BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8596

Length=1112
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599412.1|  PREDICTED: NAC domain-containing protein 78-...    189   6e-65   Nicotiana tomentosiformis
ref|XP_009764398.1|  PREDICTED: NAC domain-containing protein 78-...    190   2e-59   Nicotiana sylvestris
ref|XP_009625486.1|  PREDICTED: NAC domain-containing protein 78-...    187   3e-59   Nicotiana tomentosiformis
ref|XP_009771992.1|  PREDICTED: NAC domain-containing protein 78-...    172   5e-59   Nicotiana sylvestris
ref|XP_004250028.1|  PREDICTED: NAC domain-containing protein 78        165   7e-59   Solanum lycopersicum
ref|XP_009771991.1|  PREDICTED: NAC domain-containing protein 78-...    171   8e-59   Nicotiana sylvestris
ref|XP_004239710.1|  PREDICTED: NAC domain-containing protein 78-...    166   1e-57   Solanum lycopersicum
ref|XP_006345843.1|  PREDICTED: NAC domain-containing protein 78-...    163   4e-57   Solanum tuberosum [potatoes]
ref|XP_006361710.1|  PREDICTED: NAC domain-containing protein 78-...    157   8e-57   Solanum tuberosum [potatoes]
ref|XP_006361711.1|  PREDICTED: NAC domain-containing protein 78-...    157   8e-57   
emb|CDO99814.1|  unnamed protein product                                144   4e-52   Coffea canephora [robusta coffee]
gb|EYU39671.1|  hypothetical protein MIMGU_mgv1a003896mg                160   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_011076897.1|  PREDICTED: NAC domain-containing protein 78-...    153   1e-48   Sesamum indicum [beniseed]
ref|XP_012090539.1|  PREDICTED: NAC domain-containing protein 78        150   1e-46   
ref|XP_006436536.1|  hypothetical protein CICLE_v10031147mg             146   3e-46   Citrus clementina [clementine]
ref|XP_002265345.2|  PREDICTED: NAC domain-containing protein 78        136   8e-46   Vitis vinifera
ref|XP_011101544.1|  PREDICTED: NAC domain-containing protein 78-...    147   2e-45   Sesamum indicum [beniseed]
ref|XP_011101543.1|  PREDICTED: NAC domain-containing protein 78-...    146   2e-45   Sesamum indicum [beniseed]
ref|XP_006436534.1|  hypothetical protein CICLE_v10031147mg             142   2e-45   
ref|XP_007218872.1|  hypothetical protein PRUPE_ppa003239mg             147   3e-45   Prunus persica
ref|XP_011101545.1|  PREDICTED: NAC domain-containing protein 78-...    146   3e-45   Sesamum indicum [beniseed]
ref|XP_006436535.1|  hypothetical protein CICLE_v10031147mg             142   4e-45   Citrus clementina [clementine]
ref|XP_007010050.1|  NAC domain protein, IPR003441, putative isof...    159   4e-45   
ref|XP_008232319.1|  PREDICTED: NAC domain-containing protein 78 ...    147   1e-44   Prunus mume [ume]
ref|XP_010090439.1|  NAC domain-containing protein 78                   159   4e-44   
ref|XP_008232318.1|  PREDICTED: NAC domain-containing protein 78 ...    144   6e-44   Prunus mume [ume]
ref|XP_011031618.1|  PREDICTED: NAC domain-containing protein 78-...    148   3e-42   Populus euphratica
ref|XP_011031619.1|  PREDICTED: NAC domain-containing protein 78-...    148   3e-42   Populus euphratica
gb|KDO47584.1|  hypothetical protein CISIN_1g007598mg                   132   4e-42   Citrus sinensis [apfelsine]
ref|XP_009346651.1|  PREDICTED: NAC domain-containing protein 78-...    135   2e-41   Pyrus x bretschneideri [bai li]
gb|KDO47583.1|  hypothetical protein CISIN_1g007598mg                   129   3e-41   Citrus sinensis [apfelsine]
gb|ADL36811.1|  NAC domain class transcription factor                   135   3e-41   Malus domestica [apple tree]
gb|KDO47590.1|  hypothetical protein CISIN_1g007598mg                   129   4e-41   Citrus sinensis [apfelsine]
gb|KDO47587.1|  hypothetical protein CISIN_1g007598mg                   129   4e-41   Citrus sinensis [apfelsine]
gb|KDO47589.1|  hypothetical protein CISIN_1g007598mg                   128   4e-41   Citrus sinensis [apfelsine]
gb|KDO47585.1|  hypothetical protein CISIN_1g007598mg                   129   5e-41   Citrus sinensis [apfelsine]
gb|KDO47586.1|  hypothetical protein CISIN_1g007598mg                   129   5e-41   Citrus sinensis [apfelsine]
emb|CAN70406.1|  hypothetical protein VITISV_021988                     120   5e-41   Vitis vinifera
ref|XP_009346650.1|  PREDICTED: NAC domain-containing protein 78-...    133   9e-41   Pyrus x bretschneideri [bai li]
ref|XP_009346652.1|  PREDICTED: NAC domain-containing protein 78-...    133   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_008345397.1|  PREDICTED: NAC domain-containing protein 78-...    130   9e-40   
ref|XP_009361439.1|  PREDICTED: NAC domain-containing protein 78-...    123   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_006378789.1|  NAC domain-containing protein 78                   145   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002315338.2|  hypothetical protein POPTR_0010s23650g             142   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011024334.1|  PREDICTED: NAC domain-containing protein 78-...    148   6e-38   Populus euphratica
ref|XP_008339779.1|  PREDICTED: NAC domain-containing protein 78-...    121   8e-38   
ref|XP_008339778.1|  PREDICTED: NAC domain-containing protein 78-...    121   8e-38   
ref|XP_011024333.1|  PREDICTED: NAC domain-containing protein 78-...    145   5e-37   Populus euphratica
ref|XP_006379522.1|  hypothetical protein POPTR_0008s03170g             135   6e-37   
ref|XP_002311983.2|  NAC domain-containing protein 78                   131   8e-36   
gb|AIA57516.1|  NAC domain-containing protein                           144   2e-35   Boehmeria nivea [Chinese silk-plant]
ref|XP_011469276.1|  PREDICTED: NAC domain-containing protein 78 ...    122   7e-35   Fragaria vesca subsp. vesca
ref|XP_011469274.1|  PREDICTED: NAC domain-containing protein 78 ...    119   5e-34   Fragaria vesca subsp. vesca
gb|KJB60503.1|  hypothetical protein B456_009G309000                    128   1e-33   Gossypium raimondii
gb|AGC27316.1|  NAC domain protein 13                                   124   2e-33   Gossypium hirsutum [American cotton]
ref|XP_009346099.1|  PREDICTED: NAC domain-containing protein 78-...    134   6e-33   Pyrus x bretschneideri [bai li]
ref|XP_010552948.1|  PREDICTED: NAC domain-containing protein 78-...    127   5e-31   Tarenaya hassleriana [spider flower]
gb|AAM34772.1|AF509872_1  nam-like protein 9                          95.1    6e-31   Petunia x hybrida [garden petunia]
ref|XP_010543581.1|  PREDICTED: NAC domain-containing protein 78-...    132   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_010032131.1|  PREDICTED: NAC domain-containing protein 78        127   4e-29   Eucalyptus grandis [rose gum]
ref|XP_011655859.1|  PREDICTED: NAC domain-containing protein 78        110   7e-29   Cucumis sativus [cucumbers]
dbj|BAJ34165.1|  unnamed protein product                                124   8e-29   Eutrema halophilum
ref|XP_006398899.1|  hypothetical protein EUTSA_v10013110mg             124   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_008446811.1|  PREDICTED: NAC domain-containing protein 78-...    108   1e-28   Cucumis melo [Oriental melon]
ref|XP_006297351.1|  hypothetical protein CARUB_v10013370mg             125   1e-28   Capsella rubella
ref|XP_006407560.1|  hypothetical protein EUTSA_v10020438mg             125   3e-28   Eutrema salsugineum [saltwater cress]
gb|EYU32441.1|  hypothetical protein MIMGU_mgv1a002437mg              99.8    3e-28   Erythranthe guttata [common monkey flower]
gb|KFK38438.1|  hypothetical protein AALP_AA3G113300                    120   7e-27   Arabis alpina [alpine rockcress]
ref|XP_010486664.1|  PREDICTED: NAC domain-containing protein 78        118   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002532627.1|  conserved hypothetical protein                     116   2e-25   
ref|XP_010423584.1|  PREDICTED: NAC domain-containing protein 78 ...    111   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010464726.1|  PREDICTED: NAC domain-containing protein 78-...    117   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004307017.1|  PREDICTED: NAC domain-containing protein 78 ...    117   3e-25   Fragaria vesca subsp. vesca
ref|XP_010423582.1|  PREDICTED: NAC domain-containing protein 78 ...    110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010423583.1|  PREDICTED: NAC domain-containing protein 78 ...    110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010452336.1|  PREDICTED: NAC domain-containing protein 78-...    110   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010452337.1|  PREDICTED: NAC domain-containing protein 78-...    110   4e-25   Camelina sativa [gold-of-pleasure]
gb|AGV29480.1|  putative NAC domain class transcription factor          114   5e-25   Tamarix hispida
ref|XP_011469277.1|  PREDICTED: NAC domain-containing protein 78 ...    116   5e-25   Fragaria vesca subsp. vesca
ref|XP_010694513.1|  PREDICTED: NAC domain-containing protein 78        115   5e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010485001.1|  PREDICTED: NAC domain-containing protein 78-...    114   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004496134.1|  PREDICTED: NAC domain-containing protein 78-...    113   6e-24   Cicer arietinum [garbanzo]
ref|XP_004496133.1|  PREDICTED: NAC domain-containing protein 78-...    113   6e-24   Cicer arietinum [garbanzo]
ref|NP_196061.1|  NAC family transcriptional activator                  104   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65338.1|  NAC, putative                                           111   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566376.1|  NAC domain containing protein 53                      111   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51388.1|AC011560_20  unknown protein; 75639-73470                 106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490948.1|  PREDICTED: NAC domain-containing protein 78-...    104   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010490950.1|  PREDICTED: NAC domain-containing protein 78-...    104   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_008456549.1|  PREDICTED: NAC domain-containing protein 78-...    109   8e-23   
ref|XP_008456548.1|  PREDICTED: NAC domain-containing protein 78-...    109   9e-23   
ref|XP_002871092.1|  hypothetical protein ARALYDRAFT_908325             101   2e-22   Arabidopsis lyrata subsp. lyrata
gb|KFK24891.1|  hypothetical protein AALP_AA8G038000                    107   2e-22   Arabis alpina [alpine rockcress]
ref|XP_006286823.1|  hypothetical protein CARUB_v10003768mg           99.4    6e-22   
ref|XP_010243195.1|  PREDICTED: NAC domain-containing protein 78-...    104   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010243196.1|  PREDICTED: NAC domain-containing protein 78-...    104   4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002882677.1|  ANAC053                                          99.0    7e-21   
ref|XP_010267268.1|  PREDICTED: NAC domain-containing protein 78-...    103   7e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004150380.1|  PREDICTED: NAC domain-containing protein 78-...    102   2e-20   Cucumis sativus [cucumbers]
ref|XP_011649428.1|  PREDICTED: NAC domain-containing protein 78-...    102   2e-20   Cucumis sativus [cucumbers]
gb|AAF09254.1|AF201456_1  NAC2                                        93.6    4e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KEH17171.1|  NAC transcription factor-like protein                 99.4    2e-19   Medicago truncatula
ref|XP_007144249.1|  hypothetical protein PHAVU_007G140500g           92.8    6e-19   Phaseolus vulgaris [French bean]
gb|KEH43320.1|  NAC transcription factor-like protein                 97.1    9e-19   Medicago truncatula
gb|KEH43318.1|  NAC transcription factor-like protein                 97.1    1e-18   Medicago truncatula
gb|KEH43319.1|  NAC transcription factor-like protein                 96.7    2e-18   Medicago truncatula
gb|KEH43321.1|  NAC transcription factor-like protein                 96.7    2e-18   Medicago truncatula
gb|KEH43317.1|  NAC transcription factor-like protein                 96.7    2e-18   Medicago truncatula
gb|EPS65703.1|  nam-like protein 9                                    86.7    3e-18   Genlisea aurea
ref|XP_009125558.1|  PREDICTED: NAC domain-containing protein 78-...  95.5    3e-18   Brassica rapa
gb|AAN46239.1|  unknown protein                                       87.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46238.1|  unknown protein                                       86.3    5e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AGV29486.1|  putative NAC domain class transcription factor        90.1    7e-18   Tamarix hispida
ref|XP_010485171.1|  PREDICTED: NAC domain-containing protein 78-...  87.4    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDY44853.1|  BnaC09g50530D                                        87.0    2e-17   Brassica napus [oilseed rape]
ref|XP_009125559.1|  PREDICTED: NAC domain-containing protein 78-...  93.2    2e-17   Brassica rapa
emb|CDY58437.1|  BnaC03g71220D                                        91.7    2e-17   Brassica napus [oilseed rape]
gb|AAN46250.1|  unknown protein                                       82.8    5e-17   Arabidopsis lyrata [lyrate rockcress]
gb|KHN00951.1|  NAC domain-containing protein 78                      91.3    8e-17   Glycine soja [wild soybean]
ref|XP_003556302.1|  PREDICTED: NAC domain-containing protein 78-...  91.7    8e-17   Glycine max [soybeans]
gb|AHA84185.1|  NAC domain-containing protein 78                      90.9    1e-16   Phaseolus vulgaris [French bean]
emb|CDX70227.1|  BnaA10g25760D                                        89.0    7e-16   
emb|CDY14157.1|  BnaC02g02740D                                        88.2    1e-15   Brassica napus [oilseed rape]
ref|XP_009130822.1|  PREDICTED: NAC domain-containing protein 78-...  85.1    1e-15   Brassica rapa
emb|CDY41354.1|  BnaA01g31650D                                        87.4    1e-15   Brassica napus [oilseed rape]
ref|XP_009122601.1|  PREDICTED: NAC domain-containing protein 78-...  87.8    1e-15   Brassica rapa
ref|XP_009130821.1|  PREDICTED: NAC domain-containing protein 78-...  84.7    2e-15   Brassica rapa
emb|CDY11289.1|  BnaA03g01250D                                        83.6    3e-15   Brassica napus [oilseed rape]
ref|XP_009122853.1|  PREDICTED: NAC domain-containing protein 78      82.8    4e-14   Brassica rapa
gb|AAN46247.1|  unknown protein                                       82.0    6e-14   Arabidopsis lyrata [lyrate rockcress]
emb|CDY61762.1|  BnaAnng17650D                                        82.0    1e-13   Brassica napus [oilseed rape]
gb|AAN46251.1|  unknown protein                                       79.7    4e-13   Arabidopsis lyrata [lyrate rockcress]
gb|KDO47588.1|  hypothetical protein CISIN_1g007598mg                 68.2    1e-12   Citrus sinensis [apfelsine]
ref|XP_006648145.1|  PREDICTED: NAC domain-containing protein 78-...  71.6    4e-10   Oryza brachyantha
ref|XP_010940544.1|  PREDICTED: uncharacterized protein LOC105059077  70.1    1e-09   Elaeis guineensis
gb|AAO72552.1|  NAC-like protein                                      69.7    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88066.1|  hypothetical protein OsI_09496                        69.3    2e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001048559.1|  Os02g0822400                                     69.3    2e-09   
ref|XP_003570443.1|  PREDICTED: NAC domain-containing protein 78      68.9    3e-09   Brachypodium distachyon [annual false brome]
ref|XP_008779162.1|  PREDICTED: uncharacterized protein LOC103698888  68.6    4e-09   Phoenix dactylifera
ref|XP_002453065.1|  hypothetical protein SORBIDRAFT_04g037720        68.2    5e-09   Sorghum bicolor [broomcorn]
ref|XP_008787444.1|  PREDICTED: NAC domain-containing protein 78      68.2    5e-09   Phoenix dactylifera
gb|ACF82881.1|  unknown                                               62.8    8e-08   Zea mays [maize]
ref|XP_009418258.1|  PREDICTED: uncharacterized protein LOC103998499  64.3    9e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004954444.1|  PREDICTED: NAC domain-containing protein 78-...  63.2    2e-07   Setaria italica
gb|EMS63008.1|  NAC domain-containing protein 78                      62.8    2e-07   Triticum urartu
ref|XP_010935812.1|  PREDICTED: NAC domain-containing protein 78-...  62.8    2e-07   Elaeis guineensis
ref|XP_010935813.1|  PREDICTED: NAC domain-containing protein 78-...  62.8    3e-07   Elaeis guineensis
gb|EMT07836.1|  hypothetical protein F775_28266                       62.4    3e-07   
gb|ACN34478.1|  unknown                                               62.0    5e-07   Zea mays [maize]
dbj|BAJ97673.1|  predicted protein                                    61.6    7e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008677410.1|  PREDICTED: NAC domain-containing protein 78 ...  61.2    7e-07   Zea mays [maize]
gb|ACN28830.1|  unknown                                               61.6    7e-07   Zea mays [maize]
ref|NP_001152531.1|  NAC domain-containing protein 78                 61.2    7e-07   
ref|XP_009418629.1|  PREDICTED: NAC domain-containing protein 78 ...  55.8    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418630.1|  PREDICTED: NAC domain-containing protein 78 ...  55.5    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383926.1|  PREDICTED: NAC domain-containing protein 78-...  55.5    6e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383919.1|  PREDICTED: NAC domain-containing protein 78-...  55.5    6e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007010051.1|  NAC domain containing protein 2, putative is...  52.4    1e-04   



