasome subunit alpha type-6-B...    473   3e-165   Tarenaya hassleriana [spider flower]
ref|XP_004141710.1|  PREDICTED: proteasome subunit alpha type-6         472   4e-165   Cucumis sativus [cucumbers]
ref|XP_011001657.1|  PREDICTED: proteasome subunit alpha type-6-like    472   5e-165   Populus euphratica
ref|XP_006465892.1|  PREDICTED: proteasome subunit alpha type-6-like    472   6e-165   Citrus sinensis [apfelsine]
ref|XP_010939895.1|  PREDICTED: proteasome subunit alpha type-6-like    471   8e-165   Elaeis guineensis
ref|XP_006474716.1|  PREDICTED: proteasome subunit alpha type-6-l...    471   1e-164   Citrus sinensis [apfelsine]
ref|XP_010541996.1|  PREDICTED: proteasome subunit alpha type-6-B       471   1e-164   Tarenaya hassleriana [spider flower]
ref|XP_003595788.1|  Proteasome subunit alpha type                      471   1e-164   Medicago truncatula
ref|XP_004303706.1|  PREDICTED: proteasome subunit alpha type-6         470   2e-164   Fragaria vesca subsp. vesca
ref|XP_002308263.1|  Proteasome subunit alpha type 6-1 family pro...    470   3e-164   Populus trichocarpa [western balsam poplar]
gb|ABK95322.1|  unknown                                                 470   3e-164   Populus trichocarpa [western balsam poplar]
gb|AFK46380.1|  unknown                                                 469   4e-164   Lotus japonicus
gb|ACN66752.1|  PAA1                                                    469   8e-164   Carica papaya [mamon]
ref|XP_011018964.1|  PREDICTED: proteasome subunit alpha type-6-like    469   9e-164   Populus euphratica
gb|AFK46801.1|  unknown                                                 469   1e-163   Medicago truncatula
ref|XP_010533014.1|  PREDICTED: proteasome subunit alpha type-6-B...    468   2e-163   Tarenaya hassleriana [spider flower]
gb|ACJ85912.1|  unknown                                                 467   5e-163   Medicago truncatula
ref|NP_178641.1|  20S proteasome subunit PAA2                           465   2e-162   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32243.1|  hypothetical protein AALP_AA6G216400                    464   8e-162   Arabis alpina [alpine rockcress]
ref|XP_010435443.1|  PREDICTED: proteasome subunit alpha type-6-A...    463   1e-161   Camelina sativa [gold-of-pleasure]
ref|XP_010494382.1|  PREDICTED: proteasome subunit alpha type-6-B       463   2e-161   Camelina sativa [gold-of-pleasure]
ref|XP_010666851.1|  PREDICTED: proteasome subunit alpha type-6         462   2e-161   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010450390.1|  PREDICTED: proteasome subunit alpha type-6-A       462   2e-161   Camelina sativa [gold-of-pleasure]
ref|XP_006282775.1|  hypothetical protein CARUB_v10006215mg             462   3e-161   Capsella rubella
ref|XP_010441957.1|  PREDICTED: proteasome subunit alpha type-6-B...    462   3e-161   Camelina sativa [gold-of-pleasure]
ref|XP_009102355.1|  PREDICTED: proteasome subunit alpha type-6-B       462   4e-161   Brassica rapa
ref|XP_002516258.1|  proteasome subunit alpha type, putative            462   5e-161   Ricinus communis
ref|XP_006474717.1|  PREDICTED: proteasome subunit alpha type-6-l...    461   6e-161   
ref|NP_198409.1|  proteasome alpha subunit A1                           460   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136197.1|  PREDICTED: proteasome subunit alpha type-6-B...    459   4e-160   Brassica rapa
ref|XP_006396131.1|  hypothetical protein EUTSA_v10002649mg             459   5e-160   Eutrema salsugineum [saltwater cress]
ref|XP_002870436.1|  hypothetical protein ARALYDRAFT_493620             459   7e-160   
gb|AAM12968.1|  multicatalytic endopeptidase complex alpha subuni...    459   9e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649499.1|  PREDICTED: proteasome subunit alpha type-6-like    458   1e-159   Oryza brachyantha
emb|CAA74025.1|  multicatalytic endopeptidase complex, proteasome...    457   2e-159   Arabidopsis thaliana [mouse-ear cress]
gb|AAC32054.1|  20S proteasome subunit PAA1                             457   5e-159   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049162.1|  Os03g0180400                                       456   8e-159   
ref|NP_001130062.1|  uncharacterized protein LOC100191154               455   2e-158   Zea mays [maize]
gb|KDO64977.1|  hypothetical protein CISIN_1g025897mg                   455   3e-158   Citrus sinensis [apfelsine]
ref|XP_004985490.1|  PREDICTED: proteasome subunit alpha type-6-like    454   4e-158   Setaria italica
gb|ACN33969.1|  unknown                                                 454   5e-158   Zea mays [maize]
ref|XP_002465753.1|  hypothetical protein SORBIDRAFT_01g045210          454   6e-158   Sorghum bicolor [broomcorn]
ref|NP_001105138.1|  maize 20S proteasome alpha subunit                 452   3e-157   Zea mays [maize]
emb|CDY50408.1|  BnaC03g45100D                                          452   5e-157   Brassica napus [oilseed rape]
ref|XP_003558667.1|  PREDICTED: proteasome subunit alpha type-6         450   2e-156   Brachypodium distachyon [annual false brome]
emb|CDX93103.1|  BnaA03g38250D                                          449   1e-155   
gb|EMT09268.1|  Proteasome subunit alpha type-6                         447   4e-155   
gb|AGO97077.1|  20S proteasome alpha                                    446   9e-155   Saccharum hybrid cultivar GT28
gb|ABK22399.1|  unknown                                                 446   9e-155   Picea sitchensis
dbj|BAJ85935.1|  predicted protein                                      446   1e-154   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006452821.1|  hypothetical protein CICLE_v10010323mg             440   1e-152   
gb|KHG04433.1|  Proteasome subunit alpha type-6                         435   7e-151   Gossypium arboreum [tree cotton]
gb|ABF94306.1|  Proteasome subunit alpha type 6, putative, expressed    437   2e-150   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001777426.1|  predicted protein                                  428   1e-147   
ref|XP_001768229.1|  predicted protein                                  426   8e-147   
ref|XP_010111992.1|  Proteasome subunit alpha type-6                    428   8e-147   
ref|XP_002989745.1|  hypothetical protein SELMODRAFT_272088             425   2e-146   Selaginella moellendorffii
ref|XP_001782615.1|  predicted protein                                  423   1e-145   
ref|NP_001031340.1|  20S proteasome subunit PAA2                        420   6e-145   Arabidopsis thaliana [mouse-ear cress]
gb|KDO64982.1|  hypothetical protein CISIN_1g025897mg                   420   1e-144   Citrus sinensis [apfelsine]
gb|KHN46954.1|  Proteasome subunit alpha type-6                         432   1e-144   Glycine soja [wild soybean]
ref|XP_001751730.1|  predicted protein                                  401   5e-137   
gb|AFW89473.1|  hypothetical protein ZEAMMB73_334376                    382   5e-130   
ref|XP_005648429.1|  proteasome subunit alpha type-6                    380   1e-128   Coccomyxa subellipsoidea C-169
ref|XP_001691723.1|  20S proteasome alpha subunit A                     367   1e-123   Chlamydomonas reinhardtii
ref|XP_002949740.1|  20S proteasome alpha subunit A                     364   2e-122   Volvox carteri f. nagariensis
gb|KDO64983.1|  hypothetical protein CISIN_1g025897mg                   355   7e-120   Citrus sinensis [apfelsine]
ref|XP_003059392.1|  predicted protein                                  354   1e-118   Micromonas pusilla CCMP1545
ref|XP_001418143.1|  predicted protein                                  349   2e-116   Ostreococcus lucimarinus CCE9901
gb|KDD75255.1|  proteasome subunit protein                              347   8e-116   Helicosporidium sp. ATCC 50920
emb|CEF98211.1|  Proteasome A-type subunit                              345   3e-115   Ostreococcus tauri
gb|AFK44903.1|  unknown                                                 342   9e-115   Medicago truncatula
ref|XP_005843942.1|  hypothetical protein CHLNCDRAFT_27583              340   3e-113   Chlorella variabilis
gb|ESA18832.1|  hypothetical protein GLOINDRAFT_344383                  340   6e-113   
ref|NP_989113.1|  proteasome subunit alpha type-6                       339   9e-113   Xenopus tropicalis [western clawed frog]
ref|XP_006835407.1|  PREDICTED: proteasome subunit alpha type-6 i...    339   1e-112   Chrysochloris asiatica
ref|XP_537412.2|  PREDICTED: proteasome subunit alpha type-6 isof...    338   3e-112   Canis lupus familiaris [dogs]
ref|XP_004436462.1|  PREDICTED: proteasome subunit alpha type-6 i...    337   4e-112   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_001264372.1|  proteasome subunit alpha type-6                    337   5e-112   Gallus gallus [bantam]
gb|EDL36728.1|  proteasome (prosome, macropain) subunit, alpha ty...    337   6e-112   Mus musculus [mouse]
ref|NP_058979.1|  proteasome subunit alpha type-6                       337   6e-112   Rattus norvegicus [brown rat]
ref|XP_004470220.1|  PREDICTED: proteasome subunit alpha type-6         337   7e-112   Dasypus novemcinctus
ref|XP_004698589.1|  PREDICTED: proteasome subunit alpha type-6         337   8e-112   Echinops telfairi [lesser hedgehog tenrec]
ref|NP_036098.1|  proteasome subunit alpha type-6                       337   9e-112   Mus musculus [mouse]
ref|NP_001232198.1|  putative proteasome subunit alpha type 6           337   9e-112   Taeniopygia guttata
ref|XP_001095366.1|  PREDICTED: proteasome subunit alpha type-6-l...    337   1e-111   
ref|XP_004649175.1|  PREDICTED: proteasome subunit alpha type-6         337   1e-111   Jaculus jaculus
ref|NP_001088418.1|  uncharacterized protein LOC495277                  336   1e-111   Xenopus laevis [clawed frog]
ref|XP_009901279.1|  PREDICTED: proteasome subunit alpha type-6 i...    336   1e-111   Picoides pubescens
ref|XP_007180773.1|  PREDICTED: proteasome subunit alpha type-6         336   1e-111   Balaenoptera acutorostrata scammoni
ref|XP_006258805.1|  PREDICTED: proteasome subunit alpha type-6         336   1e-111   Alligator mississippiensis
ref|XP_006172412.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    336   2e-111   Tupaia chinensis
ref|XP_010153543.1|  PREDICTED: proteasome subunit alpha type-6 i...    336   2e-111   Eurypyga helias
ref|NP_001132918.1|  proteasome subunit alpha type-6                    336   2e-111   Ovis aries [domestic sheep]
ref|XP_005149366.1|  PREDICTED: proteasome subunit alpha type-6         336   2e-111   
ref|XP_005865030.1|  PREDICTED: proteasome subunit alpha type-6         336   2e-111   Myotis brandtii
gb|ABM86477.1|  proteasome (prosome, macropain) subunit, alpha ty...    335   2e-111   synthetic construct
ref|XP_011850428.1|  PREDICTED: proteasome subunit alpha type-6 i...    335   3e-111   Mandrillus leucophaeus
gb|EIE83838.1|  hypothetical protein RO3G_08543                         335   3e-111   Rhizopus delemar RA 99-880
ref|XP_003924255.1|  PREDICTED: proteasome subunit alpha type-6         337   4e-111   Saimiri boliviensis boliviensis
ref|XP_006985315.1|  PREDICTED: proteasome subunit alpha type-6         335   4e-111   Peromyscus maniculatus bairdii
emb|CEG74212.1|  Putative Proteasome subunit alpha type                 335   4e-111   Rhizopus microsporus
ref|XP_003471921.1|  PREDICTED: proteasome subunit alpha type-6         335   4e-111   Cavia porcellus [guinea pig]
ref|XP_007436765.1|  PREDICTED: proteasome subunit alpha type-6         335   6e-111   Python bivittatus
gb|KIY96698.1|  20S proteasome subunit alpha 1                          336   7e-111   Monoraphidium neglectum
ref|XP_003445487.1|  PREDICTED: proteasome subunit alpha type-6-like    334   8e-111   Oreochromis niloticus
ref|XP_005717620.1|  20S core proteasome subunit alpha 1                334   8e-111   Chondrus crispus [carageen]
gb|EPB88050.1|  proteasome subunit alpha type-6                         334   9e-111   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_001002589.1|  proteasome subunit alpha type-6                    334   9e-111   Danio rerio [leopard danio]
ref|XP_007530301.1|  PREDICTED: proteasome subunit alpha type-6         334   9e-111   Erinaceus europaeus [common hedgehog]
ref|XP_010876681.1|  PREDICTED: proteasome subunit alpha type-6         334   9e-111   Esox lucius
ref|XP_001363110.1|  PREDICTED: proteasome subunit alpha type-6         334   1e-110   Monodelphis domestica
ref|XP_005842332.1|  20S proteasome subunit alpha type 6                334   1e-110   Guillardia theta CCMP2712
ref|XP_003971508.1|  PREDICTED: proteasome subunit alpha type-6         334   1e-110   Takifugu rubripes [tiger puffer]
dbj|BAE36518.1|  unnamed protein product                                334   1e-110   Mus musculus [mouse]
ref|XP_006632201.1|  PREDICTED: proteasome subunit alpha type-6-like    334   1e-110   Lepisosteus oculatus
dbj|GAN03133.1|  proteasome subunit alpha type-6                        334   1e-110   Mucor ambiguus
ref|NP_001086785.1|  proteasome alpha 6 subunit                         333   1e-110   Xenopus laevis [clawed frog]
ref|XP_005158685.1|  PREDICTED: proteasome subunit alpha type-6 i...    333   1e-110   
emb|CDS07623.1|  Putative Proteasome subunit alpha type                 333   2e-110   Lichtheimia ramosa
emb|CAG00121.1|  unnamed protein product                                333   2e-110   Tetraodon nigroviridis
ref|XP_003440740.1|  PREDICTED: proteasome subunit alpha type-6-like    333   2e-110   Oreochromis niloticus
ref|XP_008300217.1|  PREDICTED: proteasome subunit alpha type-6         333   2e-110   Stegastes partitus
ref|XP_007253022.1|  PREDICTED: proteasome subunit alpha type-6-l...    333   2e-110   Astyanax mexicanus [blind cave fish]
gb|ERE72543.1|  proteasome subunit alpha type-6-like protein            333   2e-110   Cricetulus griseus [Chinese hamsters]
ref|XP_010744453.1|  PREDICTED: proteasome subunit alpha type-6         333   2e-110   
ref|XP_005285405.1|  PREDICTED: proteasome subunit alpha type-6 i...    333   2e-110   Chrysemys picta bellii
ref|XP_004542308.1|  PREDICTED: proteasome subunit alpha type-6-like    333   3e-110   Maylandia zebra
gb|ACB87915.1|  20S proteasome alpha subunit A1                         330   3e-110   Malus domestica [apple tree]
ref|XP_004559366.1|  PREDICTED: proteasome subunit alpha type-6-like    332   4e-110   Maylandia zebra
ref|XP_011922517.1|  PREDICTED: proteasome subunit alpha type-6         332   5e-110   Cercocebus atys
pdb|4R3O|A  Chain A, Human Constitutive 20s Proteasome                  332   5e-110   Homo sapiens [man]
emb|CDQ90937.1|  unnamed protein product                                332   5e-110   Oncorhynchus mykiss
ref|NP_001132944.1|  proteasome subunit alpha type-6                    332   5e-110   Sus scrofa [pigs]
ref|XP_002500811.1|  predicted protein                                  334   5e-110   Micromonas commoda
emb|CDH55408.1|  proteasome subunit alpha type-6                        332   6e-110   Lichtheimia corymbifera JMRC:FSU:9682
gb|ACI66289.1|  Proteasome subunit alpha type-6                         332   6e-110   Salmo salar
ref|XP_001511492.1|  PREDICTED: proteasome subunit alpha type-6 i...    332   7e-110   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_002824717.1|  PREDICTED: proteasome subunit alpha type-6 i...    332   7e-110   
ref|NP_001150310.1|  proteasome subunit alpha type 6                    333   8e-110   Zea mays [maize]
ref|XP_006015430.1|  PREDICTED: proteasome subunit alpha type-6         337   9e-110   
gb|ETE73021.1|  Proteasome subunit alpha type-6                         333   1e-109   Ophiophagus hannah
gb|ACO51961.1|  Proteasome subunit alpha type-6                         331   1e-109   Rana catesbeiana [bullfrog]
ref|XP_004653726.1|  PREDICTED: proteasome subunit alpha type-6-like    331   1e-109   
emb|CEP12966.1|  hypothetical protein                                   331   2e-109   Parasitella parasitica
gb|KDO64978.1|  hypothetical protein CISIN_1g025897mg                   329   2e-109   Citrus sinensis [apfelsine]
ref|XP_005810950.1|  PREDICTED: proteasome subunit alpha type-6-like    330   2e-109   Xiphophorus maculatus
ref|NP_001279159.1|  proteasome (prosome, macropain) subunit, alp...    330   2e-109   Callorhinchus milii [Australian ghost shark]
ref|XP_008396439.1|  PREDICTED: proteasome subunit alpha type-6         330   3e-109   Poecilia reticulata
ref|XP_008282309.1|  PREDICTED: proteasome subunit alpha type-6         330   3e-109   Stegastes partitus
emb|CDQ78135.1|  unnamed protein product                                330   3e-109   Oncorhynchus mykiss
ref|XP_007569003.1|  PREDICTED: proteasome subunit alpha type-6         330   4e-109   Poecilia formosa
ref|XP_005562133.1|  PREDICTED: proteasome subunit alpha type-6-like    330   4e-109   
ref|XP_004083706.1|  PREDICTED: proteasome subunit alpha type-6         330   4e-109   Oryzias latipes [Japanese rice fish]
ref|XP_011781260.1|  PREDICTED: proteasome subunit alpha type-6 i...    330   4e-109   Colobus angolensis palliatus
gb|ACQ58552.1|  Proteasome subunit alpha type-6                         329   6e-109   Anoplopoma fimbria
gb|ACH70967.1|  proteasome (prosome, macropain) subunit, alpha ty...    329   7e-109   Salmo salar
ref|XP_005989234.1|  PREDICTED: proteasome subunit alpha type-6         329   7e-109   Latimeria chalumnae
ref|XP_005798367.1|  PREDICTED: proteasome subunit alpha type-6-like    329   8e-109   Xiphophorus maculatus
gb|ACO08806.1|  Proteasome subunit alpha type 6                         329   9e-109   Oncorhynchus mykiss
gb|ACH70968.1|  proteasome (prosome, macropain) subunit, alpha ty...    329   1e-108   Salmo salar
ref|XP_010741287.1|  PREDICTED: proteasome subunit alpha type-6         328   1e-108   
ref|XP_011850427.1|  PREDICTED: proteasome subunit alpha type-6 i...    328   2e-108   Mandrillus leucophaeus
ref|XP_007576015.1|  PREDICTED: proteasome subunit alpha type-6         328   3e-108   Poecilia formosa
gb|ACI69778.1|  Proteasome subunit alpha type-6                         327   3e-108   Salmo salar
ref|XP_010876973.1|  PREDICTED: proteasome subunit alpha type-6         327   5e-108   Esox lucius
gb|ACO08382.1|  Proteasome subunit alpha type 6                         327   6e-108   Oncorhynchus mykiss
ref|XP_008311014.1|  PREDICTED: proteasome subunit alpha type-6         327   7e-108   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004637142.1|  PREDICTED: proteasome subunit alpha type-6         327   8e-108   Octodon degus
ref|XP_008398058.1|  PREDICTED: proteasome subunit alpha type-6         327   8e-108   Poecilia reticulata
ref|XP_001640650.1|  predicted protein                                  327   9e-108   Nematostella vectensis
gb|ACM08640.1|  Proteasome subunit alpha type-6                         326   1e-107   Salmo salar
ref|XP_007513369.1|  predicted protein                                  326   2e-107   Bathycoccus prasinos
gb|AFK10987.1|  proteasome subunit alpha type-6-like protein            325   2e-107   Callorhinchus milii [Australian ghost shark]
ref|XP_004333676.1|  proteasome subunit alpha type6, putative           325   2e-107   Acanthamoeba castellanii str. Neff
ref|XP_002610620.1|  hypothetical protein BRAFLDRAFT_260512             324   6e-107   Branchiostoma floridae
ref|XP_010777538.1|  PREDICTED: proteasome subunit alpha type-6         323   2e-106   Notothenia coriiceps [yellowbelly rockcod]
emb|CDH55409.1|  proteasome subunit alpha type-6                        322   3e-106   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003388491.1|  PREDICTED: proteasome subunit alpha type-6-like    322   4e-106   Amphimedon queenslandica
gb|EIE87129.1|  hypothetical protein RO3G_11840                         323   6e-106   Rhizopus delemar RA 99-880
ref|XP_006065991.1|  PREDICTED: proteasome subunit alpha type-6-like    322   7e-106   
ref|XP_004349345.1|  proteasome subunit iota                            320   3e-105   Capsaspora owczarzaki ATCC 30864
ref|XP_005356606.1|  PREDICTED: proteasome subunit alpha type-6-like    318   9e-105   
ref|XP_011314423.1|  PREDICTED: proteasome subunit alpha type-6-like    317   5e-104   Fopius arisanus
ref|XP_011151114.1|  PREDICTED: proteasome subunit alpha type-6-like    317   6e-104   Harpegnathos saltator
gb|ELU01128.1|  hypothetical protein CAPTEDRAFT_167909                  316   2e-103   Capitella teleta
ref|XP_010153544.1|  PREDICTED: proteasome subunit alpha type-6 i...    315   2e-103   Eurypyga helias
ref|XP_009019631.1|  hypothetical protein HELRODRAFT_106545             315   3e-103   Helobdella robusta
ref|XP_011329096.1|  PREDICTED: proteasome subunit alpha type-6-like    315   4e-103   Ooceraea biroi
ref|XP_009209663.1|  PREDICTED: proteasome subunit alpha type-6 i...    314   4e-103   
gb|KFW08632.1|  Proteasome subunit alpha type-6                         313   6e-103   Eurypyga helias
ref|XP_003216618.1|  PREDICTED: proteasome subunit alpha type-6         314   7e-103   Anolis carolinensis [Carolina anole]
gb|ACI70015.1|  Proteasome subunit alpha type-6                         314   9e-103   Salmo salar
ref|XP_011635711.1|  PREDICTED: proteasome subunit alpha type-6-like    313   9e-103   Pogonomyrmex barbatus
emb|CDQ77351.1|  unnamed protein product                                313   1e-102   Oncorhynchus mykiss
ref|XP_011054784.1|  PREDICTED: proteasome subunit alpha type-6-like    313   1e-102   Acromyrmex echinatior
ref|XP_005987928.1|  PREDICTED: proteasome subunit alpha type-6-l...    313   1e-102   Latimeria chalumnae
ref|XP_006117859.1|  PREDICTED: proteasome subunit alpha type-6         313   1e-102   
emb|CDQ88726.1|  unnamed protein product                                313   2e-102   Oncorhynchus mykiss
ref|XP_008543695.1|  PREDICTED: proteasome subunit alpha type-6-like    313   2e-102   Microplitis demolitor
ref|XP_003706429.1|  PREDICTED: proteasome subunit alpha type-6-like    313   2e-102   Megachile rotundata
gb|ACM09335.1|  Proteasome subunit alpha type-6                         313   2e-102   Salmo salar
ref|XP_009063626.1|  hypothetical protein LOTGIDRAFT_229407             312   3e-102   Lottia gigantea
ref|XP_011866991.1|  PREDICTED: proteasome subunit alpha type-6-like    312   4e-102   Vollenhovia emeryi
ref|XP_005656349.1|  PREDICTED: proteasome subunit alpha type-6 i...    311   4e-102   
gb|EFX71218.1|  proteasome subunit alpha type 6-like protein            312   4e-102   Daphnia pulex