>ref|XP_009599412.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=541

 Score =   189 bits (481),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 139/206 (67%), Gaps = 17/206 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA DDFQ+M FD  +  GND+ + +Q+  A+K+  + T+Q + PNE     E+KND A
Sbjct  338  FFDANDDFQNMGFDPSVLFGNDDQISDQALPAEKNIGEVTQQFIAPNEGL--GEYKNDFA  395

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EPTK GSD Q+PF+K+AS+MLGNI APPAFASE P KDA LRLN+ +Q SSSV V
Sbjct  396  SSSKLEPTKFGSDHQYPFMKRASKMLGNIHAPPAFASEFPTKDATLRLNSLSQTSSSVQV  455

Query  490  TAGLIQISDLTLGS--------KHGNYNIILSFDFSQGA-----QSPGSLEPVSHGKMLS  350
            TAG  QI D+T+GS        KH +YNI LSF  S+G+     +S  S+ P     ++S
Sbjct  456  TAGF-QIRDMTVGSNGTGWPLGKHADYNIFLSFGISRGSDESAVESFYSIHPGKTTSIIS  514

Query  349  GGWFYFLLFWVLILSISVKVGTFIYA  272
             GWFY+L F  L+L +S K+GT I A
Sbjct  515  RGWFYYLFFSFLMLCMSFKIGTIICA  540


 Score = 87.0 bits (214),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDELKP D  +  + D  PV  EY+GESS ++ SE ++ LLNEP ++ TD  QF +  
Sbjct  252   QQPDELKPIDLAVQQNVDVDPVMHEYIGESSKNVNSEDVDYLLNEPTVNATDDLQFKEEA  311

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNP+E ++SGFDM +
Sbjct  312   FLEANDLSNPIEVDSSGFDMLE  333



>ref|XP_009764398.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=542

 Score =   190 bits (482),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 141/207 (68%), Gaps = 17/207 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA DDFQ+M F+  +  G D+ + + +  ADK+     EQ V P+E+  D   K ++A
Sbjct  337  FFDADDDFQNMGFNPPMMTGGDDHVSDLASLADKNIGKVAEQPVAPSEEPAD--QKTNVA  394

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EP+K GSD+++PF+KQAS MLG IPAPPAFASE P KDAA R+N++++ASSS+HV
Sbjct  395  SSSKLEPSKFGSDYKYPFMKQASCMLGGIPAPPAFASEFPSKDAAFRMNSSSEASSSIHV  454

Query  490  TAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH---GKMLSGG  344
            TAG IQI ++T+G         KHGNYNI+LSF  SQ A S  SLE V     GK +S  
Sbjct  455  TAGYIQIRNMTMGGNGTDGLVGKHGNYNILLSFGLSQHADSSASLESVVSILPGKTISAA  514

Query  343  ---WFYFLLFWVLILSISVKVGTFIYA  272
               WFY+L  WVLILS+S K+GT I A
Sbjct  515  SWCWFYYLFSWVLILSMSFKIGTLIRA  541


 Score = 68.6 bits (166),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -1

Query  1100  QHPDELKPFDQPIHD-FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDE + FD  I +  +  PVK E+M E S ++ SE ++ LLNEP+   TD  Q NDG 
Sbjct  253   QPPDEQESFDPAIEENANANPVKHEFMSEPSKNVNSEDVDYLLNEPIETATDTLQSNDGA  312

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE +DLS P++  TS FDM +
Sbjct  313   FLEASDLSRPID--TSSFDMLE  332



>ref|XP_009625486.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=542

 Score =   187 bits (476),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 143/207 (69%), Gaps = 17/207 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA DDFQ+M F+  + IG D+ + + +  ADK+  +  +Q + P+E+  D   K ++A
Sbjct  337  FFDADDDFQNMGFNPPMMIGGDDHVSDLASLADKNIGEVADQPIAPSEEPTD--QKTNVA  394

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EP+K GSD+++PF+KQAS MLG IPAPPAFASE P KDAA R+N++++ASSS+HV
Sbjct  395  SSSKLEPSKFGSDYKYPFMKQASCMLGGIPAPPAFASEFPSKDAAFRMNSSSEASSSIHV  454

Query  490  TAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH---GKMLSGG  344
            TAG IQI ++T+          KHGNYNI+LSF  SQ A S  SLE V     GK +S  
Sbjct  455  TAGYIQIRNITMSGNGTDGLVGKHGNYNILLSFGLSQHADSSASLESVISILPGKTISTA  514

Query  343  ---WFYFLLFWVLILSISVKVGTFIYA  272
               WFY+LL W+LILS+S K+GT I A
Sbjct  515  SWCWFYYLLSWILILSMSFKIGTLIRA  541


 Score = 70.1 bits (170),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = -1

Query  1100  QHPDELKPFDQPIHD-FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDE + FD  I +     PVK E+M E S ++ SE ++ L NEP+   TD  QFNDG 
Sbjct  253   QPPDEQESFDPAIEENASANPVKHEFMSEPSKNVNSEDVDYLFNEPIETATDTLQFNDGA  312

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE +DLS P+  +TS FDM +
Sbjct  313   FLEASDLSRPI--DTSSFDMLE  332



>ref|XP_009771992.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score =   172 bits (435),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 17/206 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA DDFQ M FD  +  GND+ + +Q+  A+K+  + T+Q + PNE     E+KND A
Sbjct  304  FFDANDDFQHMGFDPSVLFGNDDQISDQALLAEKNIGEVTQQFIAPNEGL--GENKNDFA  361

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EPTK GSD Q+PF+K+ASQMLGNI APPAFASE P KDA LRLN+ +Q+SSSV V
Sbjct  362  SSSKLEPTKFGSDRQYPFMKKASQMLGNIHAPPAFASEFPTKDATLRLNSLSQSSSSVQV  421

Query  490  TAGLIQISDLTLGS--------KHGNYNIILSFDFSQGA-----QSPGSLEPVSHGKMLS  350
            TAG  QI D T+GS        K+ +YNIILSF  S+ +     +S  S+ P     ++S
Sbjct  422  TAGF-QIRDTTVGSNGTGWPLGKYADYNIILSFGISRRSDDSAMESFYSIHPGKTTSIIS  480

Query  349  GGWFYFLLFWVLILSISVKVGTFIYA  272
             GWFY+L F  L+L +S K+GT I A
Sbjct  481  RGWFYYLFFSFLMLCMSFKIGTIICA  506


 Score = 85.1 bits (209),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDELKP D  +  + D  PV  EY+GESS ++ SE ++ LL+EP ++ TD  QF +  
Sbjct  218   QQPDELKPIDLAVQQNVDVDPVMHEYIGESSKNVNSEDVDYLLHEPTVNATDDLQFKEEA  277

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNP+E ++SGFDM +
Sbjct  278   FLEANDLSNPIEVDSSGFDMLE  299



>ref|XP_004250028.1| PREDICTED: NAC domain-containing protein 78 [Solanum lycopersicum]
Length=528

 Score =   165 bits (418),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 128/199 (64%), Gaps = 12/199 (6%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            ++DA DDFQ+M FD  +F GND+ + +Q+    KD  + T+Q + PNE    +E KN IA
Sbjct  334  YFDANDDFQNMSFDPSVFFGNDDQISDQALLPQKDVGEVTQQPIAPNEGF--SEDKNGIA  391

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK  PTK  SD+Q+PFIKQASQMLGNI APPAFASE P KDA LRLN+ ++++SSV V
Sbjct  392  SSSKLVPTKFESDYQYPFIKQASQMLGNIHAPPAFASEFPTKDAILRLNSFSRSASSVQV  451

Query  490  TAGLIQISDLTLGSKHGNYNIILSFDFSQGAQSPG------SLEPVSHGKMLSGGWFYFL  329
            TAG    +   LG KH  YNIILS   S+G+           + P      +S GWF +L
Sbjct  452  TAG--NGTRWPLG-KHVYYNIILSLGLSRGSSDDSSMDSFHKIHPGKTTSTISRGWFCYL  508

Query  328  LFWVLILSISVKVGTFIYA  272
             F  L+L +S+++GT I A
Sbjct  509  FFSFLMLLMSLRIGTIICA  527


 Score = 90.9 bits (224),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDELKP D  +  +F+ + V  EY+GESS +M SE  + LLNEP+++ TD  QFND  
Sbjct  248   QQPDELKPIDLAVQKNFNAEQVNHEYIGESSKNMNSEDGDYLLNEPIVNGTDDLQFNDEA  307

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPV+ ++SGFDM +
Sbjct  308   FLEANDLSNPVQADSSGFDMLE  329



>ref|XP_009771991.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   171 bits (433),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 17/206 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA DDFQ M FD  +  GND+ + +Q+  A+K+  + T+Q + PNE     E+KND A
Sbjct  338  FFDANDDFQHMGFDPSVLFGNDDQISDQALLAEKNIGEVTQQFIAPNEGL--GENKNDFA  395

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EPTK GSD Q+PF+K+ASQMLGNI APPAFASE P KDA LRLN+ +Q+SSSV V
Sbjct  396  SSSKLEPTKFGSDRQYPFMKKASQMLGNIHAPPAFASEFPTKDATLRLNSLSQSSSSVQV  455

Query  490  TAGLIQISDLTLGS--------KHGNYNIILSFDFSQGA-----QSPGSLEPVSHGKMLS  350
            TAG  QI D T+GS        K+ +YNIILSF  S+ +     +S  S+ P     ++S
Sbjct  456  TAGF-QIRDTTVGSNGTGWPLGKYADYNIILSFGISRRSDDSAMESFYSIHPGKTTSIIS  514

Query  349  GGWFYFLLFWVLILSISVKVGTFIYA  272
             GWFY+L F  L+L +S K+GT I A
Sbjct  515  RGWFYYLFFSFLMLCMSFKIGTIICA  540


 Score = 85.1 bits (209),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDELKP D  +  + D  PV  EY+GESS ++ SE ++ LL+EP ++ TD  QF +  
Sbjct  252   QQPDELKPIDLAVQQNVDVDPVMHEYIGESSKNVNSEDVDYLLHEPTVNATDDLQFKEEA  311

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNP+E ++SGFDM +
Sbjct  312   FLEANDLSNPIEVDSSGFDMLE  333



>ref|XP_004239710.1| PREDICTED: NAC domain-containing protein 78-like [Solanum lycopersicum]
Length=544

 Score =   166 bits (421),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 136/207 (66%), Gaps = 18/207 (9%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA D+FQ M F+  +  G+D+ + + +   +K+  +  +Q + P+E+  D   K ++A
Sbjct  340  FFDADDNFQSMGFNPPMMTGDDDHVSDLASVEEKNIAEVNDQPIAPSEEPDD--QKKNVA  397

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EP+K GSD+++PF+KQ S MLG IPAPPAFASE P K+AALR+N++++ASSS+HV
Sbjct  398  SSSKLEPSKFGSDYKYPFMKQTSCMLGGIPAPPAFASEFPSKNAALRMNSSSEASSSIHV  457

Query  490  TAGLIQISDLTLGS--------KHGNYNIILSFDFSQGAQSPGSLE------PVSHGKML  353
            T G I+I+++T+ S        KHGNYN+ILS   SQ   S   LE      P      +
Sbjct  458  T-GFIRITNMTVSSNGMDGLVGKHGNYNVILSLGLSQHGDSSAHLESEASFLPGKTISTV  516

Query  352  SGGWFYFLLFWVLILSISVKVGTFIYA  272
            S  WFY+L  WVL+LS + K+GTFI A
Sbjct  517  SWCWFYYLFLWVLLLSTTFKIGTFIRA  543


 Score = 85.9 bits (211),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIHDF--DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDG  927
             Q PDE + FD  I     D  PVK E+M E SNSM++E ++ LL+EP++  TD  QF+DG
Sbjct  253   QQPDEQESFDPAIQQINADTNPVKHEFMSEPSNSMSTEDVDYLLDEPVITATDNLQFSDG  312

Query  926   TFLETNDLSNPVEGNTSGFDMFD  858
              FLE +DLS P+E +TSGFDM +
Sbjct  313   AFLEASDLSRPIEVDTSGFDMLE  335



>ref|XP_006345843.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=544

 Score =   163 bits (413),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 132/207 (64%), Gaps = 18/207 (9%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA D+FQ M F+  +    D+ + + +   +K+  +  +Q + P+E+  D   K ++A
Sbjct  340  FFDADDNFQSMGFNPPMMTEGDDHVSDLASPEEKNIGEVNDQPIAPSEEPED--QKKNVA  397

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            SSSK EP+K GSD+++PF+KQAS MLG IPAPPAFASE P K AALR+N++++ASSS+HV
Sbjct  398  SSSKLEPSKFGSDYKYPFMKQASCMLGGIPAPPAFASEFPSKSAALRMNSSSEASSSIHV  457

Query  490  TAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLE------PVSHGKML  353
            T G IQI+++T+          KHGNYN+ILS   SQ   S   LE      P      +
Sbjct  458  T-GFIQITNMTMSGNGMDELVGKHGNYNVILSLGLSQHGDSSAHLESAVSFLPGKTISTV  516

Query  352  SGGWFYFLLFWVLILSISVKVGTFIYA  272
            S  WFY+L  WVLILS + KVGT I A
Sbjct  517  SWCWFYYLFLWVLILSTTFKVGTLIRA  543


 Score = 87.0 bits (214),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIHDF--DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDG  927
             Q PDE + FD  I     D  PVK E+M E SNSM +E ++ LL+EP++  TD  QF+DG
Sbjct  253   QQPDEQESFDPAIQQINADTNPVKHEFMSEPSNSMNTEDVDYLLDEPVVTATDNLQFSDG  312

Query  926   TFLETNDLSNPVEGNTSGFDMFD  858
              FLE +DLS P+E NTSGFDM +
Sbjct  313   AFLEASDLSRPIEVNTSGFDMLE  335



>ref|XP_006361710.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score =   157 bits (398),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 127/207 (61%), Gaps = 17/207 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            ++DA DDFQ+M FD  +F GND+ + +Q+   +KD  + T+Q + PNE     E KN  A
Sbjct  338  YFDANDDFQNMSFDPSVFFGNDDQISDQALLPEKDVGEVTQQPIAPNEGF--GEDKNGFA  395

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            +SSK  PTK GSD+Q PF+KQASQMLGNI APPAFASE P KDA LRLN+ ++++S V V
Sbjct  396  ASSKLVPTKFGSDYQLPFMKQASQMLGNIHAPPAFASEFPTKDAILRLNSLSRSASPVQV  455

Query  490  TAGLIQISDLTLG--------SKHGNYNII------LSFDFSQGAQSPGSLEPVSHGKML  353
            TA LI+I D++ G         KH  YNII       S        S  S+ P      +
Sbjct  456  TADLIRIRDMSAGGNGTRWPLGKHVYYNIILSLGLSRSSSDDSSMDSFHSIHPGKTTSTI  515

Query  352  SGGWFYFLLFWVLILSISVKVGTFIYA  272
            S GWF +L F  L+L +S+++GT I A
Sbjct  516  SRGWFCYLFFSFLMLLMSLRIGTTICA  542


 Score = 91.7 bits (226),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDELKP D  +  +F+ + V  EY+GESS +M SE  + LLNEP+++ TD  QFND  
Sbjct  252   QQPDELKPIDLAVQQNFNAEQVNHEYIGESSKNMNSEDGDYLLNEPIVNGTDDLQFNDEA  311

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPV+ ++SGFDMF+
Sbjct  312   FLEANDLSNPVQVDSSGFDMFE  333



>ref|XP_006361711.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Solanum 
tuberosum]
Length=563

 Score =   157 bits (398),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 127/207 (61%), Gaps = 17/207 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            ++DA DDFQ+M FD  +F GND+ + +Q+   +KD  + T+Q + PNE     E KN  A
Sbjct  358  YFDANDDFQNMSFDPSVFFGNDDQISDQALLPEKDVGEVTQQPIAPNEGF--GEDKNGFA  415

Query  667  SSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHV  491
            +SSK  PTK GSD+Q PF+KQASQMLGNI APPAFASE P KDA LRLN+ ++++S V V
Sbjct  416  ASSKLVPTKFGSDYQLPFMKQASQMLGNIHAPPAFASEFPTKDAILRLNSLSRSASPVQV  475

Query  490  TAGLIQISDLTLG--------SKHGNYNII------LSFDFSQGAQSPGSLEPVSHGKML  353
            TA LI+I D++ G         KH  YNII       S        S  S+ P      +
Sbjct  476  TADLIRIRDMSAGGNGTRWPLGKHVYYNIILSLGLSRSSSDDSSMDSFHSIHPGKTTSTI  535

Query  352  SGGWFYFLLFWVLILSISVKVGTFIYA  272
            S GWF +L F  L+L +S+++GT I A
Sbjct  536  SRGWFCYLFFSFLMLLMSLRIGTTICA  562