ref|XP_011167410.1|  PREDICTED: proteasome subunit alpha type-6-like    312   5e-102   Solenopsis invicta [imported red fire ant]
ref|XP_005703510.1|  20S proteasome subunit alpha 1                     312   5e-102   Galdieria sulphuraria
ref|XP_003740511.1|  PREDICTED: proteasome subunit alpha type-6-like    311   5e-102   Galendromus occidentalis
ref|XP_002113578.1|  hypothetical protein TRIADDRAFT_27191              312   6e-102   Trichoplax adhaerens
ref|XP_008608969.1|  proteasome subunit alpha type-6                    311   7e-102   Saprolegnia diclina VS20
ref|XP_005293216.1|  PREDICTED: proteasome subunit alpha type-6-l...    311   9e-102   Chrysemys picta bellii
ref|XP_011494157.1|  PREDICTED: proteasome subunit alpha type-6-like    311   1e-101   Ceratosolen solmsi marchali
ref|XP_003393493.1|  PREDICTED: proteasome subunit alpha type-6-like    311   1e-101   Bombus terrestris [large earth bumblebee]
gb|EFZ13292.1|  hypothetical protein SINV_14495                         311   1e-101   
ref|XP_006678757.1|  hypothetical protein BATDEDRAFT_88011              311   1e-101   Batrachochytrium dendrobatidis JAM81
ref|XP_001607854.1|  PREDICTED: proteasome subunit alpha type-6-like    310   2e-101   Nasonia vitripennis
ref|XP_007253021.1|  PREDICTED: proteasome subunit alpha type-6-l...    312   2e-101   
ref|XP_002741353.1|  PREDICTED: proteasome subunit alpha type-6-like    310   3e-101   Saccoglossus kowalevskii
ref|XP_011259025.1|  PREDICTED: proteasome subunit alpha type-6-like    310   3e-101   Camponotus floridanus
gb|KDO64985.1|  hypothetical protein CISIN_1g025897mg                   306   3e-101   Citrus sinensis [apfelsine]
ref|XP_011685154.1|  PREDICTED: proteasome subunit alpha type-6-like    309   4e-101   Wasmannia auropunctata
ref|XP_003697298.1|  PREDICTED: proteasome subunit alpha type-6-like    309   4e-101   Apis florea [dwarf honeybee]
ref|XP_004997606.1|  proteasome subunit alpha type-6                    309   6e-101   Salpingoeca rosetta
ref|XP_008881328.1|  hypothetical protein H310_15130                    309   7e-101   Aphanomyces invadans
ref|XP_006608469.1|  PREDICTED: proteasome subunit alpha type-6-like    309   8e-101   Apis dorsata [rock honeybee]
gb|KFM81155.1|  Proteasome subunit alpha type-6                         308   9e-101   Stegodyphus mimosarum
ref|XP_002411749.1|  proteasome subunit alpha type, putative            308   1e-100   Ixodes scapularis [blacklegged tick]
ref|XP_007068323.1|  PREDICTED: proteasome subunit alpha type-6-like    308   2e-100   Chelonia mydas [green seaturtle]
ref|XP_006801196.1|  PREDICTED: proteasome subunit alpha type-6-l...    308   2e-100   Neolamprologus brichardi [lyretail cichlid]
ref|XP_009831249.1|  hypothetical protein H257_07425                    307   2e-100   Aphanomyces astaci
ref|XP_001843247.1|  proteasome subunit alpha type 6                    307   2e-100   Culex quinquefasciatus
emb|CCA15401.1|  proteasome subunit alpha type6 putative                306   5e-100   Albugo laibachii Nc14
ref|XP_010896958.1|  PREDICTED: proteasome subunit alpha type-6-l...    306   6e-100   Esox lucius
ref|XP_003449352.1|  PREDICTED: proteasome subunit alpha type-6-like    306   7e-100   
gb|ETI45522.1|  hypothetical protein F443_09944                         306   1e-99    
ref|XP_005762775.1|  hypothetical protein EMIHUDRAFT_446206             306   1e-99    
emb|CCI48184.1|  unnamed protein product                                305   1e-99    
ref|XP_004075507.1|  PREDICTED: proteasome subunit alpha type-6-like    305   2e-99    
ref|XP_009526410.1|  hypothetical protein PHYSODRAFT_285915             305   2e-99    
ref|XP_006426693.1|  hypothetical protein CICLE_v100263522mg            301   3e-99    
ref|XP_002902293.1|  proteasome subunit alpha type-6, putative          305   3e-99    
ref|NP_001187798.1|  proteasome subunit alpha type-6                    305   3e-99    
ref|XP_318387.2|  AGAP003935-PA                                         305   3e-99    
ref|XP_007873808.1|  hypothetical protein PNEG_01835                    305   4e-99    
ref|XP_001749972.1|  hypothetical protein                               304   5e-99    
gb|KFB46736.1|  AGAP003935-PA-like protein                              304   5e-99    
ref|XP_005099053.1|  PREDICTED: proteasome subunit alpha type-6-like    304   7e-99    
gb|ABI13160.1|  putative proteasome alpha subunit                       304   1e-98    
ref|XP_011419593.1|  PREDICTED: proteasome subunit alpha type-6         303   1e-98    
gb|ETN58251.1|  proteasome subunit alpha type 6                         303   1e-98    
ref|XP_001654091.1|  AAEL009898-PA                                      303   1e-98    
ref|XP_007688022.1|  hypothetical protein COCMIDRAFT_5367               303   1e-98    
ref|XP_008993532.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    303   2e-98    
gb|ADO27866.1|  proteasome subunit alpha type-6                         301   9e-98    
ref|XP_007234010.1|  PREDICTED: proteasome subunit alpha type-6-like    300   2e-97    
ref|XP_002143952.1|  proteasome component Prs2, putative                299   5e-97    
ref|XP_003303796.1|  hypothetical protein PTT_16156                     299   5e-97    
ref|XP_005243955.1|  PREDICTED: proteasome subunit alpha type-6         299   6e-97    
gb|AGM32386.1|  proteasome subunit alpha type-6                         299   6e-97    
tpe|CBF76587.1|  TPA: proteasome core alpha 1 component (Eurofung)      299   7e-97    
gb|EFX02870.1|  proteasome subunit alpha type 6                         299   7e-97    
gb|KFH62604.1|  proteasome subunit alpha type-6                         298   9e-97    
emb|CDM30570.1|  Probable proteasome subunit alpha type-6               298   1e-96    
ref|XP_001931683.1|  proteasome subunit alpha type-6                    298   1e-96    
ref|XP_008307633.1|  PREDICTED: proteasome subunit alpha type-6-like    298   1e-96    
ref|XP_002427127.1|  proteasome subunit alpha type, putative            298   1e-96    
ref|XP_009222727.1|  proteasome subunit alpha type-6                    298   2e-96    
gb|KGO36960.1|  Proteasome A-type subunit                               297   3e-96    
ref|XP_007912348.1|  putative proteasome subunit alpha type 6 pro...    297   4e-96    
ref|NP_705941.1|  proteasome subunit alpha type-6                       296   4e-96    
gb|KJJ17056.1|  Proteasome alpha-subunit N-terminal domain              297   5e-96    
gb|ABM55423.1|  proteasome subunit alpha type 6-like protein            296   6e-96    
gb|EME46261.1|  hypothetical protein DOTSEDRAFT_70305                   296   6e-96    
ref|XP_001271130.1|  predicted protein                                  296   6e-96    
ref|XP_002559377.1|  Pc13g09540                                         296   7e-96    
ref|XP_001796064.1|  hypothetical protein SNOG_05667                    296   8e-96    
gb|EMF14550.1|  N-terminal nucleophile aminohydrolase                   296   8e-96    
ref|XP_003844849.1|  similar to proteasome subunit alpha type-6         296   9e-96    
ref|XP_006696698.1|  hypothetical protein CTHT_0063920                  296   1e-95    
gb|EHB05850.1|  Proteasome subunit alpha type-6                         295   2e-95    
emb|CBN08618.1|  proteasome (prosome, macropain) subunit, alpha t...    295   2e-95    
ref|XP_002480335.1|  proteasome component Prs2, putative                295   2e-95    
gb|EQL00512.1|  proteasome subunit alpha type 6                         295   2e-95    
gb|EHK40697.1|  hypothetical protein TRIATDRAFT_301498                  295   3e-95    
emb|CEJ93046.1|  Putative Proteasome subunit alpha type                 295   3e-95    
gb|EHK16557.1|  hypothetical protein TRIVIDRAFT_75344                   295   3e-95    
ref|XP_002841029.1|  hypothetical protein                               295   3e-95    
ref|XP_007796832.1|  putative proteasome subunit alpha type 6 pro...    295   3e-95    
ref|XP_011396415.1|  Proteasome subunit alpha type-6                    293   4e-95    
gb|KJZ78751.1|  Putative proteasome subunit alpha type-6                294   5e-95    
gb|EKG12338.1|  Proteasome alpha-subunit conserved site                 294   5e-95    
ref|XP_007926644.1|  hypothetical protein MYCFIDRAFT_188442             294   5e-95    
ref|XP_006963196.1|  proteasome subunit alpha 6                         294   5e-95    
ref|XP_010739538.1|  PREDICTED: proteasome subunit alpha type-6-like    294   6e-95    
dbj|GAM85636.1|  hypothetical protein ANO11243_036430                   294   6e-95    
ref|XP_002127869.1|  PREDICTED: proteasome subunit alpha type-6-l...    294   7e-95    
gb|KFY37296.1|  hypothetical protein V495_07258                         294   7e-95    
ref|XP_004584816.1|  PREDICTED: proteasome subunit alpha type-6         293   8e-95    
gb|KDN66300.1|  putative proteasome A-type and B-type                   294   8e-95    
gb|EPE09739.1|  proteasome subunit alpha type 6                         293   8e-95    
ref|XP_011120711.1|  hypothetical protein AOL_s00075g98                 294   8e-95    
ref|XP_003717769.1|  proteasome subunit alpha type-6                    293   9e-95    
gb|KFQ96181.1|  Proteasome subunit alpha type-6                         293   1e-94    
gb|KFA67907.1|  hypothetical protein S40285_04100                       293   1e-94    
gb|EPS29950.1|  hypothetical protein PDE_04900                          293   1e-94    
gb|KFY28594.1|  hypothetical protein V493_02857                         293   1e-94    
emb|CCF38339.1|  proteasome A-type and B-type                           293   1e-94    
gb|EFA79004.1|  proteasome subunit alpha type 6                         293   1e-94    
ref|XP_008712166.1|  hypothetical protein HMPREF1541_09269              293   1e-94    
gb|EFQ28985.1|  proteasome A-type and B-type                            293   1e-94    
ref|XP_968655.1|  PREDICTED: proteasome subunit alpha type-6            293   1e-94    
ref|XP_009860960.1|  PREDICTED: proteasome subunit alpha type-6-l...    293   2e-94    
ref|XP_005177054.1|  PREDICTED: proteasome subunit alpha type-6         292   2e-94    
gb|KIX01010.1|  hypothetical protein Z518_10076                         293   2e-94    
gb|KFZ47806.1|  Proteasome subunit alpha type-6                         291   2e-94    
ref|XP_005804586.1|  PREDICTED: proteasome subunit alpha type-6-like    292   2e-94    
ref|XP_007295783.1|  proteasome subunit alpha type 6                    293   2e-94    
ref|XP_011850429.1|  PREDICTED: proteasome subunit alpha type-6 i...    291   2e-94    
ref|XP_007680618.1|  hypothetical protein BAUCODRAFT_126149             294   2e-94    
gb|KIL96483.1|  hypothetical protein FAVG1_01227                        292   3e-94    
ref|XP_662473.1|  hypothetical protein AN4869.2                         293   3e-94    
gb|KFQ31740.1|  Proteasome subunit alpha type-6                         291   3e-94    
dbj|BAM18567.1|  proteasome alpha1 subunit                              292   3e-94    
gb|KFO90954.1|  Proteasome subunit alpha type-6                         291   4e-94    
emb|CAG06433.1|  unnamed protein product                                291   4e-94    
ref|XP_007601883.1|  proteasome A-type and B-type                       292   4e-94    
ref|XP_004773397.1|  PREDICTED: proteasome subunit alpha type-6 i...    291   4e-94    
gb|KFX91072.1|  hypothetical protein V490_06088                         292   4e-94    
gb|KIW74909.1|  hypothetical protein Z517_11680                         291   5e-94    
gb|KFO63713.1|  Proteasome subunit alpha type-6                         290   5e-94    
ref|XP_005014711.1|  PREDICTED: proteasome subunit alpha type-6         290   5e-94    
gb|KFR01991.1|  Proteasome subunit alpha type-6                         290   6e-94    
ref|XP_003323788.2|  proteasome subunit alpha type-6                    291   6e-94    
ref|XP_008599361.1|  proteasome A-type and B-type                       291   6e-94    
ref|XP_011319207.1|  proteasome component C7-alpha                      291   6e-94    
gb|KIW87420.1|  hypothetical protein Z519_12056                         292   6e-94    
ref|XP_001819832.1|  proteasome subunit alpha type-6                    291   6e-94    
gb|KFP89006.1|  Proteasome subunit alpha type-6                         290   7e-94    
gb|KEY66092.1|  hypothetical protein S7711_09211                        292   7e-94    
ref|XP_004055136.1|  PREDICTED: proteasome subunit alpha type-6-like    291   7e-94    
gb|KFA73659.1|  hypothetical protein S40288_07644                       292   7e-94    
ref|XP_010631916.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   7e-94    
gb|EGU87091.1|  hypothetical protein FOXB_02485                         291   7e-94    
ref|XP_007731114.1|  proteasome subunit alpha type-6                    291   7e-94    
ref|XP_011953664.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   7e-94    
gb|KFY99093.1|  hypothetical protein V500_01465                         291   7e-94    
ref|XP_009255010.1|  hypothetical protein FPSE_03616                    291   8e-94    
ref|XP_008424335.1|  PREDICTED: proteasome subunit alpha type-6-like    291   8e-94    
ref|XP_011781277.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   8e-94    
ref|XP_004436463.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   9e-94    
gb|KIW43338.1|  hypothetical protein PV06_04450                         291   9e-94    
gb|KIW28395.1|  hypothetical protein PV07_08062                         291   9e-94    
ref|XP_005656350.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   9e-94    
gb|KGQ11560.1|  Proteasome subunit alpha type-6                         291   9e-94    
gb|KFV43324.1|  Proteasome subunit alpha type-6                         290   1e-93    
ref|NP_001269163.1|  proteasome subunit alpha type-6 isoform c          290   1e-93    
gb|EMC83847.1|  Proteasome subunit alpha type-6                         290   1e-93    
emb|CCE29503.1|  probable SCL1-20S proteasome subunit YC7ALPHA/Y8...    291   1e-93    
ref|XP_004270017.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   1e-93    
ref|XP_007119013.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   1e-93    
ref|XP_009158794.1|  proteasome subunit alpha type-6                    291   1e-93    
ref|XP_005047359.1|  PREDICTED: proteasome subunit alpha type-6         290   1e-93    
ref|XP_007741776.1|  20S proteasome subunit alpha 1                     291   1e-93    
ref|XP_007719836.1|  proteasome subunit alpha type-6                    291   1e-93    
ref|XP_004681994.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   1e-93    
ref|XP_007464885.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   1e-93    
ref|XP_003857582.1|  proteasome core particle subunit alpha 1           290   1e-93    
gb|KFY66093.1|  hypothetical protein V496_02185                         290   1e-93    
gb|KJY01742.1|  proteasome subunit alpha type-6 like protein            290   1e-93    
gb|ELR02822.1|  20S proteasome subunit alpha 1                          290   1e-93    
ref|XP_007586723.1|  putative proteasome subunit alpha type-6 pro...    290   2e-93    
gb|KDB16148.1|  proteasome subunit alpha type 6                         290   2e-93    
ref|XP_007807465.1|  proteasome subunit alpha type 6                    290   2e-93    
gb|KDR14657.1|  Proteasome subunit alpha type-6                         290   2e-93    
emb|CEF75633.1|  unnamed protein product                                290   2e-93    
gb|KFG86753.1|  proteasome subunit alpha type 6                         290   2e-93    
ref|XP_007756206.1|  proteasome subunit alpha type-6                    290   2e-93    
ref|XP_003051118.1|  predicted protein                                  290   2e-93    
ref|XP_009288678.1|  PREDICTED: proteasome subunit alpha type-6         289   2e-93    
gb|KFY13879.1|  hypothetical protein V492_03002                         290   2e-93    
ref|XP_001244388.1|  hypothetical protein CIMG_03829                    290   2e-93    
dbj|GAD99016.1|  predicted protein                                      293   2e-93    
ref|XP_005376981.1|  PREDICTED: proteasome subunit alpha type-6 i...    289   2e-93    
gb|ERS99418.1|  hypothetical protein HMPREF1624_04618                   290   2e-93    
ref|XP_006515947.1|  PREDICTED: proteasome subunit alpha type-6 i...    289   2e-93    
ref|XP_007821798.1|  Proteasome A-type subunit                          290   3e-93    
ref|XP_005751769.1|  PREDICTED: proteasome subunit alpha type-6-like    290   3e-93    
ref|XP_006240160.1|  PREDICTED: proteasome subunit alpha type-6 i...    289   3e-93    
ref|XP_002679314.1|  predicted protein                                  290   3e-93    
ref|NP_001040459.1|  proteasome subunit alpha type 6-A                  290   3e-93    
ref|XP_008267725.1|  PREDICTED: proteasome subunit alpha type-6 i...    290   3e-93    
ref|XP_003662349.1|  hypothetical protein MYCTH_2302907                 290   3e-93    
ref|XP_006128209.1|  PREDICTED: proteasome subunit alpha type-6-like    290   4e-93    
gb|KFH45227.1|  Proteasome subunit alpha-like protein                   289   4e-93    
ref|XP_004562835.1|  PREDICTED: proteasome subunit alpha type-6-like    289   4e-93    
ref|XP_007577895.1|  PREDICTED: proteasome subunit alpha type-6-like    289   4e-93    
gb|KID99895.1|  proteasome subunit alpha type 6                         289   4e-93    
ref|XP_002159995.1|  PREDICTED: proteasome subunit alpha type-6-like    289   4e-93    
ref|XP_003286860.1|  proteasome subunit alpha type 6                    289   5e-93    
ref|XP_011850430.1|  PREDICTED: proteasome subunit alpha type-6 i...    288   5e-93    
gb|EQB51932.1|  proteasome A-type and B-type                            289   5e-93    
gb|KIW69429.1|  hypothetical protein PV04_05306                         289   6e-93    
emb|CAA43964.1|  macropain subunit iota                                 288   6e-93    
gb|KID80249.1|  proteasome subunit alpha type 6                         288   7e-93    
ref|XP_008724612.1|  hypothetical protein G647_10399                    288   8e-93    
gb|KFP76959.1|  Proteasome subunit alpha type-6                         287   8e-93    
gb|KFZ52790.1|  Proteasome subunit alpha type-6                         287   8e-93    
gb|ENH81729.1|  proteasome subunit alpha type 6                         288   8e-93    
dbj|GAM19752.1|  hypothetical protein SAMD00019534_029270               288   8e-93    
ref|XP_001912148.1|  hypothetical protein                               288   9e-93    
ref|XP_003649967.1|  hypothetical protein THITE_2109162                 288   1e-92    
gb|KHN94324.1|  proteasome subunit alpha type 6                         289   1e-92    
gb|KIN06410.1|  hypothetical protein OIDMADRAFT_141988                  288   1e-92    
ref|XP_005965384.1|  PREDICTED: proteasome subunit alpha type-6-l...    289   1e-92    
emb|CCC12323.1|  unnamed protein product                                288   2e-92    
gb|KHJ35771.1|  putative proteasome subunit alpha type 6                288   2e-92    
ref|XP_001224606.1|  conserved hypothetical protein                     288   2e-92    
ref|XP_004535732.1|  PREDICTED: proteasome subunit alpha type-6-l...    287   2e-92    
ref|XP_009317738.1|  PREDICTED: proteasome subunit alpha type-6         288   2e-92    
ref|XP_001548586.1|  conserved hypothetical protein                     287   2e-92    
gb|KIV96436.1|  hypothetical protein PV10_00308                         287   3e-92    
ref|XP_957907.1|  proteasome subunit alpha type 6                       287   3e-92    
ref|XP_003177216.1|  proteasome subunit alpha type-6                    287   3e-92    
gb|EHJ78841.1|  proteasome subunit alpha type 6-A                       286   4e-92    
gb|KEQ85758.1|  proteasome core particle subunit alpha 1                286   5e-92    
gb|KDB22734.1|  hypothetical protein H109_05356                         286   5e-92    
gb|EPQ67273.1|  hypothetical protein BGT96224_A21417                    286   6e-92    
gb|KIW08744.1|  hypothetical protein PV09_00682                         286   6e-92    
gb|EZG02619.1|  hypothetical protein H106_07457                         286   6e-92    
gb|EZF34225.1|  hypothetical protein H101_02239                         286   7e-92    
ref|XP_007833194.1|  Proteasome subunit alpha type-6                    286   8e-92    
ref|NP_571870.2|  proteasome alpha 6b subunit                           286   9e-92    
ref|XP_008290377.1|  PREDICTED: proteasome subunit alpha type-6-like    285   1e-91    
gb|AAK40123.1|AF354751_1  proteasome subunit alpha Type 6-B             285   1e-91    
ref|XP_006665767.1|  proteasome subunit alpha type 6                    286   1e-91    
ref|NP_724614.1|  proteasome alpha1 subunit, isoform A                  285   2e-91    
gb|KEQ76497.1|  proteasome core particle subunit alpha 1                285   2e-91    
ref|NP_595374.1|  20S proteasome component alpha 1 (predicted)          285   2e-91    
ref|XP_001361000.1|  GA15805                                            285   2e-91    
gb|KEQ92672.1|  hypothetical protein AUEXF2481DRAFT_31918               285   3e-91    
emb|CAK44248.1|  unnamed protein product                                284   3e-91    
ref|XP_002623465.1|  proteasome component C7-alpha                      284   4e-91    
ref|XP_008085140.1|  N-terminal nucleophile aminohydrolases (Ntn ...    284   4e-91    
ref|XP_006658809.1|  PREDICTED: proteasome subunit alpha type-6-like    284   4e-91    
ref|XP_011207521.1|  PREDICTED: proteasome subunit alpha type-6         284   4e-91    
gb|KEZ38816.1|  hypothetical protein SAPIO_CDS10856                     284   5e-91    
ref|XP_002089534.1|  Prosalpha6                                         283   5e-91    
gb|KGO72988.1|  Proteasome A-type subunit                               284   7e-91    
ref|XP_002004197.1|  GI19734                                            283   7e-91    
ref|XP_009649783.1|  proteasome subunit alpha type-6-A                  283   7e-91    
ref|XP_001213840.1|  proteasome subunit alpha type 6                    295   9e-91    
ref|XP_011190787.1|  PREDICTED: proteasome subunit alpha type-6-like    283   9e-91    
gb|EEH39752.2|  proteasome component C7-alpha                           283   1e-90    
emb|CCG84721.1|  protein of unknown function                            283   1e-90    



>ref|XP_009631638.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana tomentosiformis]
Length=246

 Score =   491 bits (1264),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/246 (95%), Positives = 243/246 (99%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIE+GVV++EDP FRVL+T EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVKKEDPVFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_009797939.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana sylvestris]
 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Nicotiana tabacum]
 emb|CAB39975.1| PRCI [Nicotiana tabacum]
Length=246

 Score =   491 bits (1263),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 233/246 (95%), Positives = 243/246 (99%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIE+GVV++EDP FRVL+T EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVKKEDPIFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_011098408.1| PREDICTED: proteasome subunit alpha type-6 [Sesamum indicum]
Length=246

 Score =   489 bits (1259),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 233/246 (95%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIE+GVVR++DP F+VLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVRKDDPVFKVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|EYU19318.1| hypothetical protein MIMGU_mgv1a012555mg [Erythranthe guttata]
Length=246

 Score =   488 bits (1257),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 233/246 (95%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP DVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPADVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSY+ETVQTAISALQSVLQEDFKASEIE+GVVR+EDP F+VLST EIDEHLT
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSVLQEDFKASEIEVGVVRKEDPVFKVLSTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6 [Solanum lycopersicum]
 ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum]
Length=246

 Score =   488 bits (1256),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 231/246 (94%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP DVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPADVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKN+PAFSYEETVQT ISALQSVLQEDFKASEIE+GVVR+EDP FRVL+T EIDEHLT
Sbjct  181  KKMKNNPAFSYEETVQTTISALQSVLQEDFKASEIEVGVVRKEDPVFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_011099933.1| PREDICTED: proteasome subunit alpha type-6-like [Sesamum indicum]
Length=246

 Score =   488 bits (1255),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 232/246 (94%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFS++ETVQTAISALQSVLQEDFKASEIE+GVVR+EDP F+VLST EIDEHLT
Sbjct  181  KKMKNDPAFSFDETVQTAISALQSVLQEDFKASEIEVGVVRKEDPVFKVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_009380029.1| PREDICTED: proteasome subunit alpha type-6 [Musa acuminata subsp. 
malaccensis]
Length=246

 Score =   486 bits (1250),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 243/246 (99%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR +DP+FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRNDDPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KJB65226.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=246

 Score =   485 bits (1249),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 228/246 (93%), Positives = 243/246 (99%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P+FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KHG01950.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=246

 Score =   485 bits (1249),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 228/246 (93%), Positives = 242/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+  +P+FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKANNPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010269878.1| PREDICTED: proteasome subunit alpha type-6-like [Nelumbo nucifera]
Length=246

 Score =   484 bits (1247),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 229/246 (93%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRP GV AMILGIDEE GPQLFKCDPAGHFFGHKATS G+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPFGVAAMILGIDEENGPQLFKCDPAGHFFGHKATSVGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL T EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPVFRVLPTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010274570.1| PREDICTED: proteasome subunit alpha type-6 [Nelumbo nucifera]
Length=246

 Score =   484 bits (1246),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 228/246 (93%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF +TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFAITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGV AM+LGIDEE GPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVAAMVLGIDEENGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KJB82986.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=246

 Score =   484 bits (1245),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 242/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum]
Length=246

 Score =   483 bits (1244),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 242/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P+FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>emb|CDP03072.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   483 bits (1244),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/245 (93%), Positives = 240/245 (98%), Gaps = 0/245 (0%)
 Frame = -1

Query  909  SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  730
            SRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  3    SRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  62

Query  729  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  550
            DQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF++GYEMPVD LA+WIADK
Sbjct  63   DQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKFGYEMPVDTLAKWIADK  122

Query  549  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEK  370
            SQVYTQHAYMRPLGVVAMILGIDEE GPQLFKCDPAGHFFGHKATSAG K+QEAINFLEK
Sbjct  123  SQVYTQHAYMRPLGVVAMILGIDEEAGPQLFKCDPAGHFFGHKATSAGAKDQEAINFLEK  182

Query  369  KMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTA  190
            KMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVLST EIDEHLTA
Sbjct  183  KMKNDPAFSYEETVQTAISALQSVLQEDFKANEIEVGVVRKENPIFRVLSTEEIDEHLTA  242

Query  189  ISERD  175
            ISERD
Sbjct  243  ISERD  247



>ref|XP_007012615.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
Length=246

 Score =   483 bits (1244),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FR LST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRALSTAEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 [Vitis vinifera]
 emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera]
 emb|CBI35851.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   483 bits (1244),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/246 (93%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGID+E GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDDENGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSY+ETVQTAISALQSVLQEDFK +EIE+GVVR + P+FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSVLQEDFKPNEIEVGVVRTDSPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_009404175.1| PREDICTED: proteasome subunit alpha type-6-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   482 bits (1240),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATGITADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGITADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLG+VAMILGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGIVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQIAISALQSVLQEDFKATEIEVGVVRKEDTVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea]
Length=246

 Score =   481 bits (1239),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 228/246 (93%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF VTKYLGLL TGITADARTLVQQARN+AA+FRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFHVTKYLGLLTTGITADARTLVQQARNKAADFRFRYGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLG++AM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGIIAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGSKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKASEIE+GVVR+EDP F+VLST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKASEIEVGVVRKEDPVFKVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KJB65225.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=247

 Score =   481 bits (1238),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 228/247 (92%), Positives = 243/247 (98%), Gaps = 1/247 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK-ATSAGVKEQEAINFL  376
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHK ATSAG KEQEAINFL
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKVATSAGSKEQEAINFL  180

Query  375  EKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHL  196
            EKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P+FRVLST EIDEHL
Sbjct  181  EKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPAFRVLSTEEIDEHL  240

Query  195  TAISERD  175
            TAISERD
Sbjct  241  TAISERD  247



>ref|XP_012077064.1| PREDICTED: proteasome subunit alpha type-6 [Jatropha curcas]
 gb|KDP33929.1| hypothetical protein JCGZ_07500 [Jatropha curcas]
Length=246

 Score =   480 bits (1235),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQS+LQEDFKA+EIE+GVVR ++  FRVL T EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSILQEDFKATEIEVGVVRADNRVFRVLPTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006592586.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max]
 gb|KHN16010.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=246

 Score =   479 bits (1234),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL+T EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPEFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_008228175.1| PREDICTED: proteasome subunit alpha type-6 [Prunus mume]
Length=246

 Score =   479 bits (1232),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 226/246 (92%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP F+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLT
Sbjct  181  KKMKNDPLFTYDETVQTAISALQSVLQEDFKANEIEVGVVVKENPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010937324.1| PREDICTED: proteasome subunit alpha type-6 [Elaeis guineensis]
Length=246

 Score =   479 bits (1232),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 225/246 (91%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFGHKATS+G+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFGHKATSSGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP FSYEETVQTAISALQSVLQEDFKA+EIE+GVVR +DP FRVLST EIDEHLT
Sbjct  181  KKMKNDPKFSYEETVQTAISALQSVLQEDFKATEIEVGVVRTDDPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006842706.1| PREDICTED: proteasome subunit alpha type-6 [Amborella trichopoda]
 gb|ERN04381.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
Length=246

 Score =   479 bits (1232),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 223/246 (91%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQAR+EAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARHEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLG+ AM+LGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGIAAMVLGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQT ISALQSVLQEDFKA+EIE+GVVR+E+P FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTTISALQSVLQEDFKATEIEVGVVRRENPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KJB82987.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=247

 Score =   479 bits (1232),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 227/247 (92%), Positives = 242/247 (98%), Gaps = 1/247 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK-ATSAGVKEQEAINFL  376
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHK ATSAG KEQEAINFL
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKVATSAGSKEQEAINFL  180

Query  375  EKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHL  196
            EKKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHL
Sbjct  181  EKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHL  240

Query  195  TAISERD  175
            TAISERD
Sbjct  241  TAISERD  247



>ref|XP_007215872.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
Length=246

 Score =   478 bits (1231),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 226/246 (92%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP F+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLT
Sbjct  181  KKMKNDPLFTYDETVQTAISALQSVLQEDFKANEIEVGVVVKENPVFRVLSTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006381605.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
 ref|XP_011039970.1| PREDICTED: proteasome subunit alpha type-6 [Populus euphratica]
 gb|ERP59402.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
Length=246

 Score =   478 bits (1231),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR ++  FRVLST EIDEHLT
Sbjct  181  KKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTDNLVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_012079628.1| PREDICTED: proteasome subunit alpha type-6-like [Jatropha curcas]
 gb|KDP45827.1| hypothetical protein JCGZ_17434 [Jatropha curcas]
Length=246

 Score =   478 bits (1229),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 238/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVT+LFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTNLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQS+LQEDFKA+EIE+GVVR +   FRVL T EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSILQEDFKATEIEVGVVRADSRVFRVLPTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer 
arietinum]
 ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer 
arietinum]
 ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer 
arietinum]
Length=246

 Score =   477 bits (1228),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 222/246 (90%), Positives = 242/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR +YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH++GHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYYGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVV++++P+FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVQKDNPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_008782714.1| PREDICTED: proteasome subunit alpha type-6 [Phoenix dactylifera]
Length=246

 Score =   477 bits (1227),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 225/246 (91%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPLTKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGV AMILGIDEEKGPQLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVAAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVV+ +DP FR LST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVKTDDPVFRGLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_008802476.1| PREDICTED: proteasome subunit alpha type-6-like [Phoenix dactylifera]
Length=246

 Score =   477 bits (1227),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 226/246 (92%), Positives = 238/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP F YEETVQTAISALQSV+QEDFKA+EIE+GVVR ED  FRVLST EIDEHLT
Sbjct  181  KKMKNDPKFLYEETVQTAISALQSVIQEDFKATEIEVGVVRTEDSVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010064020.1| PREDICTED: proteasome subunit alpha type-6 [Eucalyptus grandis]
 gb|KCW71315.1| hypothetical protein EUGRSUZ_F04398 [Eucalyptus grandis]
Length=246

 Score =   477 bits (1227),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 226/246 (92%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFR GYEMPVD LA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRNGYEMPVDALAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GP+L+KCDPAGHFFGHKATSAG KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEFGPRLYKCDPAGHFFGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSY+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSVLQEDFKANEIEVGVVRSDNPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   477 bits (1227),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+G+TSIGV GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGVTSIGVCGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FRVLST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_007133143.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
 gb|ESW05137.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
Length=246

 Score =   476 bits (1225),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF  GYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTNGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK DPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVL+T EIDEHLT
Sbjct  181  KKMKGDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_008391412.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=246

 Score =   475 bits (1223),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 223/246 (91%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEVGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKN+P+FSY+ETVQT ISALQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLT
Sbjct  181  KKMKNEPSFSYDETVQTCISALQSVLQEDFKATEIEVGVVVKENPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_009344472.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
 ref|XP_009344473.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
Length=246

 Score =   475 bits (1223),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 223/246 (91%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKN+P+FSY+ETVQT ISALQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLT
Sbjct  181  KKMKNEPSFSYDETVQTCISALQSVLQEDFKATEIEVGVVVKENPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_008462289.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis melo]
Length=246

 Score =   475 bits (1223),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 223/246 (91%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAA+FRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAADFRFRYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GP+L+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FRVL+T E+DEHLT
Sbjct  181  KKMKNDPAFTYEETVQTAISALQSVLQEDFKANEIEVGVVRSENPIFRVLTTEEVDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|AFK47610.1| unknown [Lotus japonicus]
Length=246

 Score =   474 bits (1220),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 222/246 (90%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVLSTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ACJ85916.1| unknown [Medicago truncatula]
 gb|AFK46669.1| unknown [Medicago truncatula]
 gb|KEH19590.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
Length=246

 Score =   474 bits (1220),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 221/246 (90%), Positives = 241/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATGITADARTLVQQARNEAAE+RFRYGYEMPVDVL++W+AD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGITADARTLVQQARNEAAEYRFRYGYEMPVDVLSKWVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDELGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+Y ETVQTAISALQSVLQEDFKA+EIE+GVV++++P FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYAETVQTAISALQSVLQEDFKATEIEVGVVQKDNPEFRVLSTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max]
 sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1; AltName: Full=Proteasome iota subunit [Glycine 
max]
 gb|AAC28135.1| proteasome IOTA subunit [Glycine max]
Length=246

 Score =   474 bits (1220),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 221/246 (90%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGY+RHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVT KKVPDKL
Sbjct  1    MSRGSGGGYNRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTHKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVL+T EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVLTTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KJB82988.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=244

 Score =   474 bits (1220),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 225/246 (91%), Positives = 240/246 (98%), Gaps = 2/246 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK--DKL  58

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  59   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  118

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  178

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHLT
Sbjct  179  KKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHLT  238

Query  192  AISERD  175
            AISERD
Sbjct  239  AISERD  244



>gb|ABK96399.1| unknown [Populus trichocarpa x Populus deltoides]
Length=246

 Score =   474 bits (1220),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 225/246 (91%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE GPQL+K DPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPQLYKSDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPA SYEETVQTAISALQSVLQE+FKA+EIE+GVVR ++  FRVLST EIDEHLT
Sbjct  181  KKMKNDPALSYEETVQTAISALQSVLQENFKATEIEVGVVRTDNLVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ACU24622.1| unknown [Glycine max]
Length=246

 Score =   474 bits (1219),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 222/246 (90%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYE+PVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEIPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGLQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+E+P FRVL+T EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKENPEFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ADJ95344.1| PAA1 [Carica papaya]
Length=246

 Score =   473 bits (1218),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+GHKATSAG K+QEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYGHKATSAGSKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P F VLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFHVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002323091.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|ABK93034.1| unknown [Populus trichocarpa]
 gb|EEF04852.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   473 bits (1217),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/246 (92%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDCVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010557672.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
 ref|XP_010557673.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   473 bits (1216),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 220/246 (89%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SV+HLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVSHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK++P F+Y ETVQTAISALQSVLQEDFKA+EIE+GVVR + P+FR L+T EIDEHLT
Sbjct  181  KKMKDNPTFTYNETVQTAISALQSVLQEDFKATEIEVGVVRADSPAFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis sativus]
 gb|KGN45477.1| hypothetical protein Csa_7G448880 [Cucumis sativus]
Length=246

 Score =   472 bits (1215),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 221/246 (90%), Positives = 240/246 (98%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+G+DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGRDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FRVL+T E+DEHLT
Sbjct  181  KKMKNDPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRSDNPIFRVLTTEEVDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_011001657.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
 ref|XP_011015647.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   472 bits (1215),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 225/246 (91%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDHVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006465892.1| PREDICTED: proteasome subunit alpha type-6-like [Citrus sinensis]
 gb|KDO64976.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=246

 Score =   472 bits (1214),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 223/246 (91%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLT
Sbjct  181  KKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010939895.1| PREDICTED: proteasome subunit alpha type-6-like [Elaeis guineensis]
Length=246

 Score =   471 bits (1213),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 222/246 (90%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKATGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEF F++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFHFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLG+VAMILGIDEEKGPQL KCDPAGHFFGHKATSAGVKEQEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGLVAMILGIDEEKGPQLLKCDPAGHFFGHKATSAGVKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP FSY ETVQTAISALQSV+QEDFKA+EIE+GVVR +DP FRVLST EIDEHLT
Sbjct  181  KKMKNDPKFSYGETVQTAISALQSVIQEDFKATEIEVGVVRTKDPVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006474716.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Citrus 
sinensis]
 gb|KDO73881.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=246