 Score = 91.7 bits (226),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q PDELKP D  +  +F+ + V  EY+GESS +M SE  + LLNEP+++ TD  QFND  
Sbjct  272   QQPDELKPIDLAVQQNFNAEQVNHEYIGESSKNMNSEDGDYLLNEPIVNGTDDLQFNDEA  331

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPV+ ++SGFDMF+
Sbjct  332   FLEANDLSNPVQVDSSGFDMFE  353



>emb|CDO99814.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   144 bits (363),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 129/212 (61%), Gaps = 25/212 (12%)
 Frame = -2

Query  850  NFYDAKDDFQD-MLFDSDIFIG-NDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKN  677
            NFYDA  +    M  D    +G N+  +  Q+    K++ +  + A   +EK +    + 
Sbjct  378  NFYDADGEIPPYMNHDLPEMMGINETLVSGQASILPKESEEKAQSAEESSEKLLG---RG  434

Query  676  DIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            D+ASSSK EPTK    FQ+PFIKQAS+MLG+IPAPPAFASE P +DA L L+ ++  SS+
Sbjct  435  DVASSSKEEPTK--EYFQYPFIKQASRMLGSIPAPPAFASEFPSEDATLLLDPSS--SST  490

Query  499  VHVTAGLIQISDLTLGS--------KHGNYNIILSFDFSQGAQSPGSLEPV---SHGKM-  356
             HVTAG+IQI ++  GS        KHG YN++LSF  S+G  +  +LE V     GK  
Sbjct  491  AHVTAGMIQIGNIGPGSHGMDWLFGKHGRYNVVLSFGLSRGDDNSTTLESVVSIRPGKAA  550

Query  355  ---LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
               +S GWF F+ FWVLILS+  K+GT I AR
Sbjct  551  ASGMSRGWFCFIFFWVLILSVGFKIGTCICAR  582


 Score = 89.4 bits (220),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -1

Query  1109  CGQQHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFN  933
             C  +  D+   ++ P+H D   K VKREY+GE SN++ +E++N LL+EP MD  D  QF+
Sbjct  290   CVPEQSDDQNSYNLPVHYDLHQKAVKREYIGEPSNALDAENVNYLLDEPYMDALDNLQFD  349

Query  932   DGTFLETNDLSNPVEGNTSGFDMFD  858
             DG FLETNDLSNP+  +TS F M +
Sbjct  350   DGAFLETNDLSNPIAADTSAFGMLE  374



>gb|EYU39671.1| hypothetical protein MIMGU_mgv1a003896mg [Erythranthe guttata]
Length=557

 Score =   160 bits (405),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 130/201 (65%), Gaps = 7/201 (3%)
 Frame = -2

Query  850  NFYDAKDDFQD-MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            +F+DA +D  D  +FDS + + N++ + +Q+    ++  + TEQ  LP+E+  +  + N 
Sbjct  357  SFFDANNDNSDHFMFDSSMILENEDLVSDQTLLLQEELDNGTEQCNLPSEQLDNNNNDNS  416

Query  673  IASSSKPEP-TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
             ASSS      K  SD+++PF+KQASQMLG IPAPPAFASE P KDAALRLN+ +Q SSS
Sbjct  417  SASSSDNLDSAKYESDYKYPFMKQASQMLGKIPAPPAFASEFPLKDAALRLNSLSQPSSS  476

Query  499  VHVTAGLIQISDLTLG----SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYF  332
            VHVTAG+IQI+D   G     KH N+NI+LSF FS    S  S  P      +S GW YF
Sbjct  477  VHVTAGMIQITDGRGGDQLLGKHENFNIVLSFGFSANMDSSFSALPGKAASTVSRGWLYF  536

Query  331  LLFWVLILSISVKVGTFIYAR  269
            +  WVLILS+S K+G  I A+
Sbjct  537  MFLWVLILSVSFKIGICICAK  557


 Score = 67.0 bits (162),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = -1

Query  1073  DQPI-HDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTF-------L  918
             D P+ +D + + VK EY+GESS S  S+  + LL+EPL D++   Q+ +G++       +
Sbjct  275   DLPVPYDMEVRAVKHEYIGESSKSGISDEFDYLLDEPLRDSSADLQYGNGSYIEADEGHI  334

Query  917   ETNDLSNPVEGNTSGFDMFDFX*F  846
             ETNDLSNPVE N S FDM ++  F
Sbjct  335   ETNDLSNPVETNNSPFDMEEYLSF  358



>ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum]
Length=563

 Score =   153 bits (387),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 126/210 (60%), Gaps = 19/210 (9%)
 Frame = -2

Query  847  FYDAKDD-FQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+ A DD  Q   +D  + +G++E + +Q+    +   +T +  +L  +  +D  + ND 
Sbjct  356  FFGANDDNAQHFAYDPSVMLGSEELISDQALLPQELNGETEKSTLLSGQ--IDDNNDNDA  413

Query  670  AS-SSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            AS S K +  K  SD Q+PFIKQAS MLG+IPAPPAFA+E P K   LRLN+ +Q SSSV
Sbjct  414  ASPSDKQDSAKYESDVQYPFIKQASHMLGSIPAPPAFAAEFPSKSTTLRLNSLSQPSSSV  473

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLE------PVSHGK  359
            HVTAG+IQI +LT           K  N+NI+LSF FS+G     SLE      P     
Sbjct  474  HVTAGMIQIRNLTTDGNGRVQSFGKPENFNIVLSFGFSRGNDGSASLESSVSILPGKTLS  533

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             LS GWF F+ FWVLILS+S K+GT I A+
Sbjct  534  TLSRGWFCFIFFWVLILSMSFKIGTCICAK  563


 Score = 68.9 bits (167),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -1

Query  1106  GQQHPDELKPFDQPI-HDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFND  930
              +QH D+   +D P  +D   + VK EY+GESS S  S+ L+ LL+EP +D++D  Q+ +
Sbjct  268   AEQHEDK-NFYDLPAPYDMTVRAVKHEYIGESSKSGNSDDLDYLLDEPFLDSSDNLQYGN  326

Query  929   GTFLETNDLSN-PVEGNTSGFDMFD  858
             G F+E+NDL N   E NTS FDM +
Sbjct  327   GGFIESNDLPNSAAETNTSAFDMLE  351



>ref|XP_012090539.1| PREDICTED: NAC domain-containing protein 78 [Jatropha curcas]
 gb|AGL39700.1| NAC transcription factor 044 [Jatropha curcas]
 gb|KDP45077.1| hypothetical protein JCGZ_01577 [Jatropha curcas]
Length=563

 Score =   150 bits (380),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 130/211 (62%), Gaps = 22/211 (10%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+DA DD  ++ FD    +G +  + +Q    +KD  +   +AV      +   H N+ A
Sbjct  357  FFDANDD--NLTFDPSELMGTEYAIPDQDHLFEKD-VNGGAKAVPVVTSELSEAHGNNDA  413

Query  667  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            SSSK   PE T   SD ++PF+KQASQMLG+IPAPPAFASE P KD AL+LNAA Q+SSS
Sbjct  414  SSSKQLKPEATMFESDMKYPFMKQASQMLGSIPAPPAFASEFPVKDRALQLNAA-QSSSS  472

Query  499  VHVTAGLIQISDLTLGS--------KHGNYNIILSFDFSQGAQSPGSLEPVS---HGKML  353
            + VTAG+I+I ++T GS        K+ N NIILSFD +Q    P SL P+     GK +
Sbjct  473  IRVTAGVIRIENITFGSSGMDWSSNKNQNVNIILSFDMAQANVGPASLVPMGSFFSGKAM  532

Query  352  ---SGGWFYFLLFWVLILSISVKVGTFIYAR  269
               S GW++ + FWVLI S + K+GT++  +
Sbjct  533  STVSRGWYFLMFFWVLIFSATFKIGTYVCTK  563


 Score = 64.7 bits (156),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 4/72 (6%)
 Frame = -1

Query  1061  HDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE--  888
             ++ D K V+ EYM ES  +M +   N LL+EP +D TD   F++G FLE NDLSNPVE  
Sbjct  281   YEVDAKAVRHEYMAESRCNMNAVDDNYLLDEPFVDATDNPPFSEGLFLEANDLSNPVEPE  340

Query  887   --GNTSGFDMFD  858
               G+++ FDM D
Sbjct  341   STGDSTPFDMVD  352



>ref|XP_006436536.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485307.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Citrus 
sinensis]
 gb|ESR49776.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=549

 Score =   146 bits (368),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 127/214 (59%), Gaps = 21/214 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P   +   + T+Q  +  +  V+  H ND
Sbjct  337  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLTTEQVTEVTDQMSMAGQHQVEV-HGND  395

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  396  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  455

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPG--SLEPVSH----  365
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   SP   S EP  +    
Sbjct  456  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSHTSFEPAGNIFSG  515

Query  364  --GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              G ++    +  L  W++ILS+  K+G  + A+
Sbjct  516  KTGSVVFRSLWLLLFLWIVILSVGFKIGACVSAK  549


 Score = 68.2 bits (165),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  1052  DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSG  873
             D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ G
Sbjct  270   DARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQG  328

Query  872   FDMFD  858
             FDM +
Sbjct  329   FDMVE  333



>ref|XP_002265345.2| PREDICTED: NAC domain-containing protein 78 [Vitis vinifera]
 emb|CBI31389.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   136 bits (343),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 125/212 (59%), Gaps = 20/212 (9%)
 Frame = -2

Query  847  FYDAK-DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F DA  D+ Q M F S   +G++  L + +P  D++  +   + +    + +   + +  
Sbjct  349  FLDADGDNLQQMAFGSFEMMGSENPLSDLAP-LDQEPVNGGAEKLPIGSQQLSEAYGDSG  407

Query  670  ASSSK--PEPTKLGSDFQHPFIKQAS-QMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            ASSSK  PE T+  SD  +PFIKQAS Q+LG IPAP A AS+ P KD ALRLN+A Q+SS
Sbjct  408  ASSSKKNPEATEFESDIPYPFIKQASYQLLGGIPAPFASASDAPTKDVALRLNSAMQSSS  467

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH------  365
            SVH+TAG+IQI D TL          K GN N +LSF   QG  +  SLEP++       
Sbjct  468  SVHLTAGMIQIRDTTLSGNGVDWSYGKSGNINFMLSFGLPQGETNSASLEPIASLMSGKA  527

Query  364  GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            G ++S   FY +  WVLILS+S K+GT I +R
Sbjct  528  GPVISRAGFYLIFIWVLILSVSYKIGTCICSR  559


 Score = 76.3 bits (186),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  1109  CGQQHPDELKPFD-QPIHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFN  933
             CG + P++ K FD    ++ D K VK EY  E SN + S  ++ LL+EP +D ++   F 
Sbjct  261   CGSELPNDQKIFDLSEQYEVDAKSVKDEYYVEQSNDVNSVEVDYLLDEPYLDASENLAFE  320

Query  932   DGTFLETNDLSNPVEGNTSGFDMFDFX*FL*CQG  831
             DG FLET+DLSNPVE + SGFD+ ++  FL   G
Sbjct  321   DGFFLETDDLSNPVETDPSGFDIDEYLAFLDADG  354



>ref|XP_011101544.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Sesamum 
indicum]
Length=542

 Score =   147 bits (370),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 129/201 (64%), Gaps = 13/201 (6%)
 Frame = -2

Query  847  FYDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+DA D +  D  +D  + +G+++ + +++    K  C+ TE+A+LP  K +D +  ND 
Sbjct  341  FFDANDGNSLDFAYDPALMLGSEDLVPDKAKLPHKGLCEGTEKAILPMGKLMD-DINNDA  399

Query  670  ASS-SKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            AS   + +     SDFQ+ F+++ASQMLGNIPAP AFA+E P KDA LRLN++TQ+SSSV
Sbjct  400  ASVFDEKQSENNQSDFQYQFVRKASQMLGNIPAPSAFAAEFPSKDAILRLNSSTQSSSSV  459

Query  496  HVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLE------PVSHGKMLSGG  344
            HVT+G+IQI +L      +KH N NI+LSF  S+      SLE      P      +S G
Sbjct  460  HVTSGMIQIRNLNTDGAFAKHENLNILLSFGLSRSDDGSSSLESSVRILPGKVASSISKG  519

Query  343  WFYFLLFWVLILSISVKVGTF  281
            WFYF+ FWVLILS+S K+ T+
Sbjct  520  WFYFMFFWVLILSVSFKIATY  540


 Score = 64.7 bits (156),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  1034  REYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFD  858
             ++Y+GE   S  S++++ LL+E  +D++D  Q+ DG F+ETNDLSNP+E +++ FDM +
Sbjct  278   KQYIGECGKSSRSQNMDYLLDEAFLDSSDNLQYGDGGFIETNDLSNPIETDSAAFDMLE  336



>ref|XP_011101543.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Sesamum 
indicum]
Length=547

 Score =   146 bits (369),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 129/201 (64%), Gaps = 13/201 (6%)
 Frame = -2

Query  847  FYDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+DA D +  D  +D  + +G+++ + +++    K  C+ TE+A+LP  K +D +  ND 
Sbjct  346  FFDANDGNSLDFAYDPALMLGSEDLVPDKAKLPHKGLCEGTEKAILPMGKLMD-DINNDA  404

Query  670  ASS-SKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            AS   + +     SDFQ+ F+++ASQMLGNIPAP AFA+E P KDA LRLN++TQ+SSSV
Sbjct  405  ASVFDEKQSENNQSDFQYQFVRKASQMLGNIPAPSAFAAEFPSKDAILRLNSSTQSSSSV  464

Query  496  HVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLE------PVSHGKMLSGG  344
            HVT+G+IQI +L      +KH N NI+LSF  S+      SLE      P      +S G
Sbjct  465  HVTSGMIQIRNLNTDGAFAKHENLNILLSFGLSRSDDGSSSLESSVRILPGKVASSISKG  524

Query  343  WFYFLLFWVLILSISVKVGTF  281
            WFYF+ FWVLILS+S K+ T+
Sbjct  525  WFYFMFFWVLILSVSFKIATY  545


 Score = 64.7 bits (156),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  1034  REYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFD  858
             ++Y+GE   S  S++++ LL+E  +D++D  Q+ DG F+ETNDLSNP+E +++ FDM +
Sbjct  283   KQYIGECGKSSRSQNMDYLLDEAFLDSSDNLQYGDGGFIETNDLSNPIETDSAAFDMLE  341



>ref|XP_006436534.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 gb|ESR49774.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=476

 Score =   142 bits (359),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 127/214 (59%), Gaps = 22/214 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  265  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  322

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  323  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  382

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPG--SLEPVSH----  365
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   SP   S EP  +    
Sbjct  383  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSHTSFEPAGNIFSG  442

Query  364  --GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              G ++    +  L  W++ILS+  K+G  + A+
Sbjct  443  KTGSVVFRSLWLLLFLWIVILSVGFKIGACVSAK  476


 Score = 68.6 bits (166),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  197   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  255

Query  875   GFDMFD  858
             GFDM +
Sbjct  256   GFDMVE  261



>ref|XP_007218872.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
 gb|EMJ20071.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
Length=590

 Score =   147 bits (372),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 124/211 (59%), Gaps = 19/211 (9%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            ++DA DD    + FDS   +G +  + +QSP   K     TEQ  +  E     E  ND 
Sbjct  381  YFDADDDISQYIDFDSCGMMGVENSVPDQSPVDQKLGNGETEQLPMGVEHLAQAEDTND-  439

Query  670  ASSSKPEPT-KLGSDFQHPFIKQASQ-MLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            ASSSK +P  KL SD  +PFIK+AS  MLGNIPAPPAFASE P KDA LRLN+   +SSS
Sbjct  440  ASSSKQKPEFKLESDVNYPFIKKASHMMLGNIPAPPAFASEFPAKDAILRLNSGAASSSS  499

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPV------SHG  362
            VH+TAG+I+I D+T           K G  N++ S   SQ   + G+L P+        G
Sbjct  500  VHLTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPMDGSLSGKTG  559

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ++  GWF F+ FWVL LS+S K+G+++Y R
Sbjct  560  CVVMRGWFLFMFFWVLFLSMSFKIGSYVYTR  590


 Score = 63.5 bits (153),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -1

Query  1091  DELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLE  915
             D+LK FD P H + D K VK E   E SN      +N  LNEP  +TT+     DG FLE
Sbjct  299   DDLKFFDVPEHYEADAKLVKDECFIEPSNDTNPADVNYPLNEPYFNTTENPPVGDGLFLE  358

Query  914   TNDLSNPVEGNTSGFDMFD  858
             TNDLSNPVE +T+GFDM D
Sbjct  359   TNDLSNPVE-STAGFDMLD  376



>ref|XP_011101545.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Sesamum 
indicum]
 ref|XP_011101546.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Sesamum 
indicum]
Length=459

 Score =   146 bits (369),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 129/201 (64%), Gaps = 13/201 (6%)
 Frame = -2

Query  847  FYDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+DA D +  D  +D  + +G+++ + +++    K  C+ TE+A+LP  K +D +  ND 
Sbjct  258  FFDANDGNSLDFAYDPALMLGSEDLVPDKAKLPHKGLCEGTEKAILPMGKLMD-DINNDA  316