 Score =   471 bits (1212),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 222/246 (90%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTA+SALQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAVSALQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010541996.1| PREDICTED: proteasome subunit alpha type-6-B [Tarenaya hassleriana]
Length=246

 Score =   471 bits (1211),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 220/246 (89%), Positives = 238/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATS G+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSVGMKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR + P FR L+T EIDEHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADSPVFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_003595788.1| Proteasome subunit alpha type [Medicago truncatula]
 gb|AES66039.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
 gb|AFK48993.1| unknown [Medicago truncatula]
Length=246

 Score =   471 bits (1211),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 220/246 (89%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+Y+ETVQTAI+ALQSVLQEDFKA+EIE+GVV+++ P FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYDETVQTAIAALQSVLQEDFKATEIEVGVVQKDKPEFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_004303706.1| PREDICTED: proteasome subunit alpha type-6 [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   470 bits (1210),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 219/246 (89%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TK+LGLLATG+TADARTLV QARNEAA+FRF+ GYEMPVDVLA WIA+
Sbjct  61   LDQSSVTHLFPITKFLGLLATGMTADARTLVSQARNEAADFRFKNGYEMPVDVLANWIAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LG+DEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEETGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV  E+P+FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYDETVQTAISALQSVLQEDFKATEIEVGVVSMENPAFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002308263.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|EEE91786.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   470 bits (1210),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+ SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPSLSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDRIFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ABK95322.1| unknown [Populus trichocarpa]
Length=246

 Score =   470 bits (1209),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/246 (91%), Positives = 232/246 (94%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRY YEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYWYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPA SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPALSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDCVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|AFK46380.1| unknown [Lotus japonicus]
Length=246

 Score =   469 bits (1208),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 220/246 (89%), Positives = 238/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGV GKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVCGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLFP+TKYLGLLATG+TADARTL QQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLAQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E G QL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGAQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+GVVR+++P FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEVGVVRKDNPEFRVLSTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ACN66752.1| PAA1 [Carica papaya]
Length=246

 Score =   469 bits (1207),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 222/246 (90%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVV QKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVPQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEA EFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEATEFRFRYGYEMPVDALAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE+GPQLFKCDPAG F+GHKATSAG K+QEAINFLE
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEEEGPQLFKCDPAGFFYGHKATSAGSKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTAISALQSVLQEDFKA+EIE+GVVR E+P F VLST EIDEHLT
Sbjct  181  KKMKNDPAFSYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFHVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_011018964.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   469 bits (1206),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 223/246 (91%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVSHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAMILGIDEE GPQL+KCDPAGH+FGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMILGIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+ SYEETVQTAISALQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLT
Sbjct  181  KKMKNDPSLSYEETVQTAISALQSVLQEDFKATEIEVGVVRTGDRIFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|AFK46801.1| unknown [Medicago truncatula]
Length=246

 Score =   469 bits (1206),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 219/246 (89%), Positives = 238/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+Y+ETVQTAI+ALQSV QEDFKA+EIE+GVV+++ P FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYDETVQTAIAALQSVFQEDFKATEIEVGVVQKDKPEFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010533014.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   468 bits (1204),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 218/246 (89%), Positives = 238/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLF +TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFQITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGP L+KCDPAGHF+GHKATS G+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPLLYKCDPAGHFYGHKATSVGMKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L+T EIDEHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPVFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ACJ85912.1| unknown [Medicago truncatula]
Length=246

 Score =   467 bits (1201),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 218/246 (89%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVAHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP+F+Y+ETVQTAI+ALQSVLQEDFKA+EIE+GVV+++ P FRVLST EIDEHLT
Sbjct  181  KKMKNDPSFTYDETVQTAIAALQSVLQEDFKATEIEVGVVQKDKPEFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AI ERD
Sbjct  241  AIGERD  246



>ref|NP_178641.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 ref|XP_002883713.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O81147.1|PSA6B_ARATH RecName: Full=Proteasome subunit alpha type-6-B; AltName: Full=20S 
proteasome subunit alpha A-2; AltName: Full=Proteasome 
subunit alpha type-1 [Arabidopsis thaliana]
 gb|AAC32055.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AAC95161.1| 20S proteasome alpha subunit A2 (PAA2) [Arabidopsis thaliana]
 gb|AAK96583.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|AAN28768.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|EFH59972.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC05979.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=246

 Score =   465 bits (1197),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 217/246 (88%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR +DP FR L T EIDEHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADDPLFRSLRTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KFK32243.1| hypothetical protein AALP_AA6G216400 [Arabis alpina]
Length=246

 Score =   464 bits (1193),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 215/246 (87%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SV+HLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDASSVSHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFSYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRAENPVFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010435443.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
 ref|XP_010440739.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
Length=246

 Score =   463 bits (1192),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 214/246 (87%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF++ ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLT
Sbjct  181  KKMKENPAFTFNETVQTAISALQSVLQEDFKATEIEVGVVRAENPLFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010494382.1| PREDICTED: proteasome subunit alpha type-6-B [Camelina sativa]
Length=246

 Score =   463 bits (1191),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/246 (88%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SV+HLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRSLETEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010666851.1| PREDICTED: proteasome subunit alpha type-6 [Beta vulgaris subsp. 
vulgaris]
Length=246

 Score =   462 bits (1190),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 219/246 (89%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK++GITSI VRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKSSGITSIAVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSV+HLF VTKYLGLLATG+TADAR LVQQARNEAAEFR +YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVSHLFQVTKYLGLLATGMTADARNLVQQARNEAAEFRHKYGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP LFKCDPAGHF+GHKATSAG K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLFKCDPAGHFYGHKATSAGAKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSY+ETVQTAISALQSVLQEDFKA+EIE+GVV+  +P+FR L+T EIDEHLT
Sbjct  181  KKMKNDPAFSYDETVQTAISALQSVLQEDFKATEIEVGVVQVGNPAFRGLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010450390.1| PREDICTED: proteasome subunit alpha type-6-A [Camelina sativa]
Length=246

 Score =   462 bits (1190),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 214/246 (87%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYVGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LG+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLT
Sbjct  181  KKMKENPAFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPLFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006282775.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
 gb|EOA15673.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
Length=246

 Score =   462 bits (1190),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 213/246 (87%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TK++GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKFIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLT
Sbjct  181  KKMKENPAFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPLFRALTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010441957.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X1 
[Camelina sativa]
 ref|XP_010441958.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X2 
[Camelina sativa]
Length=246

 Score =   462 bits (1189),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 218/246 (89%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVTHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAGVKEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++  FR L T EI+EHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNRIFRSLETEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_009102355.1| PREDICTED: proteasome subunit alpha type-6-B [Brassica rapa]
 emb|CDY33398.1| BnaA07g04410D [Brassica napus]
 emb|CDY18045.1| BnaC07g04250D [Brassica napus]
Length=246

 Score =   462 bits (1189),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 215/246 (87%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRSLETEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   462 bits (1188),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 228/246 (93%), Positives = 239/246 (97%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA +TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV+AM+LGIDEE GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVIAMVLGIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKND AF+YEETVQTAISALQSVLQEDFKA+EIE+GVVR +D  FRVLST EIDEHLT
Sbjct  181  KKMKNDRAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRADDRVFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006474717.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Citrus 
sinensis]
 gb|KDO73882.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=244

 Score =   461 bits (1187),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 220/246 (89%), Positives = 234/246 (95%), Gaps = 2/246 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKK--DKL  58

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  59   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  118

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  178

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAFSYEETVQTA+SALQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLT
Sbjct  179  KKMKNDPAFSYEETVQTAVSALQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLT  238

Query  192  AISERD  175
            AISERD
Sbjct  239  AISERD  244



>ref|NP_198409.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
 sp|O81146.2|PSA6A_ARATH RecName: Full=Proteasome subunit alpha type-6-A; AltName: Full=20S 
proteasome subunit alpha A-1; AltName: Full=Proteasome 
component 1; AltName: Full=Proteasome subunit alpha type-1 
[Arabidopsis thaliana]
 dbj|BAB09993.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 dbj|BAF00393.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AED93984.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
Length=246

 Score =   460 bits (1184),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 211/246 (86%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLT
Sbjct  181  KKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_009136197.1| PREDICTED: proteasome subunit alpha type-6-B-like [Brassica rapa]
Length=246

 Score =   459 bits (1182),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 213/246 (87%), Positives = 237/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRCLETEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006396131.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
 gb|ESQ36910.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
Length=246

 Score =   459 bits (1181),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 214/246 (87%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVV+ ++P FR L T EI+EHLT
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVKADNPIFRSLETEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002870436.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46695.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   459 bits (1181),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV AM+LG+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVGAMVLGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLT
Sbjct  181  KKMKENPAFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|AAM12968.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AAM47883.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
Length=246

 Score =   459 bits (1180),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 210/246 (85%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQK+VPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKEVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLT
Sbjct  181  KKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006649499.1| PREDICTED: proteasome subunit alpha type-6-like [Oryza brachyantha]
Length=246

 Score =   458 bits (1178),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 214/246 (87%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP FSY+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDDPQFSYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha 
subunit [Arabidopsis thaliana]
Length=245

 Score =   457 bits (1177),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 210/245 (86%), Positives = 235/245 (96%), Gaps = 0/245 (0%)
 Frame = -1

Query  909  SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  730
            SRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  1    SRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLL  60

Query  729  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  550
            DQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIADK
Sbjct  61   DQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADK  120

Query  549  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEK  370
            SQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLEK
Sbjct  121  SQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEK  180

Query  369  KMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTA  190
            KMK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLTA
Sbjct  181  KMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTA  240

Query  189  ISERD  175
            ISERD
Sbjct  241  ISERD  245



>gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana]
Length=246

 Score =   457 bits (1175),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 209/246 (85%), Positives = 236/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM++G+DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            ++MK +P+F+++ETVQTAISALQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLT
Sbjct  181  EEMKGNPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|NP_001049162.1| Os03g0180400 [Oryza sativa Japonica Group]
 sp|Q9LSU3.1|PSA6_ORYSJ RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Oryza sativa Japonica Group]
 dbj|BAA96829.1| alpha 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 gb|AAN65435.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|AAO13479.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|ABF94305.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11076.1| Os03g0180400 [Oryza sativa Japonica Group]
 gb|EAY88785.1| hypothetical protein OsI_10259 [Oryza sativa Indica Group]
 gb|EAZ25813.1| hypothetical protein OsJ_09653 [Oryza sativa Japonica Group]
 dbj|BAG94887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87220.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   456 bits (1173),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 213/246 (87%), Positives = 234/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP FSYEETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLT
Sbjct  181  KKMKDDPQFSYEETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|NP_001130062.1| uncharacterized protein LOC100191154 [Zea mays]
 gb|ACF78183.1| unknown [Zea mays]
 gb|ACG28463.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG40310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACL54338.1| unknown [Zea mays]
Length=246

 Score =   455 bits (1171),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 235/246 (96%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+E+  FRVL+T EID+HLT
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEERLFRVLTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|KDO64977.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=241

 Score =   455 bits (1170),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 218/246 (89%), Positives = 232/246 (94%), Gaps = 5/246 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQV     AVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQV-----AVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  55

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  56   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  115

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  116  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLE  175

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLT
Sbjct  176  KKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLT  235

Query  192  AISERD  175
            AISERD
Sbjct  236  AISERD  241



>ref|XP_004985490.1| PREDICTED: proteasome subunit alpha type-6-like [Setaria italica]
Length=246

 Score =   454 bits (1169),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 234/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKKAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDDPQFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ACN33969.1| unknown [Zea mays]
 tpg|DAA43695.1| TPA: proteasome subunit alpha type [Zea mays]
Length=246

 Score =   454 bits (1169),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 211/246 (86%), Positives = 234/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLT
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_002465753.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
 gb|EER92751.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
Length=246

 Score =   454 bits (1168),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 211/246 (86%), Positives = 234/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|NP_001105138.1| maize 20S proteasome alpha subunit [Zea mays]
 emb|CAC19494.1| maize 20S proteasome alpha subunit [Zea mays]
Length=246

 Score =   452 bits (1163),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 210/246 (85%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKY+GLLATG+TAD R+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADGRSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLT
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>emb|CDY50408.1| BnaC03g45100D [Brassica napus]
Length=244

 Score =   452 bits (1162),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 235/246 (96%), Gaps = 2/246 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPL  VAM+LG+DEE+GP L+KCDPAGHF+GHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPL--VAMVLGMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLE  178

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLT
Sbjct  179  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADNPIFRSLETEEIEEHLT  238

Query  192  AISERD  175
            AISERD
Sbjct  239  AISERD  244



>ref|XP_003558667.1| PREDICTED: proteasome subunit alpha type-6 [Brachypodium distachyon]
Length=246

 Score =   450 bits (1158),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 209/246 (85%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD+TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAE+R ++GYEMPVDVLA+WIAD
Sbjct  61   LDETSVTHLFPITKYIGLLATGLTADARSLVSQARNEAAEYRKKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+ P F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDSPQFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>emb|CDX93103.1| BnaA03g38250D [Brassica napus]
Length=263

 Score =   449 bits (1154),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 236/263 (90%), Gaps = 17/263 (6%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD++SVTHLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVTHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGV-----------------VAMILGIDEEKGPQLFKCDPAGHFFGH  424
            KSQVYTQHAYMRPLGV                  AM+LG+DEE+GP L+KCDPAGHF+GH
Sbjct  121  KSQVYTQHAYMRPLGVGKFCTHFPTYLHIYTSTFAMVLGMDEERGPLLYKCDPAGHFYGH  180

Query  423  KATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQE  244
            KATSAG+KEQEAINFLEKKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+GVVR +
Sbjct  181  KATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRAD  240

Query  243  DPSFRVLSTVEIDEHLTAISERD  175
            +P FR L T EI+EHLTAISERD
Sbjct  241  NPIFRCLETEEIEEHLTAISERD  263



>gb|EMT09268.1| Proteasome subunit alpha type-6 [Aegilops tauschii]
Length=246

 Score =   447 bits (1149),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 209/246 (85%), Positives = 230/246 (93%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+ P FSY+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDSPQFSYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRSLTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|AGO97077.1| 20S proteasome alpha [Saccharum hybrid cultivar GT28]
Length=246

 Score =   446 bits (1147),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 231/246 (94%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEG L+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGHLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHL P+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLLPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+DP F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR  +T EID+HLT
Sbjct  181  KKMKDDPKFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRAPTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|ABK22399.1| unknown [Picea sitchensis]
 gb|ABK25916.1| unknown [Picea sitchensis]
Length=246

 Score =   446 bits (1147),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 232/246 (94%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK++GLLATG+TADAR+LVQ ARNEAAEFRF++GYEMPVDVLAR +AD
Sbjct  61   LDQTSVTHLFPITKFIGLLATGMTADARSLVQHARNEAAEFRFKWGYEMPVDVLARRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV A++LGIDEE GPQLFKCDPAGHF G+KAT+AGVKE EA++FLE
Sbjct  121  KSQVYTQHAYMRPLGVAAIVLGIDEESGPQLFKCDPAGHFVGYKATAAGVKESEAVSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+KN+P  SYEETVQTA+SALQSVLQEDFKA+EIE+GVV ++ P FR LST EIDEHLT
Sbjct  181  KKLKNNPELSYEETVQTAVSALQSVLQEDFKATEIEVGVVTKDSPVFRTLSTDEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>dbj|BAJ85935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   446 bits (1147),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 230/246 (93%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+Q+YTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMK+ P F+Y+ETVQ AISALQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLT
Sbjct  181  KKMKDSPQFTYDETVQIAISALQSVLQEDFKATEIEVGVVRKEDRVFRSLTTEEIDQHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_006452821.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
 gb|ESR66061.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
Length=235

 Score =   440 bits (1132),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/246 (86%), Positives = 224/246 (91%), Gaps = 11/246 (4%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV           GPQL+KCDPAGHFFGHKATSAG+KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGV-----------GPQLYKCDPAGHFFGHKATSAGLKEQEAINFLE  169

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP FSYEETVQTA+SALQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLT
Sbjct  170  KKMKNDPTFSYEETVQTAVSALQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLT  229

Query  192  AISERD  175
            AISERD
Sbjct  230  AISERD  235



>gb|KHG04433.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=226

 Score =   435 bits (1119),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 222/246 (90%), Gaps = 20/246 (8%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEEKGPQL+KCDPAGHF+GHKATSAG KEQEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDPAF+YEETVQ                    +GVV+ ++P FRV+ST EIDEHLT
Sbjct  181  KKMKNDPAFTYEETVQ--------------------VGVVKADNPVFRVMSTEEIDEHLT  220

Query  192  AISERD  175
            AISERD
Sbjct  221  AISERD  226



>gb|ABF94306.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
Length=286

 Score =   437 bits (1123),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 234/286 (82%), Gaps = 40/286 (14%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  742
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVP   
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPVSS  60

Query  741  -------------------------------------DKLLDQTSVTHLFPVTKYLGLLA  673
                                                 DKLLD TSVTHLFP+TKY+GLLA
Sbjct  61   LRFDLKRSRLYAVYTAIRDQERRLICLAPCDVILILQDKLLDHTSVTHLFPITKYIGLLA  120

Query  672  TGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMI  493
            TG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIADK+QVYTQHAYMRPLGVVAM+
Sbjct  121  TGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIADKAQVYTQHAYMRPLGVVAMV  180

Query  492  LGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAIS  313
            LG DEEK  QLFKCDPAGHFFGHKATSAG+KEQEAINFLEKKMK+DP FSYEETVQ AIS
Sbjct  181  LGYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPQFSYEETVQIAIS  240

Query  312  ALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            ALQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLTAISERD
Sbjct  241  ALQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLTAISERD  286



>ref|XP_001777426.1| predicted protein [Physcomitrella patens]
 gb|EDQ57713.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   428 bits (1101),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 226/246 (92%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGNDSVCFVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF VTKY+GLLATG+TADA++L+  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQTSVTHLFAVTKYIGLLATGMTADAKSLLAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG+KATS+G KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKNDP  S+E+TVQTAISALQS+L EDFK +EIE+GVVR   P FR+LST EIDEHLT
Sbjct  181  KKMKNDPQLSFEDTVQTAISALQSILLEDFKPTEIEVGVVRVGKPEFRILSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_001768229.1| predicted protein [Physcomitrella patens]
 gb|EDQ66843.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   426 bits (1095),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 225/246 (91%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLF VTK++GLLATG+TADA++L+  ARNEAA F+F  GYE+PVD LA+ IAD
Sbjct  61   LDQTSVTHLFAVTKFIGLLATGMTADAKSLIAHARNEAANFKFDLGYEIPVDYLAKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV AM++GID+E+GPQL+KCDPAGH+FG+KATS+G KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIGIDDEQGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+KN+P  SY+ETVQTAISALQS+L EDFK +EIE+GVVR   P FRVLST EIDEHLT
Sbjct  181  KKIKNNPQLSYDETVQTAISALQSILLEDFKPTEIEVGVVRAGKPEFRVLSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_010111992.1| Proteasome subunit alpha type-6 [Morus notabilis]
 gb|EXC32303.1| Proteasome subunit alpha type-6 [Morus notabilis]
Length=299

 Score =   428 bits (1100),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 205/227 (90%), Positives = 220/227 (97%), Gaps = 0/227 (0%)
 Frame = -1

Query  855  GRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLL  676
            GR    +YAFKAVKAAGITSIGV+GKDSVCVVTQKKVPDKLLDQTSVTHLFP+TKYLGLL
Sbjct  73   GRSSFPKYAFKAVKAAGITSIGVKGKDSVCVVTQKKVPDKLLDQTSVTHLFPITKYLGLL  132

Query  675  ATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAM  496
            ATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM
Sbjct  133  ATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAM  192

Query  495  ILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAI  316
            +LGID+E GP+L+KCDPAGHFFGHKATSAG+KEQEAINFLEKKMKNDPAF+YEETVQTAI
Sbjct  193  VLGIDDEFGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTYEETVQTAI  252

Query  315  SALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            SALQSVLQEDFKA+EIE+GVVRQ++P FRVLST EIDEHLTAISERD
Sbjct  253  SALQSVLQEDFKANEIEVGVVRQDNPVFRVLSTEEIDEHLTAISERD  299



>ref|XP_002989745.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
 ref|XP_002991751.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ07155.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ09222.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
Length=246