Query  670  ASS-SKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            AS   + +     SDFQ+ F+++ASQMLGNIPAP AFA+E P KDA LRLN++TQ+SSSV
Sbjct  317  ASVFDEKQSENNQSDFQYQFVRKASQMLGNIPAPSAFAAEFPSKDAILRLNSSTQSSSSV  376

Query  496  HVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLE------PVSHGKMLSGG  344
            HVT+G+IQI +L      +KH N NI+LSF  S+      SLE      P      +S G
Sbjct  377  HVTSGMIQIRNLNTDGAFAKHENLNILLSFGLSRSDDGSSSLESSVRILPGKVASSISKG  436

Query  343  WFYFLLFWVLILSISVKVGTF  281
            WFYF+ FWVLILS+S K+ T+
Sbjct  437  WFYFMFFWVLILSVSFKIATY  457


 Score = 64.3 bits (155),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  1034  REYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFD  858
             ++Y+GE   S  S++++ LL+E  +D++D  Q+ DG F+ETNDLSNP+E +++ FDM +
Sbjct  195   KQYIGECGKSSRSQNMDYLLDEAFLDSSDNLQYGDGGFIETNDLSNPIETDSAAFDMLE  253



>ref|XP_006436535.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485308.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Citrus 
sinensis]
 gb|ESR49775.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=548

 Score =   142 bits (358),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 127/214 (59%), Gaps = 22/214 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  337  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  394

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  395  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  454

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPG--SLEPVSH----  365
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   SP   S EP  +    
Sbjct  455  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSHTSFEPAGNIFSG  514

Query  364  --GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              G ++    +  L  W++ILS+  K+G  + A+
Sbjct  515  KTGSVVFRSLWLLLFLWIVILSVGFKIGACVSAK  548


 Score = 68.2 bits (165),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  1052  DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSG  873
             D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ G
Sbjct  270   DARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQG  328

Query  872   FDMFD  858
             FDM +
Sbjct  329   FDMVE  333



>ref|XP_007010050.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18860.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
Length=590

 Score =   159 bits (401),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 131/210 (62%), Gaps = 21/210 (10%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F DA D  Q + FDSD  +G++  + +Q P A   +   TEQ    +E     E  N  A
Sbjct  385  FIDADD--QPLAFDSDQMVGSEIPVSDQEPLAQTHSNGGTEQVSNASEHL--EELGNSDA  440

Query  667  SSSKPE--PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            SSSK E  PTK  S  ++PF+KQAS MLG+ PAPPAFASE P KDAAL+LN+A QASSSV
Sbjct  441  SSSKQELEPTKFESGTKYPFLKQASHMLGSFPAPPAFASEFPSKDAALKLNSAAQASSSV  500

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH------GK  359
            HV AG+I+I+++T          SK+GN NI+LSF   QG  +  +  P++       G 
Sbjct  501  HVVAGMIRITNMTSSGNQLDWSHSKNGNVNIVLSFSLPQGDVNSSNFLPMASLLSGKAGS  560

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            +L+ GWF+ +L WVLI+++S+K GT IY R
Sbjct  561  VLARGWFFLMLLWVLIITVSLKFGTCIYTR  590


 Score = 51.2 bits (121),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -1

Query  1046  KPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFD  867
             KPVK EY+ E   ++     N  L+EP +D TD    NDG FLE NDLSNP+   +  FD
Sbjct  319   KPVKDEYVVEPIENVNPADNNYFLDEPYLDVTDYLPANDGFFLEANDLSNPIGPESDVFD  378



>ref|XP_008232319.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Prunus 
mume]
Length=590

 Score =   147 bits (370),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 122/210 (58%), Gaps = 17/210 (8%)
 Frame = -2

Query  847  FYDAKDDF-QDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            ++DA DD  Q + FDS   +G +  + +QSP   K     TEQ  +  E     E  ND 
Sbjct  381  YFDADDDISQYIDFDSCGMMGVENSVPDQSPVDQKLVNGETEQLPMGVEHLAQAEDTNDA  440

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQ-MLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            +SS +    KL SD  +PFIK+AS  MLGNIPAPPAFASE P KDA LRLN+ + +SS V
Sbjct  441  SSSEQKPEFKLESDVNYPFIKKASHMMLGNIPAPPAFASEFPAKDAILRLNSGSASSSPV  500

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPV------SHGK  359
            H+TAG+I+I D+T           K G  N++ S   SQ   + G+L P+        G 
Sbjct  501  HITAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPMDGSLSGKTGC  560

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            ++  GWF F+ FWVL LS+S K+G+++Y R
Sbjct  561  VVMRGWFLFMFFWVLFLSMSFKIGSYVYTR  590


 Score = 62.0 bits (149),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -1

Query  1091  DELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLE  915
             D+LK FD P H + D K VK E   E SN      +N  LNEP  +T +     DG FLE
Sbjct  299   DDLKFFDVPEHSEADAKLVKDECFIEPSNDTNPADVNYPLNEPYFNTAENPPVGDGLFLE  358

Query  914   TNDLSNPVEGNTSGFDMFD  858
             TNDLSNPVE +T+GFDM D
Sbjct  359   TNDLSNPVE-STAGFDMLD  376



>ref|XP_010090439.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB39454.1| NAC domain-containing protein 78 [Morus notabilis]
Length=612

 Score =   159 bits (402),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 128/210 (61%), Gaps = 16/210 (8%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D +DD Q + FDS   +G +  L ++ P   K      E +    ++  +    N+ 
Sbjct  403  NFFDVEDDSQLLAFDSSQIMGIENSLTQEEPPLQKLVTGEAEASPTGTQQPAEAHDNNEA  462

Query  670  ASSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            ++SS + E TK  SDF++PF+KQASQMLG+IPAPPAFA+E P KDAALRLN+   +S SV
Sbjct  463  STSSQRAEVTKSESDFKYPFMKQASQMLGSIPAPPAFAAEFPTKDAALRLNSVGTSSGSV  522

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH------GK  359
            HVTAG+I+I  L L          K G+ N++LS+   Q A    ++ P++       G 
Sbjct  523  HVTAGMIRIQHLNLDGNGMDWSFGKSGDVNLLLSYSLPQAAFDSATVVPMAGILSGKAGS  582

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            ++S GWF+F+  WVLI+S+S KVG +IY R
Sbjct  583  VVSKGWFFFMFIWVLIISVSFKVGNYIYTR  612


 Score = 47.8 bits (112),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -1

Query  1061  HDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGN  882
             H+   KPVK EY  + S+++    +N    E  ++ T+   F +G +LETNDLS PVE +
Sbjct  332   HEMHAKPVKDEYCVQPSDNVDPADVNYAFGEQFLNATNTPPFGEGLYLETNDLSKPVEED  391

Query  881   TSGFDMFD  858
                F + D
Sbjct  392   PGDFGLLD  399



>ref|XP_008232318.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Prunus 
mume]
Length=591

 Score =   144 bits (364),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 123/211 (58%), Gaps = 18/211 (9%)
 Frame = -2

Query  847  FYDAKDDF-QDMLFDSDIFIGNDEFLGEQSPSADKDACD-TTEQAVLPNEKAVDTEHKND  674
            ++DA DD  Q + FDS   +G +  + +QSP   K   +  TEQ  +  E     E  ND
Sbjct  381  YFDADDDISQYIDFDSCGMMGVENSVPDQSPVDQKQLVNGETEQLPMGVEHLAQAEDTND  440

Query  673  IASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
             +SS +    KL SD  +PFIK+AS M LGNIPAPPAFASE P KDA LRLN+ + +SS 
Sbjct  441  ASSSEQKPEFKLESDVNYPFIKKASHMMLGNIPAPPAFASEFPAKDAILRLNSGSASSSP  500

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPV------SHG  362
            VH+TAG+I+I D+T           K G  N++ S   SQ   + G+L P+        G
Sbjct  501  VHITAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPMDGSLSGKTG  560

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ++  GWF F+ FWVL LS+S K+G+++Y R
Sbjct  561  CVVMRGWFLFMFFWVLFLSMSFKIGSYVYTR  591


 Score = 62.0 bits (149),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -1

Query  1091  DELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLE  915
             D+LK FD P H + D K VK E   E SN      +N  LNEP  +T +     DG FLE
Sbjct  299   DDLKFFDVPEHSEADAKLVKDECFIEPSNDTNPADVNYPLNEPYFNTAENPPVGDGLFLE  358

Query  914   TNDLSNPVEGNTSGFDMFD  858
             TNDLSNPVE +T+GFDM D
Sbjct  359   TNDLSNPVE-STAGFDMLD  376



>ref|XP_011031618.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=556

 Score =   148 bits (374),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 22/211 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA D  ++M FD SDIF  +D  +  Q P   +D    TE+ +   +K ++T    D
Sbjct  351  NFFDADD--ENMSFDPSDIF-ASDIAVSNQQPPPQEDVKGGTEEVLKAIQKPLETHGNVD  407

Query  673  IASSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
             +SS  KP+  +  S F++PFIKQAS MLG IPAPPA ASE P KDAALR+ +A+  SSS
Sbjct  408  PSSSKQKPDAMEFDSGFKYPFIKQASHMLGKIPAPPALASEFPSKDAALRIQSAS--SSS  465

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVS---HGK--  359
            +HVTAG+I+I +++LG         K+GN ++I SF   Q    P S  P++    GK  
Sbjct  466  IHVTAGMIRIENMSLGGNGAEWSFGKNGNIDVIFSFGLPQQEGGPASWVPMTSLFSGKAE  525

Query  358  -MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ++S GW + + FWVLILS+S K+GT I A+
Sbjct  526  SVVSRGWLFLMFFWVLILSVSYKIGTCICAK  556


 Score = 52.4 bits (124),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE----  888
             ++   VK EY  E  N++ +  +N L +E  +D  +    ++G FLE NDLSNPVE    
Sbjct  278   YETDAVKNEYNAEPMNNVNAVDVNYLFDESYLDALNNLPQSEGLFLEANDLSNPVEPETG  337

Query  887   GNTSGFDMFD  858
             G++SGFDM +
Sbjct  338   GDSSGFDMLE  347



>ref|XP_011031619.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=502

 Score =   148 bits (374),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 22/211 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA D  ++M FD SDIF  +D  +  Q P   +D    TE+ +   +K ++T    D
Sbjct  297  NFFDADD--ENMSFDPSDIF-ASDIAVSNQQPPPQEDVKGGTEEVLKAIQKPLETHGNVD  353

Query  673  IASSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
             +SS  KP+  +  S F++PFIKQAS MLG IPAPPA ASE P KDAALR+ +A+  SSS
Sbjct  354  PSSSKQKPDAMEFDSGFKYPFIKQASHMLGKIPAPPALASEFPSKDAALRIQSAS--SSS  411

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVS---HGK--  359
            +HVTAG+I+I +++LG         K+GN ++I SF   Q    P S  P++    GK  
Sbjct  412  IHVTAGMIRIENMSLGGNGAEWSFGKNGNIDVIFSFGLPQQEGGPASWVPMTSLFSGKAE  471

Query  358  -MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ++S GW + + FWVLILS+S K+GT I A+
Sbjct  472  SVVSRGWLFLMFFWVLILSVSYKIGTCICAK  502


 Score = 52.4 bits (124),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE----  888
             ++   VK EY  E  N++ +  +N L +E  +D  +    ++G FLE NDLSNPVE    
Sbjct  224   YETDAVKNEYNAEPMNNVNAVDVNYLFDESYLDALNNLPQSEGLFLEANDLSNPVEPETG  283

Query  887   GNTSGFDMFD  858
             G++SGFDM +
Sbjct  284   GDSSGFDMLE  293



>gb|KDO47584.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=549

 Score =   132 bits (332),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 17/182 (9%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P   +   + T+Q  +  +  V+  H ND
Sbjct  337  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLTTEQVTEVTDQMSMAGQHQVEV-HGND  395

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  396  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  455

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  456  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  513

Query  352  SG  347
            SG
Sbjct  514  SG  515


 Score = 68.2 bits (165),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  269   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  327

Query  875   GFDMFD  858
             GFDM +
Sbjct  328   GFDMVE  333



>ref|XP_009346651.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Pyrus 
x bretschneideri]
Length=607

 Score =   135 bits (340),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 125/224 (56%), Gaps = 33/224 (15%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE------QAVLPNEKAVDT  689
            ++DA DD    + FDS   +G + ++ +++P+  K     TE      + V P  + +  
Sbjct  386  YFDANDDISQYIDFDSCGMMGVENYVPDEAPADQKLVNGETEPQPMGGEHVQPEPQPMGG  445

Query  688  EH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  533
            EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  
Sbjct  446  EHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMR  505

Query  532  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLE  377
            RLN+   +SSSVHVTAG+I+I D+T           K G  N++ S    Q   + G+L 
Sbjct  506  RLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNLV  565

Query  376  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
            PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  566  PV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  607


 Score = 62.4 bits (150),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q P++LK  D P H + D K VK E   E S+      +N  LNEP ++ T+     DG 
Sbjct  301   QSPEDLKFVDLPEHNEADAKSVKDECFLEPSDDANPAVVNYSLNEPYLNATENTPIGDGL  360

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPVE +T+GFDM D
Sbjct  361   FLEANDLSNPVE-STAGFDMLD  381



>gb|KDO47583.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=596

 Score =   129 bits (325),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  385  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  442

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  443  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  502

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  503  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  560

Query  352  SG  347
            SG
Sbjct  561  SG  562


 Score = 68.2 bits (165),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  1052  DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSG  873
             D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ G
Sbjct  318   DARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQG  376

Query  872   FDMFD  858
             FDM +
Sbjct  377   FDMVE  381



>gb|ADL36811.1| NAC domain class transcription factor [Malus domestica]
Length=607

 Score =   135 bits (339),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 125/224 (56%), Gaps = 33/224 (15%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE------QAVLPNEKAVDT  689
            ++DA DD    + FDS   +G + ++ +++P+  K     TE      + V P  + +  
Sbjct  386  YFDANDDISQYIDFDSYGMMGVENYVPDEAPADQKLVNGETEPQPMGGEHVQPEPQPLGG  445

Query  688  EH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAAL  533
            EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A  
Sbjct  446  EHLVQPVDTDDASSSKKTAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAMR  505

Query  532  RLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLE  377
            RLN+   +SSSVHVTA +I+I D+T           K G  N++ S   SQ   + G+L 
Sbjct  506  RLNSGAASSSSVHVTAAMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQDDGNSGNLV  565

Query  376  PVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
            PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  566  PV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  607


 Score = 62.4 bits (150),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q P++LK  D P H + D K VK E   E S+      +N  LNEP ++ T+     DG 
Sbjct  301   QSPEDLKFVDLPEHNEADAKSVKDECFLEPSDDANPAVVNYSLNEPYLNATENTPIGDGL  360

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPVE +T+GFDM D
Sbjct  361   FLEANDLSNPVE-STAGFDMLD  381



>gb|KDO47590.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=463

 Score =   129 bits (323),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  252  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  309

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  310  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  369

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  370  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  427

Query  352  SG  347
            SG
Sbjct  428  SG  429


 Score = 68.2 bits (165),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  184   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  242

Query  875   GFDMFD  858
             GFDM +
Sbjct  243   GFDMVE  248



>gb|KDO47587.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=536

 Score =   129 bits (323),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  325  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  382

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  383  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  442

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  443  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  500

Query  352  SG  347
            SG
Sbjct  501  SG  502


 Score = 68.2 bits (165),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  257   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  315

Query  875   GFDMFD  858
             GFDM +
Sbjct  316   GFDMVE  321



>gb|KDO47589.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=476

 Score =   128 bits (322),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  265  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  322

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  323  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  382

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  383  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  440

Query  352  SG  347
            SG
Sbjct  441  SG  442


 Score = 68.6 bits (166),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  197   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  255

Query  875   GFDMFD  858
             GFDM +
Sbjct  256   GFDMVE  261



>gb|KDO47585.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=548

 Score =   129 bits (323),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  337  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  394

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  395  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  454

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  455  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  512

Query  352  SG  347
            SG
Sbjct  513  SG  514


 Score = 68.2 bits (165),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  269   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  327

Query  875   GFDMFD  858
             GFDM +
Sbjct  328   GFDMVE  333



>gb|KDO47586.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=528

 Score =   129 bits (323),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  317  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  374

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +AS+S  KP+  K  SD ++PF+KQASQMLGN+ A PAFASE P KDAALRLN+    SS
Sbjct  375  VASTSEQKPDIVKSESDVKYPFLKQASQMLGNVAAAPAFASEFPTKDAALRLNSLAHPSS  434

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQG--AQSPGSLEPVSHGKML  353
            SVHVTAG+I+I ++TL          K+G+ NI+ SFD SQ   + SP S EP   G + 
Sbjct  435  SVHVTAGMIRIRNITLSGSGLDWSVGKNGDMNIVFSFDLSQNVISPSPTSFEPA--GNIF  492

Query  352  SG  347
            SG
Sbjct  493  SG  494


 Score = 68.2 bits (165),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  249   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  307

Query  875   GFDMFD  858
             GFDM +
Sbjct  308   GFDMVE  313



>emb|CAN70406.1| hypothetical protein VITISV_021988 [Vitis vinifera]
Length=573

 Score =   120 bits (301),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 116/203 (57%), Gaps = 20/203 (10%)
 Frame = -2

Query  847  FYDAK-DDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F DA  D+ Q M F S   +G++  L + +P  D++  +   +      + +   + +  
Sbjct  349  FLDADGDNLQQMAFGSFEMMGSENPLSDLAP-LDQEPVNGGAEKXPIGSQQLSEAYGDSG  407

Query  670  ASSSKPEP--TKLGSDFQHPFIKQAS-QMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            ASSSK  P  T+  SD  +PFIKQAS Q+LG IPAP A AS+ P KD ALRLN+A Q+SS
Sbjct  408  ASSSKKNPXATEFESDIPYPFIKQASYQLLGGIPAPFASASDAPTKDVALRLNSAMQSSS  467

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH------  365
            SVH+TAG+IQI D TL          K GN N +LSF   QG  +  SLEP++       
Sbjct  468  SVHLTAGMIQIRDTTLSGNGVDWSYGKSGNINFMLSFGLPQGETNSASLEPIASLMSGKA  527

Query  364  GKMLSGGWFYFLLFWVLILSISV  296
            G ++S   FY +  WVLILS ++
Sbjct  528  GPVISRAGFYLIFIWVLILSRAL  550


 Score = 76.3 bits (186),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  1109  CGQQHPDELKPFD-QPIHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFN  933
             CG + P++ K FD    ++ D K VK EY  E SN + S  ++ LL+EP +D ++   F 
Sbjct  261   CGSELPNDQKIFDLSEQYEVDAKSVKDEYYVEQSNDVNSVEVDYLLDEPYLDASENLAFE  320

Query  932   DGTFLETNDLSNPVEGNTSGFDMFDFX*FL*CQG  831
             DG FLET+DLSNPVE + SGFD+ ++  FL   G
Sbjct  321   DGFFLETDDLSNPVETDPSGFDIDEYLAFLDADG  354



>ref|XP_009346650.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Pyrus 
x bretschneideri]
Length=608

 Score =   133 bits (334),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 126/225 (56%), Gaps = 34/225 (15%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTE------QAVLPNEKAVD  692
            ++DA DD    + FDS   +G + ++ +++P+  K   +  TE      + V P  + + 
Sbjct  386  YFDANDDISQYIDFDSCGMMGVENYVPDEAPADQKQLVNGETEPQPMGGEHVQPEPQPMG  445

Query  691  TEH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAA  536
             EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A 
Sbjct  446  GEHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAM  505

Query  535  LRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSL  380
             RLN+   +SSSVHVTAG+I+I D+T           K G  N++ S    Q   + G+L
Sbjct  506  RRLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNL  565

Query  379  EPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
             PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  566  VPV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  608


 Score = 62.8 bits (151),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q P++LK  D P H + D K VK E   E S+      +N  LNEP ++ T+     DG 
Sbjct  301   QSPEDLKFVDLPEHNEADAKSVKDECFLEPSDDANPAVVNYSLNEPYLNATENTPIGDGL  360

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPVE +T+GFDM D
Sbjct  361   FLEANDLSNPVE-STAGFDMLD  381



>ref|XP_009346652.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Pyrus 
x bretschneideri]
Length=607

 Score =   133 bits (334),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 126/225 (56%), Gaps = 34/225 (15%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTE------QAVLPNEKAVD  692
            ++DA DD    + FDS   +G + ++ +++P+  K   +  TE      + V P  + + 
Sbjct  385  YFDANDDISQYIDFDSCGMMGVENYVPDEAPADQKQLVNGETEPQPMGGEHVQPEPQPMG  444

Query  691  TEH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAA  536
             EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A 
Sbjct  445  GEHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAM  504

Query  535  LRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSL  380
             RLN+   +SSSVHVTAG+I+I D+T           K G  N++ S    Q   + G+L
Sbjct  505  RRLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNL  564

Query  379  EPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
             PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  565  VPV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  607


 Score = 62.4 bits (150),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q P++LK  D P H + D K VK E   E S+      +N  LNEP ++ T+     DG 
Sbjct  300   QSPEDLKFVDLPEHNEADAKSVKDECFLEPSDDANPAVVNYSLNEPYLNATENTPIGDGL  359

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPVE +T+GFDM D
Sbjct  360   FLEANDLSNPVE-STAGFDMLD  380



>ref|XP_008345397.1| PREDICTED: NAC domain-containing protein 78-like [Malus domestica]
Length=609

 Score =   130 bits (326),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 125/226 (55%), Gaps = 35/226 (15%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE------QAVLPNEKAVDT  689
            ++DA DD    + FDS   +G + ++ +++P+  K     TE      + V P  + +  
Sbjct  386  YFDANDDISQYIDFDSXGMMGVENYVPDEAPADQKLVNGETEPQPMGGEXVQPEPQPLGG  445

Query  688  EH-----KNDIASSSKPEPT---KLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDA  539
            EH       D AS+S  + T   K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A
Sbjct  446  EHLVQPVDTDDASASSSKKTXEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEA  505

Query  538  ALRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGS  383
              RLN+   +SSSVHVTA +I+I D+T           K G  N++ S   SQ   + G+
Sbjct  506  MRRLNSGAASSSSVHVTAAMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQDDGNSGN  565

Query  382  LEPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
            L PV  G  LSG        GWF F+ FWVL LS+S+K+G++I  R
Sbjct  566  LVPV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIXTR  609


 Score = 62.8 bits (151),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q P++LK  D P H + D K VK E   E S+      +N  LNEP ++ T+     DG 
Sbjct  301   QSPEDLKFVDLPEHXEADAKSVKDECFLEPSDDANPAVVNYSLNEPYLNATENTPIGDGL  360

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLE NDLSNPVE +T+GFDM D
Sbjct  361   FLEANDLSNPVE-STAGFDMLD  381



>ref|XP_009361439.1| PREDICTED: NAC domain-containing protein 78-like [Pyrus x bretschneideri]
Length=589

 Score =   123 bits (308),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 115/212 (54%), Gaps = 27/212 (13%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            ++DA DD    + FDS  ++       +Q PS  K     TE   +  E  V  E  +D 
Sbjct  386  YFDANDDISQYIDFDSCGYVP------DQGPSDQKLLNGETELQPMGGEHLVQPEDTDDA  439

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            + + K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A LRLN+   +SSSV
Sbjct  440  SLTKKMPECKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPAKEAMLRLNSGASSSSSV  499

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG--  347
            HVTA +I+I D+T           K G  N++ S   SQ   + G+L PV  G  LSG  
Sbjct  500  HVTAAMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNLVPV--GGSLSGKT  557

Query  346  ------GWFYFLLFWVLILSISVKVGTFIYAR  269
                  GWF F+  WVL LS+S K+G++I  R
Sbjct  558  GCVVMRGWFLFMFLWVLFLSMSYKIGSYICTR  589


 Score = 67.4 bits (163),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             Q+P++LK  D   H + D +PVK E   E S+      +N  LNEP +D T+   F DG 
Sbjct  301   QNPEDLKFVDLTEHYEADARPVKDECFLEPSDGANPSVVNYSLNEPYLDATENKPFGDGL  360

Query  923   FLETNDLSNPVEGNTSGFDMFD  858
             FLETNDLSNPVE +T+GFDM D
Sbjct  361   FLETNDLSNPVE-STAGFDMLD  381



>ref|XP_006378789.1| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|ERP56586.1| NAC domain-containing protein 78 [Populus trichocarpa]
Length=554

 Score =   145 bits (367),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 133/211 (63%), Gaps = 24/211 (11%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA D  ++M FD SDIF G++  + +Q P  + D    TE+    +   ++T    D
Sbjct  351  NFFDAVD--ENMSFDPSDIF-GSETAVSDQLPPQE-DVKGQTEELSTASLNLLETHGTID  406

Query  673  IASSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
             +SS  KPE  K  SDF++PFIKQAS  LGNIPAPPA ASE P KDAAL L+ A+  SSS
Sbjct  407  PSSSKQKPEAMKFDSDFKYPFIKQASHRLGNIPAPPALASEFPSKDAALHLHPAS--SSS  464

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH---GK--  359
            ++VTAG+I+I +++LG         K+GN NIILSF   Q    P SL P++    GK  
Sbjct  465  INVTAGMIRIENMSLGGNEMEWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFPGKTE  523

Query  358  -MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ++S GW Y + FWVLILS+S K+GT I A+
Sbjct  524  SVVSRGWLYLMFFWVLILSVSYKIGTCICAK  554


 Score = 44.7 bits (104),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = -1

Query  1037  KREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE----GNTSGF  870
             K+E+  E  N + + + N L +E  +D       ++G FLE NDLS PVE    G++SGF
Sbjct  284   KKEHNAEPINIVNALNANYLFDESYLDALGDLPPSEGFFLEANDLSKPVEPETGGDSSGF  343

Query  869   DMFD  858
             DM D
Sbjct  344   DMVD  347



>ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
 gb|EEF01509.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
Length=556

 Score =   142 bits (359),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 134/213 (63%), Gaps = 26/213 (12%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA D  ++M FD SDIF G++  + +Q P  + D    TE+    +   ++T    D
Sbjct  351  NFFDAVD--ENMSFDPSDIF-GSETAVSDQLPPQE-DVKGQTEELSTASLNLLETHGTID  406

Query  673  IASSS-KPEPTKL--GSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             +SS  KPE  K   G+DF++PFIKQAS  LGNIPAPPA ASE P KDAAL L+ A+  S
Sbjct  407  PSSSKQKPEAMKFDSGADFKYPFIKQASHRLGNIPAPPALASEFPSKDAALHLHPAS--S  464

Query  505  SSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH---GK  359
            SS++VTAG+I+I +++LG         K+GN NIILSF   Q    P SL P++    GK
Sbjct  465  SSINVTAGMIRIENMSLGGNEMEWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFPGK  523

Query  358  ---MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
               ++S GW Y + FWVLILS+S K+GT I A+
Sbjct  524  TESVVSRGWLYLMFFWVLILSVSYKIGTCICAK  556


 Score = 44.7 bits (104),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = -1

Query  1037  KREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE----GNTSGF  870
             K+E+  E  N + + + N L +E  +D       ++G FLE NDLS PVE    G++SGF
Sbjct  284   KKEHNAEPINIVNALNANYLFDESYLDALGDLPPSEGFFLEANDLSKPVEPETGGDSSGF  343

Query  869   DMFD  858
             DM D
Sbjct  344   DMVD  347



>ref|XP_011024334.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=556

 Score =   148 bits (374),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 130/210 (62%), Gaps = 21/210 (10%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+DA D  +++ FD    +G++  + +Q     +D    TE+    ++  ++T    D 
Sbjct  352  NFFDAVD--ENLSFDPSDILGSETAVSDQQLPPQEDVKGRTEELSTASQNLLETHGTIDP  409

Query  670  ASSS-KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            +SS  KPE  K  SDF++PFIKQAS  LGNIPAPPA ASE P KDAALRL+ A+  SSS+
Sbjct  410  SSSKQKPEGMKFDSDFKYPFIKQASHRLGNIPAPPALASEFPSKDAALRLHPAS--SSSI  467

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH---GK---  359
            +VTAG+I+I +++LG         K+GN NIILSF   Q    P SL P++    GK   
Sbjct  468  NVTAGMIRIENMSLGGNEMQWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFLGKTES  526

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            ++S GW Y + FWVLILS+S K GT I A+
Sbjct  527  VVSRGWLYLMFFWVLILSVSYKFGTCICAK  556


 Score = 37.7 bits (86),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = -1

Query  1037  KREYMGE-SSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE----GNTSG  873
             K+E+  E   N + + + N L +E  +D  D    ++G FLE NDLS PVE    G++S 
Sbjct  284   KKEHNAEPIINIVNAINANYLFDESYLDALDDLPQSEGFFLEANDLSKPVELETGGDSSD  343

Query  872   FDMFD  858
             F+M D
Sbjct  344   FNMVD  348



>ref|XP_008339779.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Malus 
domestica]
Length=602

 Score =   121 bits (303),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 122/225 (54%), Gaps = 40/225 (18%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE-------QAVLPNEKAVD  692
            ++DA DD    + FDS    GN   + +Q+PS  K     TE         V P  + + 
Sbjct  386  YFDANDDISQYIDFDS---CGN---VPDQAPSNQKLLNGETEPQPMGGDHLVQPEPQPMG  439

Query  691  TEH-----KNDIASSSKPEP-TKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAA  536
             EH       D AS SK  P +K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A 
Sbjct  440  GEHLVQPEDTDDASLSKKMPESKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPAKEAM  499

Query  535  LRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSL  380
            LRLN+   +SSSVHVTAG+I+I D+T           K G  N++ S   SQ   + G+L
Sbjct  500  LRLNSGASSSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNL  559

Query  379  EPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
             PV  G  LSG        GWF F+  WVL LS+S K+G++I  R
Sbjct  560  VPV--GGSLSGKTGCVVMRGWFLFMFLWVLFLSMSFKIGSYICTR  602


 Score = 64.7 bits (156),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQ-FNDG  927
             Q+P++LK  D   H + D KPVK E   E S+      +N  LNEP +D T+  + F DG
Sbjct  300   QNPEDLKFVDLTEHYEADAKPVKDECFLEPSDGANPSVVNYSLNEPYLDATENNKPFGDG  359

Query  926   TFLETNDLSNPVEGNTSGFDMFD  858
              FLETNDLSNPVE +T+GFDM D
Sbjct  360   LFLETNDLSNPVE-STAGFDMLD  381



>ref|XP_008339778.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Malus 
domestica]
Length=603

 Score =   121 bits (303),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 122/225 (54%), Gaps = 40/225 (18%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTE-------QAVLPNEKAVD  692
            ++DA DD    + FDS    GN   + +Q+PS  K     TE         V P  + + 
Sbjct  387  YFDANDDISQYIDFDS---CGN---VPDQAPSNQKLLNGETEPQPMGGDHLVQPEPQPMG  440

Query  691  TEH-----KNDIASSSKPEP-TKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAA  536
             EH       D AS SK  P +K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A 
Sbjct  441  GEHLVQPEDTDDASLSKKMPESKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPAKEAM  500

Query  535  LRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSL  380
            LRLN+   +SSSVHVTAG+I+I D+T           K G  N++ S   SQ   + G+L
Sbjct  501  LRLNSGASSSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLSQNDGNSGNL  560

Query  379  EPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
             PV  G  LSG        GWF F+  WVL LS+S K+G++I  R
Sbjct  561  VPV--GGSLSGKTGCVVMRGWFLFMFLWVLFLSMSFKIGSYICTR  603


 Score = 64.7 bits (156),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = -1

Query  1100  QHPDELKPFDQPIH-DFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQ-FNDG  927
             Q+P++LK  D   H + D KPVK E   E S+      +N  LNEP +D T+  + F DG
Sbjct  301   QNPEDLKFVDLTEHYEADAKPVKDECFLEPSDGANPSVVNYSLNEPYLDATENNKPFGDG  360

Query  926   TFLETNDLSNPVEGNTSGFDMFD  858
              FLETNDLSNPVE +T+GFDM D
Sbjct  361   LFLETNDLSNPVE-STAGFDMLD  382



>ref|XP_011024333.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=558

 Score =   145 bits (366),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 131/212 (62%), Gaps = 23/212 (11%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+DA D  +++ FD    +G++  + +Q     +D    TE+    ++  ++T    D 
Sbjct  352  NFFDAVD--ENLSFDPSDILGSETAVSDQQLPPQEDVKGRTEELSTASQNLLETHGTIDP  409

Query  670  ASSS-KPEPTKL--GSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            +SS  KPE  K   G+DF++PFIKQAS  LGNIPAPPA ASE P KDAALRL+ A+  SS
Sbjct  410  SSSKQKPEGMKFDSGADFKYPFIKQASHRLGNIPAPPALASEFPSKDAALRLHPAS--SS  467

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH---GK-  359
            S++VTAG+I+I +++LG         K+GN NIILSF   Q    P SL P++    GK 
Sbjct  468  SINVTAGMIRIENMSLGGNEMQWSFGKNGNVNIILSFGLPQQG-GPASLVPMNSLFLGKT  526

Query  358  --MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              ++S GW Y + FWVLILS+S K GT I A+
Sbjct  527  ESVVSRGWLYLMFFWVLILSVSYKFGTCICAK  558


 Score = 37.7 bits (86),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = -1

Query  1037  KREYMGE-SSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE----GNTSG  873
             K+E+  E   N + + + N L +E  +D  D    ++G FLE NDLS PVE    G++S 
Sbjct  284   KKEHNAEPIINIVNAINANYLFDESYLDALDDLPQSEGFFLEANDLSKPVELETGGDSSD  343

Query  872   FDMFD  858
             F+M D
Sbjct  344   FNMVD  348



>ref|XP_006379522.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
 gb|ERP57319.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
Length=581

 Score =   135 bits (340),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 132/212 (62%), Gaps = 24/212 (11%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA D  ++M FD SDIF  +D  +  Q P   +D    T++ +   +K ++T H N 
Sbjct  376  NFFDADD--ENMSFDPSDIF-ASDTAVSNQQPPPQEDVKGGTDEVLKAIQKPLET-HGNV  431