 Score =   425 bits (1092),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 224/246 (91%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K+ GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKSPGITSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SVTHL+ +T Y+GLLATG+TADAR+LVQ ARNEAAEFR + GYE+PVD L++ +AD
Sbjct  61   LDQSSVTHLYAITPYIGLLATGMTADARSLVQHARNEAAEFRHKNGYEIPVDFLSKRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV AMI+ IDEEKGPQLFKCDPAGH+ G++ATSAG+KEQEA+N LE
Sbjct  121  KSQVYTQHAYMRPLGVAAMIIAIDEEKGPQLFKCDPAGHYVGYRATSAGLKEQEAVNILE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KKMKN+P  SY+ETVQTAISALQS+L EDFKA+EIE+G+VR  DP F+++ST EIDEHLT
Sbjct  181  KKMKNNPQLSYDETVQTAISALQSILLEDFKATEIEVGIVRATDPKFQIMSTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|XP_001782615.1| predicted protein [Physcomitrella patens]
 gb|EDQ52604.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   423 bits (1087),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 224/246 (91%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ SVTHLF +TKY+GLLATG+TADA++LV  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQASVTHLFAITKYIGLLATGMTADAKSLVAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            +SQVYTQHAYMRPLGV AM++GID+E GPQL+KCDPAGH+FG+KATS+G KEQEA+NFLE
Sbjct  121  ESQVYTQHAYMRPLGVSAMLIGIDDELGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK K++P FSYEETVQ AISALQS+L EDFK +EIE+GVVR   P FRVL+T EIDEHLT
Sbjct  181  KKCKSNPQFSYEETVQIAISALQSILLEDFKPTEIEVGVVRASKPEFRVLTTEEIDEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>ref|NP_001031340.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AEC05980.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=220

 Score =   420 bits (1080),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 194/217 (89%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGIDEE+GP L+KCDPAGHF+GHKATSAG+KEQEA+NFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEI  262
            KKMK +PAF+Y+ETVQTAISALQSVLQEDFKA+EIE+
Sbjct  181  KKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEV  217



>gb|KDO64982.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=225

 Score =   420 bits (1079),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -1

Query  849  LFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLLAT  670
            +  +EYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKLLD TSVTHLFP+TKYLGLLAT
Sbjct  1    MILIEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKLLDHTSVTHLFPITKYLGLLAT  60

Query  669  GITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMIL  490
            G+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+L
Sbjct  61   GMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVL  120

Query  489  GIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISA  310
             IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAINFLEKKMKNDPAF+++ETVQTAIS 
Sbjct  121  SIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAIST  180

Query  309  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  181  LQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  225



>gb|KHN46954.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=560

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 215/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG+K+QEAINFLE
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGV  256
            KKMKNDP+F+YEETVQTAISALQSVLQEDFKA+EIE+ +
Sbjct  181  KKMKNDPSFTYEETVQTAISALQSVLQEDFKATEIEMSL  219



>ref|XP_001751730.1| predicted protein [Physcomitrella patens]
 gb|EDQ83165.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   401 bits (1030),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 222/246 (90%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK++GITSIGVRG+DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSSGITSIGVRGRDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD++SVTHLF VTK +GLLATG+T DA++LV  AR EAAEFRF+ GYE+PVD LA+ +AD
Sbjct  61   LDRSSVTHLFVVTKRIGLLATGMTGDAKSLVAGARAEAAEFRFKMGYEIPVDYLAKRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQVYTQHAYMRPLGV AM +G+D+E GP+L+KCDPAGHF G+KATS+G KEQEA+N L+
Sbjct  121  KSQVYTQHAYMRPLGVSAMFIGMDDEHGPRLYKCDPAGHFVGYKATSSGAKEQEAVNILD  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K++P  SY+ETVQTAI ALQS+L EDFK +EIE+GVV Q DP+FR+L+T +ID+HLT
Sbjct  181  KKLKHNPQLSYDETVQTAICALQSILLEDFKPTEIEVGVVSQADPNFRLLTTEDIDDHLT  240

Query  192  AISERD  175
            +ISERD
Sbjct  241  SISERD  246



>gb|AFW89473.1| hypothetical protein ZEAMMB73_334376 [Zea mays]
Length=214

 Score =   382 bits (981),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 204/246 (83%), Gaps = 32/246 (13%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVVAM+LG DEEK  QLFKCDPAGHFFGHK                
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLGYDEEKNAQLFKCDPAGHFFGHK----------------  164

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
                             AISALQSVLQEDFKA+EIE+GVVR+E+  FRVL+T EID+HLT
Sbjct  165  ----------------IAISALQSVLQEDFKATEIEVGVVRKEERLFRVLTTEEIDQHLT  208

Query  192  AISERD  175
            AISERD
Sbjct  209  AISERD  214



>ref|XP_005648429.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
 gb|EIE23885.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
Length=247

 Score =   380 bits (975),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 214/247 (87%), Gaps = 1/247 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSI VRGKDSV VVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIAVRGKDSVAVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D +SVTH+F +TK++G+LATG  ADAR+LVQ++R+ AAEFR  YGYE+PVD LA  +AD
Sbjct  61   IDPSSVTHMFKITKFIGMLATGQRADARSLVQKSRSIAAEFRHTYGYEIPVDYLAARLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            ++QVYTQHAYMRPL VV ++ GIDEE GPQLFK DPAG++ G+KATSAG K+QEA NFLE
Sbjct  121  QAQVYTQHAYMRPLAVVLILAGIDEEAGPQLFKVDPAGYYVGYKATSAGAKDQEADNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVR-QEDPSFRVLSTVEIDEHL  196
            K+ K +P FS+EET QTAI+ALQSVL EDFKASEIE+GVVR  E   FRVL   E+++HL
Sbjct  181  KRFKGNPEFSFEETAQTAIAALQSVLAEDFKASEIEVGVVRASEGGVFRVLGVEEVEDHL  240

Query  195  TAISERD  175
            +AISERD
Sbjct  241  SAISERD  247



>ref|XP_001691723.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
 gb|EDP04831.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
Length=249

 Score =   367 bits (942),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 213/250 (85%), Gaps = 5/250 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSIGVRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIGVRGKDSVVFVTQKKVQDKL  59

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D TSVT LF +TK++G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKFIGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGVV+M++G+DEE+GPQLFK DPAG++ G+KATS GVKE EA NFLE
Sbjct  120  KAQVYTQHAYMRPLGVVSMLIGVDEERGPQLFKVDPAGYYVGYKATSVGVKETEANNFLE  179

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQ----EDPSFRVLSTVEID  205
            KK K++P F+Y+E V TAI+ALQ VL E+FK+S++E+GVVR      D SFRVL+T E+D
Sbjct  180  KKFKSNPQFTYDEAVTTAIAALQGVLSEEFKSSDLEVGVVRAGSEGGDGSFRVLTTEEVD  239

Query  204  EHLTAISERD  175
             +LT ISERD
Sbjct  240  HYLTIISERD  249



>ref|XP_002949740.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
 gb|EFJ49292.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
Length=249

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 211/250 (84%), Gaps = 5/250 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSI VRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIAVRGKDSVVFVTQKKVQDKL  59

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D TSVT LF +TKY+G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKYVGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            K+QVYTQHAYMRPLGV++M++GIDEE+GPQLFK DPAG++ G+KAT+ GVKE EA NFLE
Sbjct  120  KAQVYTQHAYMRPLGVISMLIGIDEERGPQLFKVDPAGYYVGYKATAVGVKETEAHNFLE  179

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQ----EDPSFRVLSTVEID  205
            KK+K +PA SY+E V TAISALQ VL E+FKA+++E+GVVR      D +FRVL+T E+D
Sbjct  180  KKLKGNPALSYDEAVITAISALQGVLSEEFKAADLEVGVVRNGPDGSDRAFRVLTTEEVD  239

Query  204  EHLTAISERD  175
              LT ISERD
Sbjct  240  HFLTIISERD  249



>gb|KDO64983.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64984.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=191

 Score =   355 bits (911),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  741  DKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARW  562
            DKLLD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+W
Sbjct  3    DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW  62

Query  561  IADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAIN  382
            IADKSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG+KEQEAIN
Sbjct  63   IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN  122

Query  381  FLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDE  202
            FLEKKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDE
Sbjct  123  FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE  182

Query  201  HLTAISERD  175
            HLTAISERD
Sbjct  183  HLTAISERD  191



>ref|XP_003059392.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56524.1| predicted protein [Micromonas pusilla CCMP1545]
Length=249

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/249 (68%), Positives = 206/249 (83%), Gaps = 3/249 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLYQVEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D   VTH+F +TK +G+ ATG + D R +VQ+AR++AAEFR  +GYE+PVD L+  +AD
Sbjct  61   VDPADVTHMFKITKVIGMCATGKSPDIRNVVQKARHKAAEFRHEFGYEIPVDFLSTRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            + QVYTQHAYMRP+  + M +GIDEEKGP LFK DPAG+  G+KATSAGVKEQEAINFLE
Sbjct  121  EFQVYTQHAYMRPMAAMCMFVGIDEEKGPCLFKNDPAGYCVGYKATSAGVKEQEAINFLE  180

Query  372  KKMKND---PAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDE  202
            KK+K +    AF   ET+QTAIS LQSVL ED K+ E+E+G+V  E+ +FR+LS+  I+E
Sbjct  181  KKVKGENAGNAFDETETIQTAISCLQSVLGEDLKSKELEVGIVTTENKNFRLLSSDVIEE  240

Query  201  HLTAISERD  175
            HLTAISERD
Sbjct  241  HLTAISERD  249



>ref|XP_001418143.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96436.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   349 bits (895),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 205/246 (83%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+G GYDRHIT+FSPEGRL+QVEYAFKA+K+ G+T+IGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGAGAGYDRHITVFSPEGRLYQVEYAFKAIKSVGVTTIGVRGKDSVCVVTQKKIPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D + VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGYE+PVDVLA  +AD
Sbjct  61   IDASDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQHYGYEVPVDVLANILAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG+F G+ ATSAG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLAVMVILIAVDEDRGPSLFKCDPAGYFVGYSATSAGAKEVEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K+  +F   +T Q AISALQ VL E+ KASE+E+ VV  ++P+FRV+S  E+++HLT
Sbjct  181  KKVKSGASFDVNQTAQLAISALQHVLGEEVKASELEVAVVTADNPNFRVISESEVEDHLT  240

Query  192  AISERD  175
            +ISERD
Sbjct  241  SISERD  246



>gb|KDD75255.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=248

 Score =   347 bits (890),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 204/247 (83%), Gaps = 2/247 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K +G+TS+ VRG DSV  V+QKKVPDK+
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKTSGLTSVAVRGADSVVFVSQKKVPDKM  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D +S+T+++ +T   GLL TG+  DAR+LV +AR+EAAEFRF+YGYEMPVDVLAR +AD
Sbjct  61   VDASSITNIYKITACTGLLVTGMHGDARSLVHKARSEAAEFRFKYGYEMPVDVLARVLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            ++QV+TQHAYMRPLGV+A I+G+DEE+GPQLFK DPAG+F G+KAT+AGVKEQEAIN LE
Sbjct  121  QAQVHTQHAYMRPLGVIATIIGVDEERGPQLFKVDPAGYFVGYKATAAGVKEQEAINALE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVV--RQEDPSFRVLSTVEIDEH  199
            K+ K++P ++ ++T+Q AI  LQ VL ED KA+++E+GV   R    SFR L   EI EH
Sbjct  181  KRFKSNPEYTLDQTIQAAIEILQDVLGEDLKATDVEVGVAERRNAMSSFRTLPVSEIAEH  240

Query  198  LTAISER  178
            + A++ER
Sbjct  241  VIALAER  247



>emb|CEF98211.1| Proteasome A-type subunit [Ostreococcus tauri]
Length=246

 Score =   345 bits (886),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 204/246 (83%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  GYDRHIT+FSP+GRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSTAGYDRHITVFSPDGRLYQVEYAFKAIKSVGMTSIGVRGKDSVCVVTQKKIPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D T VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGY++PVDVLA  +AD
Sbjct  61   IDPTDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQNYGYDVPVDVLANILAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            + QVYTQHAYMRPL V+ +++ +DE++GP LFKCDPAG++ G++ATSAG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLAVMVILVSMDEDRGPSLFKCDPAGYYVGYRATSAGSKEVEAVNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K   +F   ET Q AISALQ VL E+ KASE+E+ +V  ++P+FRV+S  +++EHLT
Sbjct  181  KKVKAGSSFDANETAQLAISALQHVLGEEVKASELEVAIVTADNPAFRVISESQVEEHLT  240

Query  192  AISERD  175
            AISERD
Sbjct  241  AISERD  246



>gb|AFK44903.1| unknown [Medicago truncatula]
Length=176

 Score =   342 bits (876),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEM VDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMLVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEA  388
            KSQVYTQHAYMRPLGVVAM+LGID+E GPQL+KCDPAGH+FGHKATSAG K+QE 
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLGIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEG  175



>ref|XP_005843942.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
 gb|EFN51840.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
Length=246

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 201/247 (81%), Gaps = 2/247 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MS GSGG YDRHITIFSPEGRL+QVEYAFKA K+ G+T+I VRG DSVC VTQ+KVPDKL
Sbjct  1    MSHGSGG-YDRHITIFSPEGRLYQVEYAFKAAKSNGLTAIAVRGTDSVCFVTQRKVPDKL  59

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
             D +SVT +  +TK +G+L TG+  DAR+L+Q+AR+EAAEFRF++GYEMPV  LAR +AD
Sbjct  60   TDPSSVTQIHSITKNIGMLLTGMHGDARSLMQKARSEAAEFRFKFGYEMPVHYLARVLAD  119

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            ++QVYTQHAYMRPLGV+ +++ IDEE+GPQLFK DPAG+F G+KAT+AGVKE EA+N LE
Sbjct  120  QAQVYTQHAYMRPLGVIPILIAIDEERGPQLFKVDPAGYFVGYKATAAGVKETEAVNMLE  179

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPS-FRVLSTVEIDEHL  196
            KK K  P +S +E V+ AIS LQ VL ED K S+IE+G+   +D   FRVLS  E++EHL
Sbjct  180  KKFKTGPQYSQKEVVELAISTLQHVLGEDLKVSDIEVGLASAQDGGRFRVLSCEELEEHL  239

Query  195  TAISERD  175
             AISERD
Sbjct  240  VAISERD  246



>gb|ESA18832.1| hypothetical protein GLOINDRAFT_344383 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71315.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=245

 Score =   340 bits (871),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 201/246 (82%), Gaps = 1/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+R S G YDRHITIFSPEGRL+QVEYAFKA+  +G+TS+GVRGKDSV +VTQKK+PDKL
Sbjct  1    MNRSSAG-YDRHITIFSPEGRLYQVEYAFKAISNSGVTSVGVRGKDSVVIVTQKKIPDKL  59

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTH+F ++ Y+G + TG+ ADAR  V +AR EAAEFR+++GY MP D+LA+ +A+
Sbjct  60   LDPSTVTHMFQLSPYVGCVMTGLIADARAQVTRARQEAAEFRYKFGYYMPSDMLAKRVAN  119

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQHA MRPLGV  +++G D+E+GPQLFKCDPAG++ G+KAT+AG K+QEA+N LE
Sbjct  120  INQVYTQHAAMRPLGVSMILIGYDDERGPQLFKCDPAGYYVGYKATAAGAKQQEALNHLE  179

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K DP   +EETV+ AI+ L SVL  DFK++EIE+ VV ++DP FR LS  EID+HL 
Sbjct  180  KKLKKDPVLDFEETVELAINTLSSVLSADFKSTEIEVAVVTKDDPKFRTLSINEIDDHLQ  239

Query  192  AISERD  175
             I E+D
Sbjct  240  RIVEKD  245



>ref|NP_989113.1| proteasome subunit alpha type-6 [Xenopus (Silurana) tropicalis]
 gb|AAH61438.1| proteasome (prosome, macropain) subunit, alpha type 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81265.1| proteasome (prosome macropain) subunit alpha type 6 [Xenopus 
(Silurana) tropicalis]
Length=246

 Score =   339 bits (870),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+T++TAIS L +VL  DFK SE+E+GVV  EDP FRVL+  EID HL 
Sbjct  181  KKVKKKLDWTYEQTLETAISCLSTVLSIDFKPSELEVGVVTVEDPKFRVLTEAEIDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_006835407.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysochloris 
asiatica]
Length=246

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 203/246 (83%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+I+FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESISFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_537412.2| PREDICTED: proteasome subunit alpha type-6 isoformX2 [Canis lupus 
familiaris]
 ref|XP_002922862.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_004399857.1| PREDICTED: proteasome subunit alpha type-6 [Odobenus rosmarus 
divergens]
 ref|XP_004773396.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820513.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_005080563.1| PREDICTED: proteasome subunit alpha type-6 [Mesocricetus auratus]
 ref|XP_005343781.1| PREDICTED: proteasome subunit alpha type-6 [Microtus ochrogaster]
 ref|XP_006732281.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006891612.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Elephantulus 
edwardii]
 ref|XP_003509963.2| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Cricetulus 
griseus]
 ref|XP_007632099.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Cricetulus 
griseus]
 ref|XP_008692325.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ursus 
maritimus]
 gb|ERE72544.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=246

 Score =   338 bits (866),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004436462.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Ceratotherium 
simum simum]
Length=246

 Score =   337 bits (865),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF VT+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKVTENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|NP_001264372.1| proteasome subunit alpha type-6 [Gallus gallus]
 ref|XP_003206625.1| PREDICTED: proteasome subunit alpha type-6 [Meleagris gallopavo]
Length=246

 Score =   337 bits (865),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFSITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTETEIDMHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|EDL36728.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_b, partial [Mus musculus]
Length=251

 Score =   337 bits (865),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  6    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  65

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  66   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  125

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  126  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  185

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  186  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  245

Query  192  AISERD  175
            A++ERD
Sbjct  246  ALAERD  251



>ref|NP_058979.1| proteasome subunit alpha type-6 [Rattus norvegicus]
 ref|NP_002782.1| proteasome subunit alpha type-6 isoform a [Homo sapiens]
 ref|NP_001039427.1| proteasome subunit alpha type-6 [Bos taurus]
 ref|NP_001180482.1| proteasome subunit alpha type-6 [Macaca mulatta]
 ref|NP_001233586.1| proteasome subunit alpha type-6 [Pan troglodytes]
 ref|NP_001271993.1| uncharacterized protein LOC101866963 [Macaca fascicularis]
 ref|NP_001272627.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Capra 
hircus]
 ref|XP_001491320.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Equus caballus]
 ref|XP_002718187.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_003408905.1| PREDICTED: proteasome subunit alpha type-6 [Loxodonta africana]
 ref|XP_003792017.1| PREDICTED: proteasome subunit alpha type-6 [Otolemur garnettii]
 ref|XP_003821244.1| PREDICTED: proteasome subunit alpha type-6 [Pan paniscus]
 ref|XP_003987590.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Felis 
catus]
 ref|XP_004270016.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Orcinus 
orca]
 ref|XP_004319607.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Tursiops 
truncatus]
 ref|XP_004376568.1| PREDICTED: proteasome subunit alpha type-6 [Trichechus manatus 
latirostris]
 ref|XP_004681993.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Condylura 
cristata]
 ref|XP_004884716.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_004867614.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_005376980.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005891864.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Bos mutus]
 ref|XP_006186437.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Camelus 
ferus]
 ref|XP_006212818.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Vicugna 
pacos]
 ref|XP_006913536.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus alecto]
 ref|XP_007073792.1| PREDICTED: proteasome subunit alpha type-6 [Panthera tigris altaica]
 ref|XP_007119012.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Physeter 
catodon]
 ref|XP_006043909.1| PREDICTED: proteasome subunit alpha type-6 [Bubalus bubalis]
 ref|XP_007464884.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007936738.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Orycteropus 
afer afer]
 ref|XP_007984674.1| PREDICTED: proteasome subunit alpha type-6 [Chlorocebus sabaeus]
 ref|XP_008069643.1| PREDICTED: proteasome subunit alpha type-6 [Tarsius syrichta]
 ref|XP_008511175.1| PREDICTED: proteasome subunit alpha type-6 [Equus przewalskii]
 ref|XP_008572098.1| PREDICTED: proteasome subunit alpha type-6 [Galeopterus variegatus]
 ref|XP_008831132.1| PREDICTED: proteasome subunit alpha type-6 [Nannospalax galili]
 ref|XP_010631915.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Fukomys 
damarensis]
 ref|XP_010833601.1| PREDICTED: proteasome subunit alpha type-6 [Bison bison bison]
 ref|XP_010966161.1| PREDICTED: proteasome subunit alpha type-6 [Camelus bactrianus]
 ref|XP_010984427.1| PREDICTED: proteasome subunit alpha type-6 [Camelus dromedarius]
 ref|XP_011374978.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus vampyrus]
 ref|XP_011781268.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Colobus 
angolensis palliatus]
 ref|XP_011733201.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Macaca 
nemestrina]
 sp|P60901.1|PSA6_RAT RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Rattus norvegicus]
 sp|P60900.1|PSA6_HUMAN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=27 
kDa prosomal protein; Short=PROS-27; Short=p27K; AltName: 
Full=Macropain iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota 
chain [Homo sapiens]
 sp|Q2YDE4.1|PSA6_BOVIN RecName: Full=Proteasome subunit alpha type-6 [Bos taurus]
 pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|O Chain O, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 emb|CAA42052.1| prosomal P27K protein [Homo sapiens]
 dbj|BAA01587.1| proteasome subunit R-IOTA [Rattus sp.]
 gb|AAH02979.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH17882.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH22354.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH23659.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH62232.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 gb|AAH70137.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 emb|CAG33225.1| PSMA6 [Homo sapiens]
 dbj|BAE01337.1| unnamed protein product [Macaca fascicularis]
 gb|AAI10261.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Bos taurus]
 gb|EAW65877.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_b [Homo sapiens]
 gb|ABM83272.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 gb|EDM03426.1| proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 dbj|BAG35846.1| unnamed protein product [Homo sapiens]
 gb|ACM47241.1| proteasome subunit alpha type 6 [Capra hircus]
 dbj|BAI46667.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 tpg|DAA17455.1| TPA: proteasome subunit alpha type-6 [Bos taurus]
 dbj|BAK63685.1| proteasome subunit alpha type 6 [Pan troglodytes]
 gb|EHB02978.1| Proteasome subunit alpha type-6 [Heterocephalus glaber]
 gb|EHH27823.1| hypothetical protein EGK_18113 [Macaca mulatta]
 gb|EHH63557.1| hypothetical protein EGM_16549 [Macaca fascicularis]
 gb|ELK11320.1| Proteasome subunit alpha type-6 [Pteropus alecto]
 gb|ELR59203.1| Proteasome subunit alpha type-6 [Bos mutus]
 gb|AIC63124.1| PSMA6, partial [synthetic construct]
 gb|KFO29294.1| Proteasome subunit alpha type-6 [Fukomys damarensis]
 prf||1912298A prosomal RNA-binding protein p27K
Length=246