Query  673  IASSSK--PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
              SSSK  PE  +  SDF++PFIKQAS MLG IPAPPA ASE P KDAALR    + +SS
Sbjct  432  GPSSSKQKPEAMEFDSDFKYPFIKQASHMLGKIPAPPALASEFPSKDAALR--LRSASSS  489

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVS---HGK-  359
            S+HVTAG+I+I +++LG         K+GN ++ILSF   Q    P S  P++    GK 
Sbjct  490  SIHVTAGVIRIENMSLGGNGTEWSFGKNGNVDVILSFGLPQQEGGPASWVPMTSLFSGKA  549

Query  358  --MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              ++S GW + + FWVLILS+S K+GT I A+
Sbjct  550  ESVVSRGWLFLMFFWVLILSVSYKIGTCICAK  581


 Score = 47.8 bits (112),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -1

Query  1055  FDPKPVKREYM-GESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE---  888
             ++   VK EY   E  N++ +  +N L +E  +D  +    ++G FLE NDLSNPVE   
Sbjct  302   YETDAVKNEYNNAEPMNNVNAVDVNYLFDESYLDALNNLPQSEGLFLEANDLSNPVEPET  361

Query  887   -GNTSGFDMFD  858
              G++SGFDM +
Sbjct  362   GGDSSGFDMLE  372



>ref|XP_002311983.2| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|EEE89350.2| NAC domain-containing protein 78 [Populus trichocarpa]
Length=568

 Score =   131 bits (330),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 126/206 (61%), Gaps = 25/206 (12%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFD-SDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA D  ++M FD SDIF  +D  +  Q P   +D    T++ +   +K ++T H N 
Sbjct  376  NFFDADD--ENMSFDPSDIF-ASDTAVSNQQPPPQEDVKGGTDEVLKAIQKPLET-HGNV  431

Query  673  IASSSK--PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
              SSSK  PE  +  SDF++PFIKQAS MLG IPAPPA ASE P KDAALR    + +SS
Sbjct  432  GPSSSKQKPEAMEFDSDFKYPFIKQASHMLGKIPAPPALASEFPSKDAALR--LRSASSS  489

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            S+HVTAG+I+I +++LG         K+GN ++ILSF   Q    P          ++S 
Sbjct  490  SIHVTAGVIRIENMSLGGNGTEWSFGKNGNVDVILSFGLPQQEGGPAK-------SVVSR  542

Query  346  GWFYFLLFWVLILSISVKVGTFIYAR  269
            GW + + FWVLILS+S K+GT I A+
Sbjct  543  GWLFLMFFWVLILSVSYKIGTCICAK  568


 Score = 47.8 bits (112),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -1

Query  1055  FDPKPVKREYM-GESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVE---  888
             ++   VK EY   E  N++ +  +N L +E  +D  +    ++G FLE NDLSNPVE   
Sbjct  302   YETDAVKNEYNNAEPMNNVNAVDVNYLFDESYLDALNNLPQSEGLFLEANDLSNPVEPET  361

Query  887   -GNTSGFDMFD  858
              G++SGFDM +
Sbjct  362   GGDSSGFDMLE  372



>gb|AIA57516.1| NAC domain-containing protein [Boehmeria nivea]
Length=631

 Score =   144 bits (362),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 131/210 (62%), Gaps = 21/210 (10%)
 Frame = -2

Query  847  FYDAKD-DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLP-NEKAVDTEHKN-  677
            ++DA++ + Q    DS   +G +  + EQ P        T E  +LP   K V   H N 
Sbjct  421  YFDAEEGNIQFPALDSSQNVGVENSVTEQEPQK----LVTGEAELLPMGTKQVVEAHDNI  476

Query  676  DIASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             +ASSS  K E TK  SDF+HP +KQASQMLG+IPAPPAFASE P K+AALRL++A QAS
Sbjct  477  HVASSSNKKAEVTKSESDFKHPLLKQASQMLGSIPAPPAFASEFPTKEAALRLHSAAQAS  536

Query  505  SSVHVTAGLIQISDLTLG--------SKHGNYNIILS-FDFSQGAQSPGSLEPVS--HGK  359
            SSVHVTAG+I+I +L            K+G+ +++LS +   Q   S  ++ P+S   G 
Sbjct  537  SSVHVTAGMIRIRNLNPEGNAMDWSFGKNGDVDLLLSYYSMPQADVSTSAMVPLSGKTGC  596

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            +++ GWF F+  WVLI+S+S KVG+F+Y R
Sbjct  597  VVTKGWFMFMFIWVLIMSVSFKVGSFMYTR  626


 Score = 33.9 bits (76),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 35/73 (48%), Gaps = 2/73 (3%)
 Frame = -1

Query  1076  FDQPIHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSN  897
               Q  +  DP+PVK EY  + SN     + +    +  ++ T+   F +G +L  +DL  
Sbjct  346   LSQEQYVMDPQPVKEEYFAQPSNEGNPINADYAFGDQFLNDTETASFCEGLYL--DDLLK  403

Query  896   PVEGNTSGFDMFD  858
             P+E +   FD  D
Sbjct  404   PIEEDPIEFDQLD  416



>ref|XP_011469276.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=596

 Score =   122 bits (305),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 113/210 (54%), Gaps = 19/210 (9%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDI-FIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            ++DA DD    + FDS    +GN+  +  +     K      E     ++  V+    ND
Sbjct  389  YFDADDDISQYIDFDSCCEMLGNENTVSSEPLVEQKSVMGEMEPLSTGSQHLVEAHDVND  448

Query  673  IASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
             +SS +    + GSD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   +SSSV
Sbjct  449  ASSSKQKPDMQFGSDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVASSSSV  508

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVS------HGK  359
            H  AG+I+I D+T           K G  N++ S    Q   +  +L P+        G 
Sbjct  509  H--AGMIRIRDITSSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVSGKTGS  566

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            ++  GW  F+ FWVL +SIS K+G++IYA+
Sbjct  567  VVMRGWVLFMFFWVLFISISFKMGSYIYAK  596


 Score = 54.3 bits (129),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = -1

Query  1100  QHPDELKPFDQP-IHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             ++ D  K F+ P  ++ + K VK E  GE S++M    ++  LN+P ++  +   F DG 
Sbjct  300   EYHDNQKFFNLPEYYETETKVVKDEDYGEPSHNMNPVDVSYSLNDPFLNAAENPTFGDGQ  359

Query  923   FLETNDLS---NPVEGNTSGFDMFD  858
             FLETNDLS   NPVE N  GFDM D
Sbjct  360   FLETNDLSIPANPVEPNPEGFDMLD  384



>ref|XP_011469274.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=597

 Score =   119 bits (297),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 116/211 (55%), Gaps = 20/211 (9%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDI-FIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            ++DA DD    + FDS    +GN+  +  +     K +     + +    + +   H  +
Sbjct  389  YFDADDDISQYIDFDSCCEMLGNENTVSSEPLVEQKQSVMGEMEPLSTGSQHLVEAHDVN  448

Query  673  IASSSKPEP-TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
             ASSSK +P  + GSD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   +SSS
Sbjct  449  DASSSKQKPDMQFGSDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVASSSS  508

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVS------HG  362
            VH  AG+I+I D+T           K G  N++ S    Q   +  +L P+        G
Sbjct  509  VH--AGMIRIRDITSSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVSGKTG  566

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ++  GW  F+ FWVL +SIS K+G++IYA+
Sbjct  567  SVVMRGWVLFMFFWVLFISISFKMGSYIYAK  597


 Score = 54.3 bits (129),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = -1

Query  1100  QHPDELKPFDQP-IHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGT  924
             ++ D  K F+ P  ++ + K VK E  GE S++M    ++  LN+P ++  +   F DG 
Sbjct  300   EYHDNQKFFNLPEYYETETKVVKDEDYGEPSHNMNPVDVSYSLNDPFLNAAENPTFGDGQ  359

Query  923   FLETNDLS---NPVEGNTSGFDMFD  858
             FLETNDLS   NPVE N  GFDM D
Sbjct  360   FLETNDLSIPANPVEPNPEGFDMLD  384



>gb|KJB60503.1| hypothetical protein B456_009G309000 [Gossypium raimondii]
Length=591

 Score =   128 bits (321),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 126/210 (60%), Gaps = 21/210 (10%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            FYDA D  Q + FD D  +G++  + +Q P  +    + TEQ +  +E     EH N  A
Sbjct  383  FYDADD--QSLAFDCDEIVGSEIPVSDQEPLTETHTNEGTEQDLNASEHV--EEHGNSDA  438

Query  667  SSSKPE--PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSV  497
            SSSK E   T+     ++PF+K+AS MLG++PAPPAFASE  PKDAA++LN+A+ ASSSV
Sbjct  439  SSSKQELEATEFDLGTKYPFMKRASHMLGSLPAPPAFASEFPPKDAAIKLNSASHASSSV  498

Query  496  HVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH------GK  359
            HV AG+I+I+D T           K+GN NI+LSF   QG     S  P++       G 
Sbjct  499  HVMAGMIRITDTTSSGNRLDWSYGKNGNLNIVLSFSLPQGDIDSSSFLPMASLLSGKTGP  558

Query  358  MLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            + + GWF+ +LF VLI+S SVK+GT    R
Sbjct  559  VSARGWFFLMLFSVLIISASVKIGTCFCTR  588


 Score = 43.9 bits (102),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 2/67 (3%)
 Frame = -1

Query  1046  KPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFD  867
             KPVK EY+ E   ++TS   N +L  P +D T     ND  FLE ND SNP+   +  FD
Sbjct  319   KPVKDEYVLEPIENITS--ANYVLGNPYLDHTSYLPTNDELFLEANDFSNPIYPESELFD  376

Query  866   MFDFX*F  846
             + ++  F
Sbjct  377   INEYLLF  383



>gb|AGC27316.1| NAC domain protein 13 [Gossypium hirsutum]
Length=591

 Score =   124 bits (312),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 125/209 (60%), Gaps = 20/209 (10%)
 Frame = -2

Query  844  YDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIAS  665
            +D  DD Q + FD D  +G++  +  Q P  +    + TEQ +   E     EH N  AS
Sbjct  383  FDDADD-QSLAFDYDEIVGSEIPVSGQEPLTETHTNEGTEQDLNAGEHV--EEHGNSDAS  439

Query  664  SSKPE--PTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVH  494
            SSK E   T+     ++PF+K+AS MLG++PAPPAFASE  PKDAA++LN+A+ ASSSVH
Sbjct  440  SSKQELEATEFDLGTKYPFMKRASHMLGSLPAPPAFASEFPPKDAAIKLNSASHASSSVH  499

Query  493  VTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH------GKM  356
            V AG+I+I+D T           K+GN NI+LSF   QG  +  S  P++       G +
Sbjct  500  VMAGMIRITDTTSSGNRLDWSYGKNGNLNIVLSFSLPQGDINSSSFLPMASLLTGKTGPV  559

Query  355  LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            L+ GWF+ +LF VLI+S SVK+GT    R
Sbjct  560  LARGWFFLMLFSVLIISASVKIGTCFCTR  588


 Score = 46.6 bits (109),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 5/84 (6%)
 Frame = -1

Query  1088  ELKPFDQPIHDF---DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFL  918
             EL   D P  D    + KPVK EY+ E   ++TS   N +L +P +D T     ND  FL
Sbjct  302   ELVVADSPEQDLIATNGKPVKDEYVLEPIENITS--ANYVLGDPYLDVTSYLPTNDELFL  359

Query  917   ETNDLSNPVEGNTSGFDMFDFX*F  846
             E ND SNP+   +  FD+ ++  F
Sbjct  360   EANDFSNPIYPESELFDINEYLSF  383



>ref|XP_009346099.1| PREDICTED: NAC domain-containing protein 78-like [Pyrus x bretschneideri]
Length=230

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 126/225 (56%), Gaps = 34/225 (15%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACD-TTE------QAVLPNEKAVD  692
            ++DA DD    + FDS   +G + ++ +++P+  K   +  TE      + V P  + + 
Sbjct  8    YFDANDDISQYIDFDSCGMMGVENYVPDEAPADQKQLVNGETEPQPMGGEHVQPEPQPMG  67

Query  691  TEH------KNDIASSSKPEPTKLGSDFQHPFIKQASQM-LGNIPAPPAFASEIP-KDAA  536
             EH       +D +SS K    K  SD  +PFIK+AS M LG+IPAPPAFASE P K+A 
Sbjct  68   GEHLVQPVDTDDASSSKKMAEFKFESDGNYPFIKKASHMMLGSIPAPPAFASEFPGKEAM  127

Query  535  LRLNAATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSL  380
             RLN+   +SSSVHVTAG+I+I D+T           K G  N++ S    Q   + G+L
Sbjct  128  RRLNSGAASSSSVHVTAGMIRIRDITSSDNRMDWSFGKDGVVNLVFSVQLPQNDGNSGNL  187

Query  379  EPVSHGKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
             PV  G  LSG        GWF F+ FWVL LS+S+K+G++IY R
Sbjct  188  VPV--GGSLSGKTGCVVMRGWFLFMFFWVLFLSMSLKIGSYIYTR  230



>ref|XP_010552948.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=568

 Score =   127 bits (320),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 124/205 (60%), Gaps = 18/205 (9%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+D  D+F   L F++   +G +  +       +K   +  E+    ++  ++ + K++ 
Sbjct  370  FFDGDDEFTPQLTFNASQLVGTEGSVPHVEGITEKAVPEVLEKEASTSKHVMEEKDKSEA  429

Query  670  ASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            + S + P+  K  SD ++PF+K+AS+MLG IPAPPAFASE P K AA+ L++A Q+S SV
Sbjct  430  SCSRQDPDALKFESDSKYPFLKKASEMLGAIPAPPAFASEFPTKVAAMHLHSAAQSSGSV  489

Query  496  HVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGG  344
            HVTAG+I+IS++T+ +         K+G+ N++LS    +  ++ G L     G+ LS  
Sbjct  490  HVTAGMIRISNMTIAAGSGMDWSYGKNGSLNVVLSLGLVEQTET-GKL-----GRTLSRA  543

Query  343  WFYFLLFWVLILSISVKVGTFIYAR  269
               F+ FWVLILS+S KVGTF+ AR
Sbjct  544  MLIFVCFWVLILSVSFKVGTFVSAR  568


 Score = 35.4 bits (80),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N LL EPLMD  +    NDG +LET+DLS
Sbjct  327  NYLLQEPLMDPDNNLPLNDGLYLETDDLS  355



>gb|AAM34772.1|AF509872_1 nam-like protein 9 [Petunia x hybrida]
Length=462

 Score = 95.1 bits (235),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 83/124 (67%), Gaps = 7/124 (6%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDS---DIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKN  677
            +++A   F++M FD     + IGND  + +Q+   +K+  +  +Q   P+++    EHKN
Sbjct  337  YFEAMITFRNMGFDGFDPSVLIGNDGHVSDQASLLEKNIGEVAQQVTAPSQQLA--EHKN  394

Query  676  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
             IASSS  +PTK + +D Q+ F+K+ASQMLG+IPAPPAFASE P KDAAL LN+   +++
Sbjct  395  TIASSSMEKPTKFVTADDQYRFMKRASQMLGSIPAPPAFASEFPTKDAALHLNSMPHSAN  454

Query  502  SVHV  491
            SV V
Sbjct  455  SVRV  458


 Score = 67.8 bits (164),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -1

Query  1100  QHPDELKPFDQPIHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTF  921
             Q  +ELKPFD  +      P++ EY+GES   + S  ++ LLN PL D++D  QFNDG F
Sbjct  252   QQQNELKPFDPAVQHTANNPLEHEYIGESGKQLNSGFVDYLLNGPLDDSSDALQFNDGAF  311

Query  920   LETNDLSNPVEGNT  879
             LE NDLS  ++ +T
Sbjct  312   LEANDLSTRLKFDT  325



>ref|XP_010543581.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=567

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 119/206 (58%), Gaps = 17/206 (8%)
 Frame = -2

Query  847  FYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+D  D+    L FD+   +G ++ +       +K   +  E+     E  V+ + K D 
Sbjct  366  FFDIDDEITAQLSFDASQLVGTEDSVPRLEDLTEKAEREGLEKETTTCEHLVEGKDK-DE  424

Query  670  ASSSK--PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            AS SK  P+ T   SD ++PF+K+AS MLG IPAPPAFASE P KDAA+RL++A Q+S S
Sbjct  425  ASCSKHDPDATPFESDSKYPFLKKASHMLGGIPAPPAFASEFPTKDAAIRLHSAAQSSGS  484

Query  499  VHVTAGLIQISDLTLG---------SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            VHVTAG+I+IS +T+           K+GN N++ S    QGA +  S +    G  LS 
Sbjct  485  VHVTAGMIRISSMTVAEGSGMDWSYGKNGNLNVVFSLGLVQGADTGLSGKT---GATLSR  541

Query  346  GWFYFLLFWVLILSISVKVGTFIYAR  269
                 + FWVLILS+S KVGT + AR
Sbjct  542  AMLILVCFWVLILSVSFKVGTIVSAR  567



>ref|XP_010032131.1| PREDICTED: NAC domain-containing protein 78 [Eucalyptus grandis]
 gb|KCW51525.1| hypothetical protein EUGRSUZ_J01038 [Eucalyptus grandis]
Length=538

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 96/148 (65%), Gaps = 12/148 (8%)
 Frame = -2