 Score =   337 bits (864),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004470220.1| PREDICTED: proteasome subunit alpha type-6 [Dasypus novemcinctus]
Length=246

 Score =   337 bits (864),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTIENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004698589.1| PREDICTED: proteasome subunit alpha type-6 [Echinops telfairi]
 ref|XP_006085896.1| PREDICTED: proteasome subunit alpha type-6 [Myotis lucifugus]
 ref|XP_006759764.1| PREDICTED: proteasome subunit alpha type-6 [Myotis davidii]
 ref|XP_008157203.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eptesicus 
fuscus]
 gb|ELK33263.1| Proteasome subunit alpha type-6 [Myotis davidii]
Length=246

 Score =   337 bits (864),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|NP_036098.1| proteasome subunit alpha type-6 [Mus musculus]
 ref|XP_010383847.1| PREDICTED: proteasome subunit alpha type-6 [Rhinopithecus roxellana]
 sp|Q9QUM9.1|PSA6_MOUSE RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Mus musculus]
 pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|U Chain U, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|II Chain i, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|WW Chain w, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|G Chain G, Mouse Constitutive 20s Proteasome
 pdb|3UNE|U Chain U, Mouse Constitutive 20s Proteasome
 pdb|3UNE|II Chain i, Mouse Constitutive 20s Proteasome
 pdb|3UNE|WW Chain w, Mouse Constitutive 20s Proteasome
 pdb|3UNF|G Chain G, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|U Chain U, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|G Chain G, Mouse 20s Immunoproteasome
 pdb|3UNH|U Chain U, Mouse 20s Immunoproteasome
 gb|AAD50532.1|AF060087_1 proteasome subunit iota [Mus musculus]
 gb|AAF21459.1|U60288_1 proteasome subunit iota [Mus musculus]
 dbj|BAC40169.1| unnamed protein product [Mus musculus]
 dbj|BAE31592.1| unnamed protein product [Mus musculus]
 gb|AAH86685.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Mus musculus]
Length=246

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|NP_001232198.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
 ref|XP_005479894.1| PREDICTED: proteasome subunit alpha type-6 [Zonotrichia albicollis]
 ref|XP_005520349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pseudopodoces 
humilis]
 gb|ACH43691.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
Length=246

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_001095366.1| PREDICTED: proteasome subunit alpha type-6-like isoform 1 [Macaca 
mulatta]
 ref|XP_001095483.1| PREDICTED: proteasome subunit alpha type-6-like isoform 2 [Macaca 
mulatta]
Length=246

 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+Q+EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQIEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004649175.1| PREDICTED: proteasome subunit alpha type-6 [Jaculus jaculus]
Length=246

 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  ++P FR+LS  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVDNPKFRILSEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|NP_001088418.1| uncharacterized protein LOC495277 [Xenopus laevis]
 gb|AAH84423.1| LOC495277 protein [Xenopus laevis]
Length=246

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++Y +T++TAIS L +VL  DFK SE+E+GVV  +DP FRVL+  EID HL 
Sbjct  181  KKVKKKLDWTYGQTLETAISCLSTVLSIDFKPSELEVGVVTVQDPKFRVLTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_009901279.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Picoides 
pubescens]
 gb|KFV69230.1| Proteasome subunit alpha type-6 [Picoides pubescens]
Length=246

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_007180773.1| PREDICTED: proteasome subunit alpha type-6 [Balaenoptera acutorostrata 
scammoni]
Length=246

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_006258805.1| PREDICTED: proteasome subunit alpha type-6 [Alligator mississippiensis]
Length=246

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_006172412.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 6 [Tupaia chinensis]
Length=246

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK  E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKXTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_010153543.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eurypyga 
helias]
 ref|XP_010581956.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Haliaeetus 
leucocephalus]
 ref|XP_011571052.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Aquila 
chrysaetos canadensis]
Length=246

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|NP_001132918.1| proteasome subunit alpha type-6 [Ovis aries]
 gb|ACI46679.1| proteasome subunit alpha type 6 [Ovis aries]
Length=246

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQSAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_005149366.1| PREDICTED: proteasome subunit alpha type-6 [Melopsittacus undulatus]
Length=246

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDGHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_005865030.1| PREDICTED: proteasome subunit alpha type-6 [Myotis brandtii]
 gb|EPQ06979.1| Proteasome subunit alpha type-6 [Myotis brandtii]
Length=246

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG + G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGSYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|ABM86477.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
Length=246

 Score =   335 bits (860),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++E+D
Sbjct  241  ALAEKD  246



>ref|XP_011850428.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Mandrillus 
leucophaeus]
Length=246

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+G V  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGAVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|EIE83838.1| hypothetical protein RO3G_08543 [Rhizopus delemar RA 99-880]
Length=246

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G   TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LAR +A+
Sbjct  61   LDPSTITHVFKLTPKIGCAMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLARRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G+KAT+AG K+QEA+N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDEFGPQLYKCDPAGYFVGYKATAAGAKQQEALNHLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L SVL  DFKASEIEIGVV +E+  FR LST EI++HL 
Sbjct  181  KKLKKNPELNMEDTIELAITTLSSVLAVDFKASEIEIGVVTKENTDFRTLSTEEIEDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>ref|XP_003924255.1| PREDICTED: proteasome subunit alpha type-6 [Saimiri boliviensis 
boliviensis]
Length=283

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 202/247 (82%), Gaps = 0/247 (0%)
 Frame = -1

Query  915  KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  736
             MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDK
Sbjct  37   NMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDK  96

Query  735  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  556
            LLD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  97   LLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIA  156

Query  555  DKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFL  376
            D SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FL
Sbjct  157  DISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFL  216

Query  375  EKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHL  196
            EKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL
Sbjct  217  EKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHL  276

Query  195  TAISERD  175
             A++ERD
Sbjct  277  VALAERD  283



>ref|XP_006985315.1| PREDICTED: proteasome subunit alpha type-6 [Peromyscus maniculatus 
bairdii]
Length=246

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GID E+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDGEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>emb|CEG74212.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEJ00907.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEI93442.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
Length=246

 Score =   335 bits (858),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK+PDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQKKIPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG+F G+KAT+AG K+QEA+N+LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYFVGYKATAAGAKQQEALNYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKA+E+EIG+V +++  FR LST EID+HL 
Sbjct  181  KKLKKNPELNMEDTIELAITTLSNVLAVDFKAAELEIGIVTKDNTDFRTLSTEEIDDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>ref|XP_003471921.1| PREDICTED: proteasome subunit alpha type-6 [Cavia porcellus]
Length=246

 Score =   335 bits (858),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+ AI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVEIAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_007436765.1| PREDICTED: proteasome subunit alpha type-6 [Python bivittatus]
Length=246

 Score =   335 bits (858),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIEIGVV  ++P FR+L+  EID HL 
Sbjct  181  KKVKKKLDWTFEQTVETAITCLSTVLSIDFKPSEIEIGVVTVDNPKFRILTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|KIY96698.1| 20S proteasome subunit alpha 1 [Monoraphidium neglectum]
Length=290

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 210/290 (72%), Gaps = 44/290 (15%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAV+ +GITSI +RGKD VC VTQKKV DKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVRQSGITSIAIRGKDCVCFVTQKKVQDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D  +VT +F +TKY+G+L TG+ AD+R++VQQAR +AAEFRF YGYE+PVD LA+ +AD
Sbjct  61   IDPGTVTRIFKITKYIGMLVTGLPADSRSVVQQARQQAAEFRFTYGYEVPVDYLAKVLAD  120

Query  552  KSQVYT-------------------------------------QHAYMRPLGVVAMILGI  484
            K+QVYT                                     QHAYMRPLGV++M++ +
Sbjct  121  KAQVYTQVGAGMLAGRGPPPADWGCPLTPPAGARWLAPPTALSQHAYMRPLGVISMLVSV  180

Query  483  DEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPA--FSYEETVQTAISA  310
            DEE+GP LFK DPAG++ G+KAT+ G KE EA+NFLEKK++  PA   SY++T QTAISA
Sbjct  181  DEERGPSLFKVDPAGYYVGYKATAVGTKETEAVNFLEKKVRAMPAEGASYDDTCQTAISA  240

Query  309  LQSVLQEDFKASEIEIGVVR-----QEDPSFRVLSTVEIDEHLTAISERD  175
            LQSVL EDFKASEIE+GV R     +++ +F+VL   E+D  L AISERD
Sbjct  241  LQSVLAEDFKASEIEVGVARTSWDGRDERAFKVLPVEEVDAFLVAISERD  290



>ref|XP_003445487.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
 ref|XP_005738779.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005933943.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
 ref|XP_006799416.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=246

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 197/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+T++TAIS L +VL  DFK SE+EIGV+  ++P F++LS  EID HL 
Sbjct  181  KKVKKKLDWTYEQTIETAISCLSTVLSIDFKPSELEIGVITAQEPKFKILSEAEIDAHLM  240

Query  192  AISERD  175
             +SER+
Sbjct  241  TLSERE  246



>ref|XP_005717620.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
 emb|CDF37749.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
Length=251

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 198/251 (79%), Gaps = 5/251 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  GYDRHITIFSPEGRLFQVEYAFKAVK  GIT+I VRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLFQVEYAFKAVKGPGITAIAVRGKDSVCAVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D +SV+  F +++  G +ATGI  DA+ +VQ+ R+EAAEF+F Y YE+PV+ LAR +AD
Sbjct  61   IDPSSVSSAFRLSENHGCIATGIITDAKAMVQRTRSEAAEFKFNYAYEIPVEYLARRVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            ++Q+YTQHAYMRPLGV   I+G+DEE+GP L+KCDPAGH+ G++A +AG KEQEA+NFL+
Sbjct  121  ENQIYTQHAYMRPLGVSLTIIGMDEEEGPALYKCDPAGHYVGYRACAAGAKEQEALNFLQ  180

Query  372  KKMKNDPA-----FSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEI  208
             K K+         S ++T+QT I+ALQ+VL  DFK  EIE+ VV + +P F +L   EI
Sbjct  181  NKFKSGDGSIGVELSEKDTIQTTIAALQNVLSADFKPEEIEVAVVSKSNPKFHLLEAKEI  240

Query  207  DEHLTAISERD  175
            ++HLTA++ERD
Sbjct  241  EDHLTALAERD  251



>gb|EPB88050.1| proteasome subunit alpha type-6 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=246

 Score =   334 bits (857),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V +ED  FR LST EI++HL 
Sbjct  181  KKLKKNPELNMEDTIELAITTLSTVLAVDFKASEIEVGIVHKEDTDFRTLSTEEIEDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>ref|NP_001002589.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAH76196.1| Zgc:92716 [Danio rerio]
Length=246

 Score =   334 bits (856),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+ V+TAI+ L +VL  DFK SE+EIGV+  EDP FR+LS  E+D HL 
Sbjct  181  KKVKKKLDWTFEQAVETAITCLTTVLSIDFKPSELEIGVITAEDPKFRILSESEVDTHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>ref|XP_007530301.1| PREDICTED: proteasome subunit alpha type-6 [Erinaceus europaeus]
Length=246

 Score =   334 bits (856),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GVV  +DP FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSELEVGVVTIDDPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_010876681.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   334 bits (856),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVFKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV+  EDP FR+LS  E+D HL 
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILSESEVDTHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_001363110.1| PREDICTED: proteasome subunit alpha type-6 [Monodelphis domestica]
Length=246

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSELEVGVVTVENPKFRILTESEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_005842332.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
 gb|EKX55352.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
Length=252

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  742
            MSR S  GYDR IT+FSPEGRL+Q+EYAFKAVKAAGIT++GVRG DSVC+VTQKKV    
Sbjct  1    MSRNSSSGYDRLITVFSPEGRLYQIEYAFKAVKAAGITTVGVRGADSVCIVTQKKVAQGH  60

Query  741  --DKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLA  568
              DKLLD +SVTH++ VT+ +G + TG  ADAR  +Q+ R EAA+FR++YGY+MP +VLA
Sbjct  61   SQDKLLDPSSVTHMYRVTETIGCVQTGHQADARAQIQRVRQEAAQFRYKYGYDMPPEVLA  120

Query  567  RWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEA  388
            + +AD +QVYTQHA MRP GV  M+ G+D+EKGPQLF CDPAGH+ G+KA +AG K+ EA
Sbjct  121  KRVADMNQVYTQHAGMRPYGVTMMLCGMDDEKGPQLFMCDPAGHYLGYKAVAAGQKDLEA  180

Query  387  INFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPS-FRVLSTVE  211
             N LEKK+KN P  SY+ET+Q AI+ LQSVL  DFK S+IE+GVV +++   FR L   E
Sbjct  181  KNMLEKKLKNSPTLSYDETIQMAITVLQSVLSADFKCSDIEVGVVNKDNKGRFRQLDEAE  240

Query  210  IDEHLTAISERD  175
            I+ HL AISERD
Sbjct  241  IERHLVAISERD  252



>ref|XP_003971508.1| PREDICTED: proteasome subunit alpha type-6 [Takifugu rubripes]
Length=246

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVITTQDPKFRILTETEVDTHLM  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>dbj|BAE36518.1| unnamed protein product [Mus musculus]
Length=246

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MR LG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRTLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_006632201.1| PREDICTED: proteasome subunit alpha type-6-like [Lepisosteus 
oculatus]
Length=246

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITETIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEFGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++++TV+TAI+ L +VL  DFK SE+EIGVV  EDP FR+LS  EID HL 
Sbjct  181  KKVKKKLDWTFDQTVETAITCLSTVLSIDFKPSELEIGVVTTEDPKFRILSEAEIDGHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>dbj|GAN03133.1| proteasome subunit alpha type-6 [Mucor ambiguus]
Length=246

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR  V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARAQVTKARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILVGYDDELGPQLYKCDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+GVV +ED  FR LST EI++HL 
Sbjct  181  KKLKKNPELNMEDTIELAITTLSTVLAVDFKASEIEVGVVHKEDTDFRTLSTEEIEDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>ref|NP_001086785.1| proteasome alpha 6 subunit [Xenopus laevis]
 gb|AAH77442.1| Psma6-prov protein [Xenopus laevis]
 dbj|BAD42870.1| 20S proteasome alpha1 subunit [Xenopus laevis]
Length=246

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ+FKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+T++TAIS L +VL  DFK SE+E+ VV  +DP F+VL+  EID HL 
Sbjct  181  KKVKKKLDWTYEQTLETAISCLSTVLSIDFKPSELEVAVVTVQDPKFKVLTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_005158685.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Danio 
rerio]
 gb|AAH55520.1| Psma6a protein [Danio rerio]
 gb|AAI64827.1| Psma6a protein [Danio rerio]
Length=246

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++++TV+TAIS L +VL  DFK SE+EIGVV  E+P FR+LS  EID HL 
Sbjct  181  KKIKKKLDWTFDQTVETAISCLSTVLAIDFKPSELEIGVVTTEEPKFRILSESEIDTHLM  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALTERD  246



>emb|CDS07623.1| Putative Proteasome subunit alpha type [Absidia idahoensis var. 
thermophila]
Length=246

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGKDGCVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V ++ P FR LS  EID+HL 
Sbjct  181  KKLKKNPTLNMEDTIELAITTLSTVLAVDFKASEIEVGIVEKDQPDFRTLSVEEIDDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>emb|CAG00121.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=246

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAIS L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTVETAISCLSTVLSIDFKPSELEVGVITTQDPKFRILTETEVDTHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_003440740.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
Length=246

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQDPKFRILAETEVDTHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_008300217.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGY++PVD+L + +AD
Sbjct  61   LDAMTVTHLFRITESIGCVMTGMTADGRSQVQRARYEAANWKYKYGYDIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVGLDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+T++TAIS L +VL  DFK SE+E+GV++ ++P F++LS  EID HL 
Sbjct  181  KKVKKKLDWTYEQTIETAISCLSTVLSIDFKPSELEVGVIKTQEPEFKILSEAEIDTHLM  240

Query  192  AISERD  175
            A+S+R+
Sbjct  241  ALSDRE  246



>ref|XP_007253022.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Astyanax 
mexicanus]
Length=246

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EAI+FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEAISFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+G++  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKHDWTFEQTIETAISCLSTVLSIDFKPSELEVGIITADDPKFRILTESEVDTHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>gb|ERE72543.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=250

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/250 (62%), Positives = 202/250 (81%), Gaps = 4/250 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETV----QTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEID  205
            KK+K    +++E+TV    QTAI+ L +VL  DFK SEIE+GVV  E+P FR+LS  EID
Sbjct  181  KKVKKKFDWTFEQTVEHSFQTAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEID  240

Query  204  EHLTAISERD  175
             HL A++ERD
Sbjct  241  AHLVALAERD  250



>ref|XP_010744453.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVLTTQDPKFRILTETEVDTHLM  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_005285405.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysemys 
picta bellii]
Length=246

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITETIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+T I+ L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKYDWTFEQTVETGITCLSTVLSIDFKPSELEVGVVTVENPKFRILTEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004542308.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
 ref|XP_005724902.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005917154.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
Length=246

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVITTQDPKFRILAETEVDTHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>gb|ACB87915.1| 20S proteasome alpha subunit A1 [Malus domestica]
Length=187

 Score =   330 bits (847),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LDQTSVTHLFP+TK++GLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            KSQ+YTQHAYMRPLGVVAM+LGIDEE GPQL+KCDPAGH+FG +     ++  EAIN   
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLGIDEELGPQLYKCDPAGHYFGQR-LQCWIERAEAINSWR  179

Query  372  KK  367
            K 
Sbjct  180  KN  181



>ref|XP_004559366.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
Length=246

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 196/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQLFKCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEELGPQLFKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+T++ AIS L +VL  DFK SE+EIGV+  ++P F++LS  EID HL 
Sbjct  181  KKVKKKLDWTYEQTIEAAISCLSTVLSIDFKPSELEIGVITAQEPKFKILSEAEIDAHLM  240

Query  192  AISERD  175
             +SER+
Sbjct  241  TLSERE  246



>ref|XP_011922517.1| PREDICTED: proteasome subunit alpha type-6 [Cercocebus atys]
Length=246

 Score =   332 bits (852),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQV TQ+A MRPLG   +++GIDE++GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVCTQNAEMRPLGCCMILIGIDEDQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>pdb|4R3O|A Chain A, Human Constitutive 20s Proteasome
 pdb|4R3O|O Chain O, Human Constitutive 20s Proteasome
 pdb|4R67|A Chain A, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|O Chain O, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|CC Chain c, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|QQ Chain q, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=244

 Score =   332 bits (852),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 200/244 (82%), Gaps = 0/244 (0%)
 Frame = -1

Query  909  SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  730
            SRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKLL
Sbjct  1    SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLL  60

Query  729  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  550
            D ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD 
Sbjct  61   DSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADI  120

Query  549  SQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEK  370
            SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLEK
Sbjct  121  SQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEK  180

Query  369  KMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTA  190
            K+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A
Sbjct  181  KVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVA  240

Query  189  ISER  178
            ++ER
Sbjct  241  LAER  244



>emb|CDQ90937.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   332 bits (852),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTESEVDVHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|NP_001132944.1| proteasome subunit alpha type-6 [Sus scrofa]
 gb|ACJ06406.1| proteasome subunit alpha type 6 [Sus scrofa]
Length=246

 Score =   332 bits (852),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+ +  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLFTVLSIDFKPSEIEVGVVTVENPKFRIFTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_002500811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62069.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   334 bits (856),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/291 (58%), Positives = 205/291 (70%), Gaps = 45/291 (15%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQV-----------------------------------  838
            MSRGSG GYDRHITIFSPEGRL+QV                                   
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPIIPSLFTPARIARLTGD  60

Query  837  -------EYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGL  679
                   EYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKLLD T +TH+F +TK +GL
Sbjct  61   PVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLDPTDITHMFKITKTIGL  120

Query  678  LATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVA  499
             ATG   D R +VQ+AR+ AAEFR  YGYE+PVD L+  +AD  QVYTQHAYMRP+  + 
Sbjct  121  CATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADWFQVYTQHAYMRPMAAMC  180

Query  498  MILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPA---FSYEETV  328
            M +GIDEE+GP L+K DPAG+F G+KATSAG KEQEAINFLEKK+K   A   F+ +ETV
Sbjct  181  MFVGIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLEKKVKGKDAGNTFTEQETV  240

Query  327  QTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            +TAI+ LQ+VL ED KA E+E+G+V  +DP+FR+LS   I++HLTAISERD
Sbjct  241  RTAIACLQTVLGEDLKARELEVGIVTVDDPNFRLLSETAIEDHLTAISERD  291



>emb|CDH55408.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=246

 Score =   332 bits (851),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V ++ P FR LS  EID+HL 
Sbjct  181  KKLKKNPTLNMEDTIELAITTLSTVLAVDFKASEIEVGIVEKDQPDFRTLSVEEIDDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>gb|ACI66289.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ADM16303.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   332 bits (851),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTESEVDIHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_001511492.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=246

 Score =   332 bits (851),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSELEVGVVTVENPKFRILTESEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_002824717.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pongo 
abelii]
Length=246

 Score =   332 bits (850),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 201/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QV+Y F+++   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVDYCFQSINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|NP_001150310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG38611.1| proteasome subunit alpha type 6 [Zea mays]
 tpg|DAA63585.1| TPA: proteasome subunit alpha type 6 [Zea mays]
Length=285

 Score =   333 bits (854),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 157/251 (63%), Positives = 196/251 (78%), Gaps = 10/251 (4%)
 Frame = -1

Query  906  RGSGG----GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKV--  745
            RG+G       DR IT+F  +GRL+QV+YA+ A K AG+TS+GVRG DSVCVV Q++   
Sbjct  14   RGAGAFRTLSEDRRITVFCSDGRLYQVDYAWNATKLAGVTSVGVRGTDSVCVVGQRRANT  73

Query  744  ---PDKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDV  574
                DKLLD TSV+ LFP+T  LGLLATGI  + R L  +ARN+ AEFRF +GYEMP DV
Sbjct  74   HAPKDKLLDMTSVSRLFPITDRLGLLATGIAGEGRALAHEARNQTAEFRFNWGYEMPPDV  133

Query  573  LARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKG-PQLFKCDPAGHFFGHKATSAGVKE  397
            LA+WIAD++Q++TQ+   RP GVVAMILGID+EKG PQLF CDPAG+FFGHKA SAG ++
Sbjct  134  LAQWIADRAQIWTQYVSKRPSGVVAMILGIDDEKGTPQLFTCDPAGYFFGHKAASAGQRD  193

Query  396  QEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLST  217
             EA+NFLEKKMKN+P+  ++ET+Q AISALQ  L+ D KASE+E+GVVR +DP+FRVL+ 
Sbjct  194  TEAVNFLEKKMKNNPSLPFQETIQMAISALQFALKADLKASEVEVGVVRTDDPTFRVLTE  253

Query  216  VEIDEHLTAIS  184
             EIDEHL AI+
Sbjct  254  AEIDEHLEAIN  264



>ref|XP_006015430.1| PREDICTED: proteasome subunit alpha type-6 [Alligator sinensis]
Length=382

 Score =   337 bits (863),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 202/246 (82%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  137  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  196

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  197  LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  256

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  257  ISQVYTQNAEMRPLGCCMILIGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  316

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL 
Sbjct  317  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLV  376

Query  192  AISERD  175
            A++ERD
Sbjct  377  ALAERD  382



>gb|ETE73021.1| Proteasome subunit alpha type-6, partial [Ophiophagus hannah]
Length=279

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  34   MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  93

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  94   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  153

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  154  ISQVYTQNAEMRPLGCCMIMIGIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  213

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TA++ L +VL  DFK SEIE+GVV  ++P FR+LS  EID HL 
Sbjct  214  KKVKKKLDWTFEQTVETAVTCLSTVLSIDFKPSEIEVGVVTVDNPKFRILSEAEIDTHLV  273

Query  192  AISERD  175
            A++ERD
Sbjct  274  ALAERD  279



>gb|ACO51961.1| Proteasome subunit alpha type-6 [Rana catesbeiana]
Length=246

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKS  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++V+HLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDNSTVSHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEETGPQVYKCDPAGYYCGFKATTAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E++V+TAIS L +VL  DFK SE+E+GVV  +DP FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQSVETAISCLSTVLSIDFKPSELEVGVVTVQDPKFRILTEAEIDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004653726.1| PREDICTED: proteasome subunit alpha type-6-like [Jaculus jaculus]
Length=246

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+Q EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQAEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+  MRPLG   +++G DEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNTEMRPLGCCMILIGTDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  ++P FR+LS  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVDNPKFRILSEAEIDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>emb|CEP12966.1| hypothetical protein [Parasitella parasitica]
Length=246

 Score =   331 bits (848),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRP GV  +++G D+E GPQL+KCDPAG++ G+KATSAG K+QE++N LE
Sbjct  121  INQVYTQQAAMRPYGVSMILIGYDDELGPQLYKCDPAGYYVGYKATSAGAKQQESLNHLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+GVV ++D  FR LS  EI++HL 
Sbjct  181  KKLKKNPELNMEDTIELAITTLSTVLAVDFKASEIEVGVVHKDDSDFRTLSIEEIEDHLQ  240

Query  192  AISERD  175
             I E+D
Sbjct  241  RIVEKD  246



>gb|KDO64978.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64979.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64980.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=210

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHK  421
            KSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHK
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHK  164



>ref|XP_005810950.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQEPKFRILTESEVDTHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|NP_001279159.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Callorhinchus 
milii]
 gb|AFM88302.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++Y++TV+TAI+ L +VL  DFK SEIEIGVV  ++P FR+ +  E D HL 
Sbjct  181  KKVKKKLDWTYDQTVETAITCLSTVLSIDFKPSEIEIGVVSVDNPKFRIFTETETDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_008396439.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQEPKFRILTESEVDAHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_008282309.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   330 bits (846),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  +D  FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQDAKFRILTETEVDVHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>emb|CDQ78135.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   330 bits (846),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K     +++ETV+TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDLTFKETVETAITCLSTVLSIDFKPSELEIGVIATEDPKFRILTESEVDTHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_007569003.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGMDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQEPKFRILTESEVDTHLM  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_005562133.1| PREDICTED: proteasome subunit alpha type-6-like [Macaca fascicularis]
Length=245

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 200/246 (81%), Gaps = 1/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTAD-RSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  119

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  120  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  179

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SE E+GVV  E+P FR+L+  EID HL 
Sbjct  180  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSETEVGVVTVENPKFRILTEAEIDAHLV  239

Query  192  AISERD  175
            A++ERD
Sbjct  240  ALAERD  245



>ref|XP_004083706.1| PREDICTED: proteasome subunit alpha type-6 [Oryzias latipes]
Length=246

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEVPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGIDEEFGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  +D  FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTTQDHKFRILTEAEVDTHLM  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_011781260.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Colobus 
angolensis palliatus]
Length=252

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 203/252 (81%), Gaps = 6/252 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGV-----VAMIL-GIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQE  391
             SQVYTQ+A MRPLG      + MIL GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E
Sbjct  121  ISQVYTQNAEMRPLGCWSFLFLGMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTE  180

Query  390  AINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVE  211
            + +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+L+  E
Sbjct  181  STSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAE  240

Query  210  IDEHLTAISERD  175
            ID HL A++ERD
Sbjct  241  IDAHLVALAERD  252



>gb|ACQ58552.1| Proteasome subunit alpha type-6 [Anoplopoma fimbria]
Length=246

 Score =   329 bits (844),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE G Q++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDEEHGAQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTIQDPKFRILTETEVDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|ACH70967.1| proteasome (prosome, macropain) subunit, alpha type 6-1 [Salmo 
salar]
 gb|ACI66033.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ACI70006.1| Proteasome subunit alpha type-6 [Salmo salar]
 emb|CDQ70650.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL 
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>ref|XP_005989234.1| PREDICTED: proteasome subunit alpha type-6 [Latimeria chalumnae]
Length=246

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF VT+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAGTVTHLFRVTENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GID+E GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILVGIDQEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SE+E+GVV  ++P FR+L   EID HL 
Sbjct  181  KKVKKKLDWTFEQTVETAITCLSTVLSIDFKPSELEVGVVTVDNPKFRILRESEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_005798367.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD T+VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDDTTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEVPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATGFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GV+  ++P F++LS  EID +L 
Sbjct  181  KKIKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVITTQEPKFKILSESEIDAYLV  240

Query  192  AISERD  175
            A+SER+
Sbjct  241  ALSERE  246



>gb|ACO08806.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   329 bits (843),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF  T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKTTENIGCVMSGMTADSKSQVQRARCEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL 
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>gb|ACH70968.1| proteasome (prosome, macropain) subunit, alpha type 6-2 [Salmo 
salar]
Length=246

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 197/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPD L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDTL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+D+E GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDDECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K     +++ETV+TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDLTFKETVETAITCLSTVLSIDFKPSELEIGVISTEDPKFRILTESEVDTHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_010741287.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 197/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T  +G + TG+TAD+++ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDALTVTHLFRITDNIGCVMTGMTADSKSQVQRARYEAANWMYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGLDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++YEET++TAIS L +VL  DFK SE+E+GVV  ++  F++LS  EID  L 
Sbjct  181  KKVKKKQDWTYEETIETAISCLSTVLAIDFKPSELEVGVVTTQESRFKILSEAEIDARLV  240

Query  192  AISERD  175
            A+SER+
Sbjct  241  ALSERE  246



>ref|XP_011850427.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mandrillus 
leucophaeus]
Length=252

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 202/252 (80%), Gaps = 6/252 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGV-----VAMIL-GIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQE  391
             SQVYTQ+A MRPLG      + MIL GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E
Sbjct  121  ISQVYTQNAEMRPLGCWSFLFLGMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTE  180

Query  390  AINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVE  211
            + +FLEKK+K    +++E+TV+TAI+ L +VL  DFK SEIE+G V  E+P FR+L+  E
Sbjct  181  STSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGAVTVENPKFRILTEAE  240

Query  210  IDEHLTAISERD  175
            ID HL A++ERD
Sbjct  241  IDAHLVALAERD  252



>ref|XP_007576015.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATGFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GV+  ++P F++LS  EID +L 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVITTQEPKFKILSESEIDAYLV  240

Query  192  AISERD  175
            A+SER+
Sbjct  241  ALSERE  246



>gb|ACI69778.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+ AD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMAADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  VSQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL 
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>ref|XP_010876973.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGQDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++ +TV+ AI+ L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL 
Sbjct  181  KKVKKKLDWTFAQTVEMAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTESEIDVHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>gb|ACO08382.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   327 bits (838),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 197/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   V TQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADNKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++ +T++TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL 
Sbjct  181  KKVKKKLDWTFAQTIETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLV  240

Query  192  AISERD  175
            ++SERD
Sbjct  241  SLSERD  246



>ref|XP_008311014.1| PREDICTED: proteasome subunit alpha type-6 [Cynoglossus semilaevis]
Length=246

 Score =   327 bits (837),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A  RPLG   +++ +DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNADKRPLGCCMIVISVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTLQEPKFRILTEAEVDTHLM  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004637142.1| PREDICTED: proteasome subunit alpha type-6 [Octodon degus]
Length=244

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 199/246 (81%), Gaps = 2/246 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA   ++Y YE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA--NWKYNYEIPVDMLCKRIAD  118

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  119  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  178

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  ++P FR+L+  EID HL 
Sbjct  179  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVDNPKFRILTEAEIDAHLV  238

Query  192  AISERD  175
            A++ERD
Sbjct  239  ALAERD  244



>ref|XP_008398058.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFKITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQL+KCDPAG++ G KAT++GVK+ EA  FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIGMDEELGPQLYKCDPAGYYCGFKATASGVKQTEATGFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GV+  ++P F++LS  EID +L 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVITTQEPKFKILSESEIDAYLV  240

Query  192  AISERD  175
            A+SER+
Sbjct  241  ALSERE  246



>ref|XP_001640650.1| predicted protein [Nematostella vectensis]
 gb|EDO48587.1| predicted protein [Nematostella vectensis]
Length=246

 Score =   327 bits (837),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 196/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RG DS  VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVGIRGADSAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VT LF +++ +G + TG+ AD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSNTVTQLFELSERIGCVMTGMVADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEEKGPQL+K DPAG+F G KA S GVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCGMILIGIDEEKGPQLYKTDPAGYFCGFKACSVGVKQTEANSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K   A+++ ETV+TAIS L SVL  DFK SE+E+GVV  ++P FR L+  EID HL 
Sbjct  181  KKVKKKHAWTFNETVETAISCLSSVLSADFKPSELEVGVVSMDNPRFRKLTEAEIDTHLV  240

Query  192  AISERD  175
            AI+ERD
Sbjct  241  AIAERD  246



>gb|ACM08640.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKP  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIGVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++++ETV+TAI+ L +VL  DFK SE+EIGV+  EDP FR+L+  E D HL 
Sbjct  181  KKVKKKLDWTFKETVETAITCLSTVLSIDFKPSELEIGVITTEDPKFRILTESEGDIHLV  240

Query  192  AISERD  175
            +++ERD
Sbjct  241  SLAERD  246



>ref|XP_007513369.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16927.1| predicted protein [Bathycoccus prasinos]
Length=247

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 193/247 (78%), Gaps = 1/247 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+GGGYDRHITIFSPEGRL+QVEYAFKA+KA GI SI V+GKD V  VTQKK PD L
Sbjct  1    MSRGAGGGYDRHITIFSPEGRLYQVEYAFKAIKAVGINSIAVKGKDCVVAVTQKKCPDVL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +DQ+++TH+F VTK LG+  TG   D R +VQ+AR +AAEFRF YGYE+PVDVLA  +AD
Sbjct  61   IDQSAMTHMFKVTKTLGMCMTGKDPDIRNVVQKARKQAAEFRFEYGYEIPVDVLANKMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
            + QVYTQHAYMRPL  + +++GIDEE+G  L+KCDP+G++ G+KA +AG KE EA+NFLE
Sbjct  121  EFQVYTQHAYMRPLATMCILMGIDEERGASLYKCDPSGYYAGYKACAAGNKEVEAVNFLE  180

Query  372  KKMKNDPAFS-YEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHL  196
            KK+K +   +  +   + AIS LQ VL ED KA E+E+ VV  + P FR+LS   I++HL
Sbjct  181  KKIKRESNVNDVDGACRLAISTLQHVLGEDVKAKELEVAVVTADAPEFRLLSEGAIEDHL  240

Query  195  TAISERD  175
            TAISERD
Sbjct  241  TAISERD  247



>gb|AFK10987.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   325 bits (834),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 197/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPD+L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDEL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVY Q+A MRPLG   +++G+DEE GPQ++KCDPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYMQNAEMRPLGCCMILVGVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++Y++TV+TAI+ L +VL  DFK SEIEIGVV  ++P FR+ +  E D HL 
Sbjct  181  KKVKKKLDWTYDQTVETAITCLSTVLPIDFKPSEIEIGVVSVDNPKFRIFTETETDVHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004333676.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11663.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
Length=242

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 196/246 (80%), Gaps = 4/246 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSR +G  YDRHITIFSPEGRL+QVEYAFKA+K   +TS+G+RG DS CV+TQKKVP+KL
Sbjct  1    MSRSAG--YDRHITIFSPEGRLYQVEYAFKAIKTENLTSLGIRGADSCCVITQKKVPEKL  58

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            +D TSVTHLF +T  +G + TG+ ADAR+ VQ+AR EAA+F  ++GY++PV  LA+ +AD
Sbjct  59   VDPTSVTHLFNITPTIGCVMTGMIADARSQVQRARKEAADFAHKFGYDIPVSYLAKRMAD  118

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +Q+YTQHAYMRPL ++  ++ IDEE+GPQL+KCDPAG + G KAT AG KEQEA NFLE
Sbjct  119  IAQIYTQHAYMRPLAMI--LISIDEEEGPQLYKCDPAGSYAGFKATGAGHKEQEARNFLE  176

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK K DP    ++T++ AI+ALQ+VL EDFKAS+IE+GVV  + P FR LS  E+D HLT
Sbjct  177  KKFKTDPKLDADKTIKMAINALQTVLGEDFKASDIEVGVVTTDSPRFRRLSDDEVDRHLT  236

Query  192  AISERD  175
             I+ERD
Sbjct  237  EIAERD  242



>ref|XP_002610620.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
 gb|EEN66630.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
Length=246

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 194/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKAV   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAVNQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTH+F +T Y+G + TG+ AD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAETVTHIFQITDYIGCVMTGMIADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G D+E GPQ++K DPAG++ G+KATS GVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGYDDEHGPQVYKTDPAGYYCGYKATSVGVKQTEANSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    F+Y E V+TAI+ L ++L  DFK +EIE+ VV +++P FRVL+  EID  L 
Sbjct  181  KKIKKKVDFTYNEAVETAITCLSTILSADFKPTEIEVAVVNKDNPKFRVLTEAEIDTQLV  240

Query  192  AISERD  175
            +I+ERD
Sbjct  241  SIAERD  246



>ref|XP_010777538.1| PREDICTED: proteasome subunit alpha type-6 [Notothenia coriiceps]
Length=246

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 199/246 (81%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAIVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T ++G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDAGTVTHLFRITDHIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRLAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GID+E GPQ++K DPAG++ G KAT+AGVK+ EA +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIGIDDEHGPQVYKNDPAGYYCGFKATAAGVKQTEATSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+T++TAIS L +VL  DFK SE+E+GVV  +DP FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTIETAISCLSTVLSIDFKPSELEVGVVTLQDPKFRILTEGEVDVHLM  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>emb|CDH55409.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=244

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 196/246 (80%), Gaps = 2/246 (1%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK  DKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKK--DKL  58

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  59   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  118

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRPLGV  +++G D+E GPQLFK DPAG++ G+KATSAG K+QE++N LE
Sbjct  119  INQVYTQQAAMRPLGVSMILIGYDDEMGPQLFKVDPAGYYVGYKATSAGAKQQESLNHLE  178

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P  + E+T++ AI+ L +VL  DFKASEIE+G+V ++ P FR LS  EID+HL 
Sbjct  179  KKLKKNPTLNMEDTIELAITTLSTVLAVDFKASEIEVGIVEKDQPDFRTLSVEEIDDHLQ  238

Query  192  AISERD  175
             I E+D
Sbjct  239  RIVEKD  244



>ref|XP_003388491.1| PREDICTED: proteasome subunit alpha type-6-like [Amphimedon queenslandica]
Length=246

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 196/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DR ITIFSPEGRL+QVEYAFKA+   G TSIGV+G +S  V+TQKKVPDKL
Sbjct  1    MSRGSSAGFDRFITIFSPEGRLYQVEYAFKAIAQTGSTSIGVKGTNSAVVITQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  S+THLF +T  +G + TG+TAD+R  V++AR+EAAEF++RYGY+MPVD + + +AD
Sbjct  61   LDPDSITHLFKITDTVGCVMTGMTADSRAQVKRARHEAAEFKYRYGYDMPVDAVCKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +Q+YTQ+A+MRP G   +++GIDEE+G QLFK DPAG++ G+KATS G K+ EA N+LE
Sbjct  121  IAQIYTQNAFMRPYGCSMILIGIDEERGIQLFKTDPAGYYCGYKATSVGAKQTEANNYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +P++ Y ETV+ A+  L  VL  D K++E+EIGVV +++P FR+L+  EIDE LT
Sbjct  181  KKIKKNPSWGYHETVEVALLTLSQVLSADLKSNEVEIGVVTEDNPEFRILTEKEIDERLT  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|EIE87129.1| hypothetical protein RO3G_11840 [Rhizopus delemar RA 99-880]
Length=269

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 201/269 (75%), Gaps = 23/269 (9%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGI-----------------------TADARTLVQQARNE  622
            LD +++TH+F +T  +G + TG+                       TADAR+ V +AR E
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIGKCNSFEHERDEIINLKLLNEPTADARSQVTRARQE  120