Query  676  DIASSSKP--EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
            D AS+SKP  +     S  ++PF+K ASQMLG+ PAPPAFA+E P KDAALRLN+A Q S
Sbjct  391  DCASTSKPHLDSKDPESSIKYPFMKAASQMLGSFPAPPAFAAEFPVKDAALRLNSAAQPS  450

Query  505  SSVHVTAGLIQISDLTL-GS-------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLS  350
            SSVHVTAG+I+I ++ L GS       K+G  NI+LSF  SQ   SP      S      
Sbjct  451  SSVHVTAGMIRIRNMNLVGSGMDWSIGKNGELNIVLSFGMSQADISPTDSGLRSRKTPSV  510

Query  349  GGWFY-FLLFWVLILSISVKVGTFIYAR  269
              W + FL FW+++LS+ VKVGT IY+R
Sbjct  511  ASWTWCFLFFWIILLSVGVKVGTSIYSR  538



>ref|XP_011655859.1| PREDICTED: NAC domain-containing protein 78 [Cucumis sativus]
 gb|KGN52230.1| hypothetical protein Csa_5G622470 [Cucumis sativus]
Length=562

 Score =   110 bits (276),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 112/213 (53%), Gaps = 28/213 (13%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDI  671
            F+DA  D  DM FD        E LG  SP  D+ +A     +    +++  D  H N  
Sbjct  358  FFDADGDNVDMSFDPS------EILGSGSPIPDQTEAVGGATEHASASKQTADLRHDNGA  411

Query  670  ASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  500
            +SSS  +PE  K  SD ++PF+K  S MLG+IPAP  FAS+   KDAA+ LN+A QASSS
Sbjct  412  SSSSMQRPEDPKSESDIKYPFLKHTSHMLGSIPAP--FASQFTSKDAAIHLNSAPQASSS  469

Query  499  VHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGG  344
            V VTAG++ I ++ L          K+ + NII  +   +G      L P + G   S  
Sbjct  470  VRVTAGMLVIRNIALNGYEVNNMYGKNSDLNIIYLYGIVEGNIDSSQLLPNAAGVNSSKS  529

Query  343  --------WFYFLLFWVLILSISVKVGTFIYAR  269
                     ++F+LFWVLILS S KV   I++R
Sbjct  530  EPLISRYFLYFFILFWVLILSASFKVARCIHSR  562


 Score = 45.1 bits (105),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 17/93 (18%)
 Frame = -1

Query  1094  PDELKPFDQP----IHDFDPKPVKREYMGESSN---SMTSESLNC-------LLNEPLMD  957
             PD  K F  P    +HD   + VK EY+ ESSN   +  ++ +N        +LNE    
Sbjct  264   PDGQKFFVLPDECGLHD---RLVKHEYLAESSNDAGANAADEVNAGDMDGRYVLNEAFYS  320

Query  956   TTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFD  858
             T+D   F+D   LE N+LSNP E + + FD+ +
Sbjct  321   TSDNLSFSDELLLEPNELSNPTESDPADFDVLE  353



>dbj|BAJ34165.1| unnamed protein product [Thellungiella halophila]
Length=501

 Score =   124 bits (312),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 121/205 (59%), Gaps = 13/205 (6%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVD-TEHKND  674
            NF+D  +D Q++  D    +G+++ L +Q       + +  E+ V   ++AV+ TE+   
Sbjct  299  NFFD-DEDTQNLTLDVSQLMGSEDALPDQEGLDQNPSPEEVEKEVAEGKEAVEKTENGEG  357

Query  673  IASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSV  497
             +S  + + T   S  ++PF+K+AS M G IPAPP+FAS+   KDAA+RL++A Q+S SV
Sbjct  358  SSSKQEADVTDFESASKYPFLKKASHMFGAIPAPPSFASQFQSKDAAIRLHSA-QSSGSV  416

Query  496  HVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGG  344
            HVTAG+I+IS++TL +         K+GN N++LSF   Q     GS    + G   +  
Sbjct  417  HVTAGMIRISNMTLAADSGMGWSYDKNGNLNVVLSFGLVQRDDEMGSSGSKTGGTTATRA  476

Query  343  WFYFLLFWVLILSISVKVGTFIYAR  269
               F+  WVL+LS+S K+GT + AR
Sbjct  477  MLIFMCLWVLLLSVSFKIGTMVSAR  501


 Score = 31.2 bits (69),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*F  846
            N L +EP +D  +    +DG +LETNDLS+   G   GF+  D+  F
Sbjct  257  NYLPDEPFIDPNNNLPLSDGLYLETNDLSS---GLQDGFNFEDYLNF  300



>ref|XP_006398899.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
 gb|ESQ40352.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
Length=572

 Score =   124 bits (311),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 121/205 (59%), Gaps = 13/205 (6%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVD-TEHKND  674
            NF+D  +D Q++  D    +G+++ L +Q       + +  E+ V   ++AV+ TE+   
Sbjct  370  NFFD-DEDTQNLTLDVSQLMGSEDALPDQEGLDQNPSPEEVEKEVAEGKEAVEKTENGEG  428

Query  673  IASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSV  497
             +S  + + T   S  ++PF+K+AS M G IPAPP+FAS+   KDAA+RL++A Q+S SV
Sbjct  429  SSSKQEADVTDFESASKYPFLKKASHMFGAIPAPPSFASQFQSKDAAIRLHSA-QSSGSV  487

Query  496  HVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGG  344
            HVTAG+I+IS++TL +         K+GN N++LSF   Q     GS    + G   +  
Sbjct  488  HVTAGMIRISNMTLAADSGMGWSYDKNGNLNVVLSFGLVQRDDEMGSSGSKTGGTTATRA  547

Query  343  WFYFLLFWVLILSISVKVGTFIYAR  269
               F+  WVL+LS+S K+GT + AR
Sbjct  548  MLIFMCLWVLLLSVSFKIGTMVSAR  572


 Score = 31.2 bits (69),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*FL  843
            N L +EP +D  +    +DG +LETNDLS+   G   GF+  D+  F 
Sbjct  328  NYLPDEPFIDPNNNLPLSDGLYLETNDLSS---GLQDGFNFEDYLNFF  372



>ref|XP_008446811.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis melo]
Length=561

 Score =   108 bits (269),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 112/213 (53%), Gaps = 29/213 (14%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDAC--DTTEQAVLPNEKAVDTEHKND  674
            F+DA  D  DM FD        E LG  SP  D+       TE A    + A D  H N+
Sbjct  358  FFDADGDNADMSFDPS------EILGSGSPIPDQTEVVGGATEHASTSKQTA-DLHHDNE  410

Query  673  IASSS--KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
             +SSS  +PE  K   D ++PF+K  S MLG+IPAP  FAS+   KDAA+ LN+A QASS
Sbjct  411  ASSSSMQRPEDPKSEPDIKYPFLKHTSHMLGSIPAP--FASQFTSKDAAIHLNSAPQASS  468

Query  502  SVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEP-----VSHG  362
            SV VTAG++ I ++ L          K+ + N+I  +   +G      L P      S  
Sbjct  469  SVRVTAGMLIIRNIALNGYEVNNMYGKNSDLNVIYLYGIVEGNIDSSQLLPNAGVNSSKS  528

Query  361  KMLSGGWF--YFLLFWVLILSISVKVGTFIYAR  269
            + L   +F  +F+LFWVLILS S KV   I++R
Sbjct  529  EPLISRYFLYFFILFWVLILSASFKVARCIHSR  561


 Score = 47.4 bits (111),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 17/93 (18%)
 Frame = -1

Query  1094  PDELKPFDQP----IHDFDPKPVKREYMGESSNSMTSESLN----------CLLNEPLMD  957
             PD  K F  P    +HD   + VK EY+ ESSN   + + +           +LNEP   
Sbjct  264   PDGQKFFVLPDECGLHD---RLVKHEYLAESSNDAGANAADEVDAGDVDGRYVLNEPFYS  320

Query  956   TTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFD  858
             T+D   F+D   LE N+LSNP E + + FD+ +
Sbjct  321   TSDNLSFSDELLLEPNELSNPTESDPADFDVLE  353



>ref|XP_006297351.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
 gb|EOA30249.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
Length=558

 Score =   125 bits (313),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 119/201 (59%), Gaps = 15/201 (7%)
 Frame = -2

Query  847  FYDAKDD-FQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+D  D+  Q++ FD    +GN++   +Q     +   +  ++     +K V  E + D 
Sbjct  365  FFDEDDENAQNLTFDPSQLMGNEDAFVDQEELFQEIETEELKKEETIGDKQVVEEKEKDE  424

Query  670  ASSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            AS SK    + T+   D+++PF+K+AS MLG IPAPPAFASE P KDAA+RLNA  Q+S 
Sbjct  425  ASCSKQFDADATEFEPDYKYPFLKKASDMLGAIPAPPAFASEFPTKDAAIRLNAG-QSSG  483

Query  502  SVHVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYF  332
            SVHVTAG+I ISD  +G    K+ N ++ILS+ F Q   + G L     G  L+     F
Sbjct  484  SVHVTAGMITISDSNMGWSYDKNVNRDLILSYHFVQ-ENASGKL-----GNSLTRAMLIF  537

Query  331  LLFWVLILSISVKVGTFIYAR  269
            + FW+L+LS+S KV T + +R
Sbjct  538  MCFWILLLSVSFKVSTLVASR  558


 Score = 30.4 bits (67),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (61%), Gaps = 1/38 (3%)
 Frame = -1

Query  1010  NSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSN  897
             N ++ ES N L+ +  +D       NDG +LETNDLS+
Sbjct  315   NDLSVES-NYLIGDAFLDPNSNLLHNDGLYLETNDLSS  351



>ref|XP_006407560.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
 gb|ESQ49013.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
Length=553

 Score =   125 bits (313),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 117/201 (58%), Gaps = 15/201 (7%)
 Frame = -2

Query  847  FYDAKDD-FQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+D  D+  Q++ FD    +G D+ + +Q    +K   +  E+      K +  E + D 
Sbjct  360  FFDEDDENAQNLTFDPSQLMGTDDVIADQEEPLEKAETEKLEKEESSGGKQLMGEKEMDA  419

Query  670  ASSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            AS  K    + T+L  D++ PF+K+AS MLG IP+PPAFASE P KDAA+RL+AA Q+S 
Sbjct  420  ASCMKLVDADATELEPDYKDPFLKKASHMLGAIPSPPAFASEFPTKDAAIRLHAA-QSSG  478

Query  502  SVHVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYF  332
            SVHVTAGLI ISD  +G    K+GN+++I SF   Q      S   ++   ++S      
Sbjct  479  SVHVTAGLITISDSYMGWSYRKNGNFDLIFSFGLVQENGIEKSGNSLTRAMLMS------  532

Query  331  LLFWVLILSISVKVGTFIYAR  269
            + FW L+LS+S KV T + +R
Sbjct  533  MCFWFLVLSVSFKVSTLVSSR  553


 Score = 28.9 bits (63),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 24/48 (50%), Gaps = 3/48 (6%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*FL  843
            N    E  +D +     NDG +LETNDLS+  +    GFD  D+  F 
Sbjct  317  NYFTGEAFLDPSSNLPQNDGLYLETNDLSSTQQ---DGFDFEDYLTFF  361



>gb|EYU32441.1| hypothetical protein MIMGU_mgv1a002437mg [Erythranthe guttata]
Length=675

 Score = 99.8 bits (247),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 106/201 (53%), Gaps = 34/201 (17%)
 Frame = -2

Query  844  YDAKDDFQDMLF--DSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            +DA DD   + F  DS    G D  + EQ     K+  + T QA+LPN + +   + N++
Sbjct  498  FDANDD-NSLYFANDSASMFGTDGLVSEQPLLPHKEMTEETAQAILPNGQHIANNNNNEV  556

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVH  494
              S K E  K  S   +PFIKQAS++LGN+PAPPAFA+E P K+A LRLN          
Sbjct  557  LPSDKQESAKQYSGLDYPFIKQASKILGNLPAPPAFAAEFPSKNAILRLN----------  606

Query  493  VTAGLIQISDLTLGSKHGNYNIILSFDFSQGAQSPGSLEP---VSHGK----MLSGGWFY  335
                         G+K  N+N+I+SF +S+G     +LE    +  GK     +S GW +
Sbjct  607  -------------GAKDENFNVIVSFGYSRGNDGSSNLESSVRIQTGKAASSAMSRGWLF  653

Query  334  FLLFWVLILSISVKVGTFIYA  272
            F+ F+ +  S++ K GT++ A
Sbjct  654  FVFFFFVFFSMTFKYGTYLCA  674


 Score = 53.9 bits (128),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -1

Query  1052  DPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSG  873
             D + VK+E  GE S S  SE L+ LL+EP  D++D   + +  F+E ND  +PVE + S 
Sbjct  429   DMELVKQESYGECSKSSNSEELDFLLDEPFFDSSDNLLYGNEGFIEANDFLSPVENDNSA  488

Query  872   FDMFD  858
             FDM +
Sbjct  489   FDMLN  493



>gb|KFK38438.1| hypothetical protein AALP_AA3G113300 [Arabis alpina]
Length=558

 Score =   120 bits (301),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 114/203 (56%), Gaps = 19/203 (9%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+D  D  +++ FD    IG ++ + +Q     K      E+      K V  E + D A
Sbjct  365  FFDEDD--ENLTFDPSQLIGTEDVIPDQEELFQKAETKELEKEEASGGKQVVEEKEKDEA  422

Query  667  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            S SK      T+   D+++ F+K+AS MLG IPAPPAFASE P KDA+++L+AA Q+S S
Sbjct  423  SCSKQVDAYATEFEPDYKYSFLKKASNMLGAIPAPPAFASEFPAKDASIQLHAA-QSSGS  481

Query  499  VHVTAGLIQISDLTLG-----SKHGNYNIILSFDFSQG-AQSPGSLEPVSHGKMLSGGWF  338
            VHVTAG+I ISD           +GN  +ILSF  +QG A S  S      G  L+   F
Sbjct  482  VHVTAGMITISDSNTSWSYGKDGNGNLELILSFGLAQGNAASEKS------GNSLTRAMF  535

Query  337  YFLLFWVLILSISVKVGTFIYAR  269
             F+ FWVL+LSIS KV T + +R
Sbjct  536  MFMCFWVLVLSISFKVSTLVSSR  558


 Score = 29.3 bits (64),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 28/63 (44%), Gaps = 12/63 (19%)
 Frame = -1

Query  1031  EYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX  852
             EY GES         N    E  +D  +    NDG FLETNDL +  +    GFD  D+ 
Sbjct  316   EYPGES---------NYFTGEAFLDPNNSLLQNDGLFLETNDLGSTQQ---DGFDYEDYL  363

Query  851   *FL  843
              F 
Sbjct  364   TFF  366



>ref|XP_010486664.1| PREDICTED: NAC domain-containing protein 78 [Camelina sativa]
Length=555

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 105/187 (56%), Gaps = 26/187 (14%)
 Frame = -2

Query  817  MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---PEP  647
            ++ D D+F+  +E   E     DK+     +Q V   EK        D AS SK    + 
Sbjct  385  LMGDEDVFVDQEELFQE----VDKEETTGDKQVVEEKEK--------DEASCSKQVDADA  432

Query  646  TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQI  470
            T+   D+++PF+K+AS MLG IPAPPAFASE P K AA+RLNA  Q+S SVHVTAG+I I
Sbjct  433  TEFEPDYKYPFLKKASHMLGAIPAPPAFASEFPTKAAAIRLNAG-QSSGSVHVTAGMITI  491

Query  469  SDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSIS  299
            SD  +G    K  N  +ILS+   Q   + G L     G  L+     F+ FWVL+LS+S
Sbjct  492  SDSNMGWSYDKIANRELILSYRLVQ-ENASGKL-----GNSLTRAMLIFMCFWVLLLSVS  545

Query  298  VKVGTFI  278
             KV T +
Sbjct  546  FKVSTLV  552



>ref|XP_002532627.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29758.1| conserved hypothetical protein [Ricinus communis]
Length=514

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 16/126 (13%)
 Frame = -2

Query  610  KQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLGS-----  449
            ++AS MLG+IPAPPAFASE P K  AL+LN A  +SSS+ VTAG+I+I  +T GS     
Sbjct  387  EKASHMLGSIPAPPAFASEFPLKGTALQLNGAP-SSSSIRVTAGMIRIESITFGSDGMDW  445

Query  448  ---KHGNYNIILSFDFSQGAQSPGSLEPVSH---GK---MLSGGWFYFLLFWVLILSISV  296
               K+GN NI+LSF  SQG  SP    P  +   GK   ++S GWF+ + FWVLILS+S 
Sbjct  446  SFGKNGNVNIVLSFVMSQGNVSPAGSAPAGNSFSGKTWSLVSRGWFFLMFFWVLILSVSY  505

Query  295  KVGTFI  278
            K+GT+I
Sbjct  506  KIGTYI  511


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = -1

Query  1061  HDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGN  882
             ++ D K V+ EY+ ESSN++ +   N LL+EP +D TD   FN+G FLE NDLSNPVE  
Sbjct  281   YEIDAKSVRHEYIAESSNNVDATDDNYLLDEPFLDATDNPPFNEGLFLEANDLSNPVEPE  340