Query  621  AAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPA  442
            AAEFR++YGYE+P D+LA+ +A+ +QVYTQ A MRP GV  +++G D+E GPQL+KCDPA
Sbjct  121  AAEFRYKYGYEIPTDMLAKRVANINQVYTQQAAMRPYGVSMILIGHDDEFGPQLYKCDPA  180

Query  441  GHFFGHKATSAGVKEQEAINFLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEI  262
            G+F G+KAT+AG K+QEA+N LEKK+K +P  + E+T++ AI+ L SVL  DFKASEIEI
Sbjct  181  GYFVGYKATAAGAKQQEALNHLEKKLKKNPELNMEDTIELAITTLSSVLAVDFKASEIEI  240

Query  261  GVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            G+V +E+  FR LST EI++HL  I E+D
Sbjct  241  GIVTKENTDFRTLSTEEIEDHLQRIVEKD  269



>ref|XP_006065991.1| PREDICTED: proteasome subunit alpha type-6-like [Bubalus bubalis]
Length=246

 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 198/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G DRHITIFSPEGRL+QVE AFKAV   G+TS+ VRGKD   +V QKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEDAFKAVNQGGLTSVAVRGKDCAVIVAQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            L  ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA+++++YGYE+PV +L + IAD
Sbjct  61   LHSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAAKWKYKYGYEIPVHMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++G+DEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  ++P FR+L+  EID HL 
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVKNPKFRILTEAEIDAHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>ref|XP_004349345.1| proteasome subunit iota [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91465.1| proteasome subunit iota [Capsaspora owczarzaki ATCC 30864]
Length=244

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 194/240 (81%), Gaps = 0/240 (0%)
 Frame = -1

Query  894  GGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSV  715
            G +DRHI+IFSPEGRL+Q+EYAFKA+ + G+TSIG+RGKDS  V+TQKKVPDKL+D +SV
Sbjct  5    GSWDRHISIFSPEGRLYQIEYAFKAINSGGLTSIGMRGKDSCVVITQKKVPDKLMDASSV  64

Query  714  THLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYT  535
            THLF +T+ +G + TG+ ADAR  VQ+AR+EAA+F+F YGY +PVD LAR +AD SQV T
Sbjct  65   THLFQLTEEIGCVMTGMIADARAQVQRARHEAAQFKFTYGYPIPVDQLARRVADISQVST  124

Query  534  QHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKND  355
            Q A  RPLG   +++G D+E G QL+K DPAG++ G+KATSAG+K QEA N+LEKK+K +
Sbjct  125  QQAGARPLGCSMILIGYDDEYGAQLYKTDPAGYYIGYKATSAGIKSQEANNYLEKKIKKN  184

Query  354  PAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            P +SY+ETV+ AI+AL SVL  DFK SEIE+GVV +E+P FRVLS  EI+ HL  ++ERD
Sbjct  185  PEWSYQETVENAITALGSVLSLDFKPSEIEVGVVTKENPFFRVLSEREIEAHLQTLAERD  244



>ref|XP_005356606.1| PREDICTED: proteasome subunit alpha type-6-like [Microtus ochrogaster]
Length=242

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 196/246 (80%), Gaps = 4/246 (2%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKK    L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKK----L  56

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+A  EAA ++++YGYE+PVD+L + IAD
Sbjct  57   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRAHYEAANWKYKYGYEIPVDMLCKRIAD  116

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++   KAT+AGVK+ E+ +FLE
Sbjct  117  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCSFKATAAGVKQTESTSFLE  176

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL 
Sbjct  177  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLV  236

Query  192  AISERD  175
            A++ERD
Sbjct  237  ALAERD  242



>ref|XP_011314423.1| PREDICTED: proteasome subunit alpha type-6-like [Fopius arisanus]
Length=246

 Score =   317 bits (812),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 194/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGCDTAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T+Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+P+D L R IAD
Sbjct  61   LDASSVTHVFQLTEYIGCVMTGMIADSKSQVQRARYEAANFKYKYGYEIPIDTLCRRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++  D+EKGP ++K DPAG+F G++A S G ++ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMILVSYDQEKGPSIYKADPAGYFCGYRAISVGARQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K +  +S++ET+Q AI+ L +VL  DFK SEIE+GVV +  P FRVL+  EID+HLT
Sbjct  181  KKLKKNQNYSHDETIQLAITCLSTVLSVDFKPSEIEVGVVSKNQPKFRVLTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_011151114.1| PREDICTED: proteasome subunit alpha type-6-like [Harpegnathos 
saltator]
 gb|EFN76820.1| Proteasome subunit alpha type-6 [Harpegnathos saltator]
Length=246

 Score =   317 bits (811),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 194/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVDTAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T+Y+G + TG+ AD+R+ VQ+AR EAA F+++YGYE+PVD L + +AD
Sbjct  61   LDASSVTHVFHLTEYIGCVMTGMIADSRSQVQRARYEAAHFKYKYGYEIPVDALCQRVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIAYDKEKGPCIYKADPAGYFCGYRAISVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    + Y+ET+Q AI+ L +VL  DFK +EIE+GVV +++P FRVL+  EID+HLT
Sbjct  181  KKLKKKQNYDYDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFRVLTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>gb|ELU01128.1| hypothetical protein CAPTEDRAFT_167909 [Capitella teleta]
Length=246

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 197/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+R S  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKDS  V TQKKVPDKL
Sbjct  1    MARPSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDSAVVATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++V+H++P+T  +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDASTVSHVYPITDQIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCQRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRPLG + +++  DEE GPQ+++ DPAG+F G KATSAGVK+ EA ++LE
Sbjct  121  INQVYTQSAEMRPLGCIMILIAFDEENGPQVYRTDPAGYFCGCKATSAGVKQVEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK++    ++Y+ET++ AI+ L SVL  DFK SEIEIGVV ++  +F++L+  EID HLT
Sbjct  181  KKIRKKQEYNYDETIELAITCLSSVLSADFKPSEIEIGVVSRDKQNFKILTEQEIDVHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_010153544.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Eurypyga 
helias]
Length=230

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRV  226
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR+
Sbjct  181  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRI  229



>ref|XP_009019631.1| hypothetical protein HELRODRAFT_106545 [Helobdella robusta]
 gb|ESO02223.1| hypothetical protein HELRODRAFT_106545 [Helobdella robusta]
Length=247

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 191/246 (78%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKA+  AG+TS+ +RG DS  VV+QKK+PDKL
Sbjct  1    MSRGNSAGFDRHITIFSPEGRLYQVEYAFKAINQAGMTSVAIRGVDSAVVVSQKKIPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+ AD++  VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDPSTVTHLFTLTETIGCVMTGMLADSKYQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ A MRPLG   M++GIDE    Q+FK DPAG++ GHKA++AGVK  EA NFLE
Sbjct  121  ISQVYTQSAEMRPLGCTMMLIGIDEHNKSQVFKADPAGYYCGHKASAAGVKHLEASNFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++  E +  AIS LQ VL  +FKA++IEIG+V   +P FRVLS  EI+ HL+
Sbjct  181  KKIKKKVDYTLNEAIDVAISCLQHVLSAEFKATDIEIGIVTTTNPKFRVLSEAEIEAHLS  240

Query  192  AISERD  175
            AI+ERD
Sbjct  241  AIAERD  246



>ref|XP_011329096.1| PREDICTED: proteasome subunit alpha type-6-like [Cerapachys biroi]
 gb|EZA60401.1| Proteasome subunit alpha type-6 [Cerapachys biroi]
Length=246

 Score =   315 bits (806),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 193/246 (78%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVDTAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH F +T+Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+PVD L + +AD
Sbjct  61   LDASSVTHAFQLTEYIGCVMTGMIADSKSQVQRARYEAAYFKYKYGYEIPVDALCQRVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIAYDKEKGPCIYKADPAGYFCGYRAISVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    + Y+ET+Q AI+ L +VL  DFK +EIE+GVV +++P FRVL+  EID+HLT
Sbjct  181  KKLKKKQNYDYDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFRVLTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_009209663.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Papio 
anubis]
 gb|EFB18466.1| hypothetical protein PANDA_011892, partial [Ailuropoda melanoleuca]
Length=228

 Score =   314 bits (804),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  229
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  228



>gb|KFW08632.1| Proteasome subunit alpha type-6, partial [Eurypyga helias]
Length=229

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 187/228 (82%), Gaps = 0/228 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  2    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  61

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  62   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  121

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  122  ISQVYTQNAEMRPLGCCMILIGIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  181

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFR  229
            KK+K    ++YE+TV+TAI+ L +VL  DFK SEIE+GVV  E+P FR
Sbjct  182  KKVKKKFDWTYEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFR  229



>ref|XP_003216618.1| PREDICTED: proteasome subunit alpha type-6 [Anolis carolinensis]
Length=246

 Score =   314 bits (804),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 193/246 (78%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DR    F   GRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRQYYHFLSRGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE  PQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCVIMIGIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIEIGVV  ++P FR+L+  E+D HL 
Sbjct  181  KKVKKKLDWTFEQTVETAITCLSTVLSIDFKPSEIEIGVVTVDNPKFRILTEAEVDTHLV  240

Query  192  AISERD  175
            A++ERD
Sbjct  241  ALAERD  246



>gb|ACI70015.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   314 bits (804),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 188/246 (76%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+GVRG D   VVTQKKVPDKL
Sbjct  1    MSRGSNAGFDRHITIFSPEGRLYQVEYAFKAIAQGGLTSLGVRGTDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  ++T+++P+T  +G + TG  AD+R+ V +AR EAAE+++++GY++  D+L R +AD
Sbjct  61   LDSATLTNMYPLTPRIGCVMTGHNADSRSQVHRARVEAAEWKYKFGYDITADMLCRRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++ +D + GP L+KCDPAG+F G +ATS G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCCMILVAMDPQLGPMLYKCDPAGYFCGFRATSVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K  P  SYE TV+ AIS L S+L  DFK SEIE+GVV +E P FR LS  EID HL 
Sbjct  181  KKLKKRPELSYEMTVELAISCLSSILSMDFKPSEIEVGVVTKESPKFRTLSETEIDTHLV  240

Query  192  AISERD  175
            AI+ER+
Sbjct  241  AIAERE  246



>ref|XP_011635711.1| PREDICTED: proteasome subunit alpha type-6-like [Pogonomyrmex 
barbatus]
Length=246

 Score =   313 bits (803),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 194/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G ++    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVETAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T+Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+PVD L + +AD
Sbjct  61   LDASSVTHVFQLTEYIGCVMTGMIADSKSQVQRARYEAAHFKYKYGYEIPVDALCQRVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIAYDKEKGPCIYKADPAGYFCGYRAISVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    + Y+ET+Q AI+ L +VL  DFK +EIE+GVV +++P FR+L+  EID+HLT
Sbjct  181  KKLKKKQNYDYDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFRILTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>emb|CDQ77351.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 187/246 (76%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+GVRG D   VVTQKKVPDKL
Sbjct  1    MSRGSNAGFDRHITIFSPEGRLYQVEYAFKAIAQGGLTSLGVRGTDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  ++T+++P+T  +G + TG  AD+R+ V +AR EAAE+++++GY++  D+L R +AD
Sbjct  61   LDSATLTNMYPLTPRIGCVMTGHNADSRSQVHRARVEAAEWKYKFGYDITADMLCRRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   + + ID + GP L+KCDPAG+F G +ATS G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCCMIFVAIDPQLGPMLYKCDPAGYFCGFRATSVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K  P  SYE TV+ AIS L S+L  DFK SEIE+GVV +E P FR LS  EID HL 
Sbjct  181  KKLKKRPELSYEMTVELAISCLSSILSMDFKPSEIEVGVVTKESPKFRTLSETEIDTHLV  240

Query  192  AISERD  175
            AI+ER+
Sbjct  241  AIAERE  246



>ref|XP_011054784.1| PREDICTED: proteasome subunit alpha type-6-like [Acromyrmex echinatior]
 ref|XP_012057588.1| PREDICTED: proteasome subunit alpha type-6-like [Atta cephalotes]
 gb|EGI65134.1| Proteasome subunit alpha type-6 [Acromyrmex echinatior]
Length=246

 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 193/246 (78%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G ++    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVETAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+PVD L + IAD
Sbjct  61   LDASSVTHVFQLTDYIGCVMTGMIADSKSQVQRARYEAAHFKYKYGYEIPVDALCQRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIAYDKEKGPCIYKADPAGYFCGYRAISVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    + Y+ET+Q AI+ L +VL  DFK +EIE+GVV +++P FR+L+  EID+HLT
Sbjct  181  KKLKKKQNYDYDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFRILTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_005987928.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Latimeria 
chalumnae]
Length=246

 Score =   313 bits (803),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 196/246 (80%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+T++ ++G DSV VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTTVAMKGDDSVVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            L+ +++T+++ +T  +G + TG+ AD R+ VQ+AR EAAE++++YGY++PVD+L + IAD
Sbjct  61   LEPSTMTNMYRLTDKIGCVMTGMIADGRSQVQRARYEAAEWKYKYGYDIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++GID+E GPQL+KCDPAG++   KATSAGVK+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCCMMLIGIDDEFGPQLYKCDPAGYYCSFKATSAGVKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K   + S  +T + AI+ L +VL  DFK++EIE+GVV +++P FR+L   EI+ HL 
Sbjct  181  KKIKKADSLSLGKTTELAITCLSTVLSLDFKSNEIEVGVVSKDNPKFRILKEAEIETHLV  240

Query  192  AISERD  175
            AI+ERD
Sbjct  241  AIAERD  246



>ref|XP_006117859.1| PREDICTED: proteasome subunit alpha type-6, partial [Pelodiscus 
sinensis]
Length=236

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 191/236 (81%), Gaps = 0/236 (0%)
 Frame = -1

Query  882  RHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLF  703
            RHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKLLD ++VTHLF
Sbjct  1    RHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLF  60

Query  702  PVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAY  523
             +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD SQVYTQ+A 
Sbjct  61   RITETIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIADISQVYTQNAE  120

Query  522  MRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPAFS  343
            MRPLG   +  G+DEE GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLEKK+K    ++
Sbjct  121  MRPLGCCMIRQGVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKYDWT  180

Query  342  YEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  175
            +E+TV+TAI+ L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  181  FEQTVETAITCLSTVLSIDFKPSELEVGVVTVENPKFRILTEAEIDTHLVALAERD  236



>emb|CDQ88726.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   313 bits (802),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 188/246 (76%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+GVRG D   VVTQKKVPDKL
Sbjct  1    MSRGSNAGFDRHITIFSPEGRLYQVEYAFKAIAQGGLTSLGVRGTDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  ++T+++P+T  +G + TG  AD+R+ V +AR EAAE+++++GY++  D+L R +AD
Sbjct  61   LDSATLTNMYPLTPRIGCVMTGHNADSRSQVHRARVEAAEWKYKFGYDITADMLCRRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++ +D + GP L+KCDPAG+F G +ATS G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCCMILVAMDPQLGPMLYKCDPAGYFCGFRATSVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K  P  SYE TV+ AIS L S+L  DFK SEIE+GVV +E P FR LS  EID HL 
Sbjct  181  KKLKKRPELSYEITVELAISCLSSILSMDFKPSEIEVGVVTKESPKFRTLSETEIDTHLV  240

Query  192  AISERD  175
            AI+ER+
Sbjct  241  AIAERE  246



>ref|XP_008543695.1| PREDICTED: proteasome subunit alpha type-6-like [Microplitis 
demolitor]
Length=246

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 139/246 (57%), Positives = 194/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQ+KVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVDTAVFATQRKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T+++G + TG+ AD+++ VQ+AR EAA F++++GYE+PVD L R +AD
Sbjct  61   LDASSVTHIFQLTEHIGCVMTGMIADSKSQVQRARYEAANFKYKFGYEIPVDTLCRRVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
              QVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S G ++ EA ++LE
Sbjct  121  IGQVYTQNAEMRPLGCSMMLIAYDKEKGPSIYKADPAGYFCGYRAISVGARQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    ++Y+ET+Q AI+ L +VL  DFK SEIE+GVV +++P FRVL+  EID+HLT
Sbjct  181  KKLKKKQNYNYDETIQLAITCLSTVLSVDFKPSEIEVGVVSKDNPKFRVLTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_003706429.1| PREDICTED: proteasome subunit alpha type-6-like [Megachile rotundata]
Length=246

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 193/246 (78%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+  +G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQSGLTSVAVKGVDTAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T+++G L TG+ AD R+ VQ+AR EAA F+++Y YE+PVDVL R IAD
Sbjct  61   LDASSVTHIFQLTEHIGCLMTGMIADGRSQVQRARYEAANFKYKYEYEIPVDVLCRRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG++ G++A S G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMMLISYDKEKGPCVYKADPAGYYCGYRAISVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    + ++ET+Q AI+ L +VL  DFK +EIE+GVV +++P FR L+  EID+HLT
Sbjct  181  KKLKKKQNYDHDETIQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFRTLTEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>gb|ACM09335.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 187/246 (76%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+GVRG D   VVTQKKVPDKL
Sbjct  1    MSRGSNAGFDRHITIFSPEGRLYQVEYAFKAIAQGGLTSLGVRGTDCAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  ++T+++P+T  +G + TG  AD+R+ V +AR EAAE+++++GY++  D+L R +AD
Sbjct  61   LDSATLTNMYPLTPRIGCVMTGHNADSRSQVHRARVEAAEWKYKFGYDITADMLCRRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   + + ID + GP L+KCDPAG+F G +ATS G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCCMIFVAIDPQLGPVLYKCDPAGYFCGFRATSVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K  P  SYE TV+ AIS L S+L  DFK SEIE+GVV +E P FR LS  EID HL 
Sbjct  181  KKLKKRPELSYEMTVELAISCLSSILSMDFKPSEIEVGVVTKESPKFRTLSETEIDTHLV  240

Query  192  AISERD  175
            AI+ER+
Sbjct  241  AIAERE  246



>ref|XP_009063626.1| hypothetical protein LOTGIDRAFT_229407 [Lottia gigantea]
 gb|ESO85377.1| hypothetical protein LOTGIDRAFT_229407 [Lottia gigantea]
Length=246

 Score =   312 bits (800),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 195/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DR+IT+FSPEGRL+QVEYAFKAV   G+TS+ VRGKDS  VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRYITVFSPEGRLYQVEYAFKAVNQGGLTSVAVRGKDSAVVVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD  +VTHLF +T+ +G + TG+ AD+++ VQ+AR EAA++++ YGYE+PVD+L + +AD
Sbjct  61   LDADTVTHLFQLTEKIGCVMTGMIADSKSQVQRARYEAAKWKYSYGYEIPVDMLVKRMAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             +QVYTQ A MRPLG   +++G D+E GP +F+ DPAG+++G KATSAGVK+ EA +FLE
Sbjct  121  INQVYTQSAEMRPLGCCMILIGYDDELGPLVFRTDPAGYYYGFKATSAGVKQLEANSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K     S+ +TV+TAI+ L +VL  DFKA+EIE+GVV ++   F+VLS  EID HL 
Sbjct  181  KKIKKKQELSFNDTVETAITCLSTVLSADFKAAEIEVGVVSKDHSRFKVLSEEEIDAHLL  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_011866991.1| PREDICTED: proteasome subunit alpha type-6-like [Vollenhovia 
emeryi]
Length=246

 Score =   312 bits (799),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 194/246 (79%), Gaps = 0/246 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G ++    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVETAVFATQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD +SVTH+F +T+Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+PVD L + +AD
Sbjct  61   LDASSVTHVFQLTEYIGCVMTGMIADSKSQVQRARYEAAHFKYKYGYEIPVDALCQRVAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   M++  D+EKGP ++K DPAG+F G++A S G K+ EA ++LE
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIAYDKEKGPCIYKADPAGYFCGYRAISVGAKQTEANSYLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLT  193
            KK+K    + ++ETVQ AI+ L +VL  DFK +EIE+GVV +++P FR+L+  EID+HLT
Sbjct  181  KKLKKKQNYDFDETVQLAITCLSTVLSVDFKPTEIEVGVVSKDNPKFRILNEQEIDKHLT  240

Query  192  AISERD  175
            AI+E+D
Sbjct  241  AIAEKD  246



>ref|XP_005656349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Sus scrofa]
Length=230

 Score =   311 bits (798),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -1

Query  912  MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  733
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  732  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  553
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  552  KSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLE  373
             SQVYTQ+A MRPLG   +++GIDEE+GPQ++KCDPAG++ G KAT+AGVK+ E+ +FLE
Sbjct  121  ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE  180

Query  372  KKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEIGVVRQEDPSFRV  226
            KK+K    +++E+TV+TAI+ L +VL  DFK SEIE+GVV  E+P F +
Sbjct  181  KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFSL  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2380164130925