Query  881   TSG----FDMFD  858
             T+G    F+M D
Sbjct  341   TAGDSTIFEMVD  352



>ref|XP_010423584.1| PREDICTED: NAC domain-containing protein 78 isoform X3 [Camelina 
sativa]
Length=490

 Score =   111 bits (277),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 30/211 (14%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ + +
Sbjct  293  NFEDYLNDFN---FDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKER  344

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S
Sbjct  345  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSS  403

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ---GAQSPGSLEPVSHG  362
             SVHVTAG+I+IS++TL +         K+GN N++LSF   Q   G  + GS    +  
Sbjct  404  GSVHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDGLNASGSKTGTTET  463

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            + +      F+  WVL+LS+S K+GT + AR
Sbjct  464  RAM----LIFMCLWVLLLSVSFKIGTLVSAR  490


 Score = 33.1 bits (74),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  257  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  285



>ref|XP_010464726.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=556

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 107/190 (56%), Gaps = 25/190 (13%)
 Frame = -2

Query  817  MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK---PEP  647
            ++ D D+F+  +E   E     DK+     +Q V   EK        D AS SK    + 
Sbjct  385  LMGDEDVFVDQEELFQE----VDKEETTGDKQVVEAKEK--------DEASCSKQVDADA  432

Query  646  TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQI  470
            T+   D+++PF+K+AS MLG IPAPPAFASE P K AA+RLNA  Q+S SVHVTAG+I I
Sbjct  433  TEFEPDYKYPFLKKASHMLGAIPAPPAFASEFPTKAAAIRLNAG-QSSGSVHVTAGMITI  491

Query  469  SDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSIS  299
            SD  +G    K+ N ++IL +   Q   + G L        L+     F+ FWVL+LS+S
Sbjct  492  SDSNMGWSYDKNANRDLILFYRLVQ-ENASGKL----GNSFLTRAMLIFICFWVLLLSVS  546

Query  298  VKVGTFIYAR  269
             KV T + +R
Sbjct  547  FKVSTLVTSR  556



>ref|XP_004307017.1| PREDICTED: NAC domain-containing protein 78 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=559

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 103/191 (54%), Gaps = 17/191 (9%)
 Frame = -2

Query  796  FIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHP  617
             +GN+  +  +     K      E     ++  V+    ND +SS +    + GSD + P
Sbjct  371  MLGNENTVSSEPLVEQKSVMGEMEPLSTGSQHLVEAHDVNDASSSKQKPDMQFGSDGKFP  430

Query  616  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG----  452
            FI +AS MLG+IPAPPAFASE P KDA LRLN+   +SSSVH  AG+I+I D+T      
Sbjct  431  FITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVASSSSVH--AGMIRIRDITSSDNRV  488

Query  451  ----SKHGNYNIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  302
                 K G  N++ S    Q   +  +L P+        G ++  GW  F+ FWVL +SI
Sbjct  489  EWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVSGKTGSVVMRGWVLFMFFWVLFISI  548

Query  301  SVKVGTFIYAR  269
            S K+G++IYA+
Sbjct  549  SFKMGSYIYAK  559



>ref|XP_010423582.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Camelina 
sativa]
Length=563

 Score =   110 bits (276),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 30/211 (14%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ + +
Sbjct  366  NFEDYLNDFN---FDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKER  417

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S
Sbjct  418  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSS  476

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ---GAQSPGSLEPVSHG  362
             SVHVTAG+I+IS++TL +         K+GN N++LSF   Q   G  + GS    +  
Sbjct  477  GSVHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDGLNASGSKTGTTET  536

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            + +      F+  WVL+LS+S K+GT + AR
Sbjct  537  RAM----LIFMCLWVLLLSVSFKIGTLVSAR  563


 Score = 33.1 bits (74),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  330  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  358



>ref|XP_010423583.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Camelina 
sativa]
Length=562

 Score =   110 bits (276),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 30/211 (14%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ + +
Sbjct  365  NFEDYLNDFN---FDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKER  416

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S
Sbjct  417  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSS  475

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ---GAQSPGSLEPVSHG  362
             SVHVTAG+I+IS++TL +         K+GN N++LSF   Q   G  + GS    +  
Sbjct  476  GSVHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDGLNASGSKTGTTET  535

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            + +      F+  WVL+LS+S K+GT + AR
Sbjct  536  RAM----LIFMCLWVLLLSVSFKIGTLVSAR  562


 Score = 33.1 bits (74),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  329  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  357



>ref|XP_010452336.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
Length=563

 Score =   110 bits (274),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 117/208 (56%), Gaps = 24/208 (12%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +  
Sbjct  366  NFEDYLNDFN---FDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKES  417

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S
Sbjct  418  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSS  476

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKML  353
             SVHVTAG+I+IS++TL +         K+GN N++LSF   Q    P +      G   
Sbjct  477  GSVHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDEPNA-SGSKTGTTE  535

Query  352  SGGWFYFLLFWVLILSISVKVGTFIYAR  269
            +     F+  WVL+LS+S K+GT + AR
Sbjct  536  TRAMLIFMFLWVLVLSVSFKIGTMVSAR  563


 Score = 33.5 bits (75),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  330  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  358



>ref|XP_010452337.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=562

 Score =   110 bits (274),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 117/208 (56%), Gaps = 24/208 (12%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +  
Sbjct  365  NFEDYLNDFN---FDDDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKES  416

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++A Q+S
Sbjct  417  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHSA-QSS  475

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKML  353
             SVHVTAG+I+IS++TL +         K+GN N++LSF   Q    P +      G   
Sbjct  476  GSVHVTAGMIRISNMTLAADSSMGWAYDKNGNLNVVLSFGVVQRDDEPNA-SGSKTGTTE  534

Query  352  SGGWFYFLLFWVLILSISVKVGTFIYAR  269
            +     F+  WVL+LS+S K+GT + AR
Sbjct  535  TRAMLIFMFLWVLVLSVSFKIGTMVSAR  562


 Score = 33.5 bits (75),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  329  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  357



>gb|AGV29480.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=367

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 93/153 (61%), Gaps = 23/153 (15%)
 Frame = -2

Query  676  DIASSSKP--EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
            D ASSSKP  E  K   D  +PFI   ++MLGNIPAPPAFA+E P K+ A RLNAA   S
Sbjct  221  DDASSSKPVVEVQKSKRDLVYPFI---NRMLGNIPAPPAFAAEFPAKNVAARLNAA---S  274

Query  505  SSVHVTAGLIQISDLTLGS--------KHGNYNIILSFDFSQGAQSPGSLEPVSH---GK  359
             SV VT G+++I + T           K G  N++LSF   +   SP  L+ +S    GK
Sbjct  275  DSVRVTTGMVRIKNTTASGNGMQWFLGKDGIVNVVLSFAVPESVVSPVGLKYLSGVLGGK  334

Query  358  M---LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
                +S GWFYFL FWVL+L+I+ K+GT IYA+
Sbjct  335  AASAVSRGWFYFLFFWVLVLAITAKIGTCIYAK  367



>ref|XP_011469277.1| PREDICTED: NAC domain-containing protein 78 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=560

 Score =   116 bits (290),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 94/155 (61%), Gaps = 18/155 (12%)
 Frame = -2

Query  685  HKNDIASSSKPEP-TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQ  512
            H  + ASSSK +P  + GSD + PFI +AS MLG+IPAPPAFASE P KDA LRLN+   
Sbjct  408  HDVNDASSSKQKPDMQFGSDGKFPFITKASHMLGSIPAPPAFASEFPAKDAILRLNSEVA  467

Query  511  ASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVS----  368
            +SSSVH  AG+I+I D+T           K G  N++ S    Q   +  +L P+     
Sbjct  468  SSSSVH--AGMIRIRDITSSDNRVEWSIGKDGVVNLVFSVQLPQSDVNSSNLVPMGGSVS  525

Query  367  --HGKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
               G ++  GW  F+ FWVL +SIS K+G++IYA+
Sbjct  526  GKTGSVVMRGWVLFMFFWVLFISISFKMGSYIYAK  560



>ref|XP_010694513.1| PREDICTED: NAC domain-containing protein 78 [Beta vulgaris subsp. 
vulgaris]
Length=540

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 121/216 (56%), Gaps = 41/216 (19%)
 Frame = -2

Query  811  FDSDIFIGNDEFLGEQSP----SADKDACDTTEQAVL------PNEKAVDTEHKND-IAS  665
             D DI IG   +L   SP      D D   +T+Q V+      P+      E  ND IAS
Sbjct  331  LDDDIDIG--PYLNFDSPLEVTDNDADQVFSTKQHVIDATWQIPSASQQLPETGNDGIAS  388

Query  664  SS-------KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQA  509
            SS       K +P++  +D Q+P + QAS+ LGNIPAPPAFASE+P KD A RL+AA Q+
Sbjct  389  SSEQVKELSKAKPSE--TDVQYPVMNQASRFLGNIPAPPAFASELPSKDMAARLSAAVQS  446

Query  508  SSSVHVTAGLIQISDLTLG----------SKHGNYNIILSFDFSQGAQSPGSLEPVS---  368
            S+SVHVTA +I+I D+ +G           K GN N++LSFD  + A SP  LE  +   
Sbjct  447  STSVHVTANMIRIRDMPIGVSGSGLHWSFDKTGNVNVLLSFDLPE-AVSPVGLESFTSLL  505

Query  367  HGKM---LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              KM    S GW  F +F +   +IS+KVGT IYA+
Sbjct  506  SSKMSTAASRGWLCF-MFCIAFAAISIKVGTCIYAK  540



>ref|XP_010485001.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010485043.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
 ref|XP_010485093.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
Length=555

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 108/191 (57%), Gaps = 26/191 (14%)
 Frame = -2

Query  829  DFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSK--  656
            D  +++ D D+F+  +E   E     +K+     +Q V   EK        D AS SK  
Sbjct  381  DPSELMGDEDVFVDQEELFQE----VEKEETTGDKQVVEAKEK--------DEASCSKQV  428

Query  655  -PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAG  482
              + T+   D+++PF+K+A+ MLG IPAPPAFASE P K AA +LNA  Q+S SVHVTAG
Sbjct  429  DADATEFEPDYKYPFLKKATHMLGAIPAPPAFASEFPTKAAAFQLNAG-QSSGSVHVTAG  487

Query  481  LIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLI  311
            +I IS+  +G    K+ N ++ILS+   Q   + G L     G  L+     F+ FWVLI
Sbjct  488  MITISESNMGWSYDKNANRDLILSYRLVQ-ENASGKL-----GNSLTRAMLIFMCFWVLI  541

Query  310  LSISVKVGTFI  278
            LS+S KV T +
Sbjct  542  LSVSFKVSTLV  552



>ref|XP_004496134.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cicer 
arietinum]
Length=577

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 120/218 (55%), Gaps = 16/218 (7%)
 Frame = -2

Query  880  PQASTCLTSXNFYDAKDDFQDMLFDSDIFIGNDEFLGEQ-SPSADKDACDTTEQAVLPNE  704
            P  +  L     Y A D  + + FDS + IG +  +     P  +++  D    + L N+
Sbjct  357  PSVAAMLDEYLNYPAGDISKHISFDSPLSIGCESPIANPVQPFIEQNVEDEANGSSLANK  416

Query  703  KAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRL  527
            +  + +  N+   +  PE +   S   +PF+KQA+++L ++PA PAFASE P K+ ALR+
Sbjct  417  QVSEAQSSNEAIPTEDPEVSSWVSGDTNPFVKQANKLLASLPAAPAFASEFPTKEFALRI  476

Query  526  NAATQASSSVHVTAGLIQISDLT--------LGSKHGNYNIILSFDFSQGAQSPGSLEPV  371
            + A Q+SSS H+TAG+I I+D+T        +  K+G +N I+S  FSQ   +  +LEP+
Sbjct  477  HPAAQSSSSAHITAGMISITDITFRGNAMDWMVGKNGGFNTIMSTGFSQTDGNSATLEPI  536

Query  370  SH------GKMLSGGWFYFLLFWVLILSISVKVGTFIY  275
            S         +LS  W +   F V++LS+S K+G+ +Y
Sbjct  537  SDLVCSKAAFVLSHSWVFLTGFSVVVLSLSFKIGSLMY  574



>ref|XP_004496133.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cicer 
arietinum]
Length=578

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 120/218 (55%), Gaps = 16/218 (7%)
 Frame = -2

Query  880  PQASTCLTSXNFYDAKDDFQDMLFDSDIFIGNDEFLGEQ-SPSADKDACDTTEQAVLPNE  704
            P  +  L     Y A D  + + FDS + IG +  +     P  +++  D    + L N+
Sbjct  358  PSVAAMLDEYLNYPAGDISKHISFDSPLSIGCESPIANPVQPFIEQNVEDEANGSSLANK  417

Query  703  KAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRL  527
            +  + +  N+   +  PE +   S   +PF+KQA+++L ++PA PAFASE P K+ ALR+
Sbjct  418  QVSEAQSSNEAIPTEDPEVSSWVSGDTNPFVKQANKLLASLPAAPAFASEFPTKEFALRI  477

Query  526  NAATQASSSVHVTAGLIQISDLT--------LGSKHGNYNIILSFDFSQGAQSPGSLEPV  371
            + A Q+SSS H+TAG+I I+D+T        +  K+G +N I+S  FSQ   +  +LEP+
Sbjct  478  HPAAQSSSSAHITAGMISITDITFRGNAMDWMVGKNGGFNTIMSTGFSQTDGNSATLEPI  537

Query  370  SH------GKMLSGGWFYFLLFWVLILSISVKVGTFIY  275
            S         +LS  W +   F V++LS+S K+G+ +Y
Sbjct  538  SDLVCSKAAFVLSHSWVFLTGFSVVVLSLSFKIGSLMY  575



>ref|NP_196061.1| NAC family transcriptional activator [Arabidopsis thaliana]
 sp|Q84K00.2|NAC78_ARATH RecName: Full=NAC domain-containing protein 78; Short=ANAC078; 
AltName: Full=Protein NTM1-like 11 [Arabidopsis thaliana]
 emb|CAB85547.1| putative protein [Arabidopsis thaliana]
 gb|AAM20460.1| putative protein [Arabidopsis thaliana]
 gb|AAM91259.1| putative protein [Arabidopsis thaliana]
 gb|AED90739.1| NAC family transcriptional activator [Arabidopsis thaliana]
Length=567

 Score =   104 bits (260),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/209 (35%), Positives = 114/209 (55%), Gaps = 20/209 (10%)
 Frame = -2

Query  850  NFYDAKDDFQD--MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKN  677
            NF D    F D  + FD  + +G ++FL  Q     K A    E+ V   ++AV+ +   
Sbjct  364  NFEDYLSFFDDEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVAGGKEAVEEKESG  423

Query  676  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSS  500
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S S
Sbjct  424  EGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSSGS  482

Query  499  VHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ---GAQSPGSLEPVSHGKM  356
            VHVTAG+++IS++TL +         K+GN N++LSF   Q      + GS   ++  + 
Sbjct  483  VHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQQDDAMTASGSKTGITATRA  542

Query  355  LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            +      F+  WVL+LS+S K+ T + AR
Sbjct  543  M----LVFMCLWVLLLSVSFKIVTMVSAR  567


 Score = 33.5 bits (75),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  328  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  356



>gb|AAM65338.1| NAC, putative [Arabidopsis thaliana]
Length=549

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (55%), Gaps = 19/200 (10%)
 Frame = -2

Query  829  DFQDML------FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            DF+D L      FD    +GN++   +Q     +      E+      K V  E + D A
Sbjct  356  DFEDYLTFFDETFDPSQLMGNEDVFFDQEELFQEVETKELEKEETSRSKHVVEEKEKDEA  415

Query  667  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            S SK    + T+   D+++P +K+AS MLG IPAP A ASE P KDAA+RL+AA Q+S S
Sbjct  416  SCSKQVDADATEFEPDYKYPLLKKASHMLGAIPAPLANASEFPTKDAAIRLHAA-QSSGS  474

Query  499  VHVTAGLIQISDLTLGSKHG---NYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  329
            VHVTAG+I ISD  +G  +G   N ++ILS    QG  +P      S   ML      F+
Sbjct  475  VHVTAGMITISDSNMGWSYGKNENLDLILSLGLVQGNTAPEKSGNSSAWAML-----IFM  529

Query  328  LFWVLILSISVKVGTFIYAR  269
             FWVL+LS+S KV   + +R
Sbjct  530  CFWVLLLSVSFKVSILVSSR  549



>ref|NP_566376.1| NAC domain containing protein 53 [Arabidopsis thaliana]
 sp|Q949N0.1|NAC53_ARATH RecName: Full=NAC domain-containing protein 53; Short=ANAC053; 
AltName: Full=Protein ANTHER INDEHISCENCE FACTOR; AltName: 
Full=Protein NTM1-like 4 [Arabidopsis thaliana]
 gb|AAK93680.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85076.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74917.1| NAC domain containing protein 53 [Arabidopsis thaliana]
Length=549

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 109/200 (55%), Gaps = 19/200 (10%)
 Frame = -2

Query  829  DFQDML------FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            DF+D L      FD    +GN++   +Q     +      E+      K V  E + D A
Sbjct  356  DFEDYLTFFDETFDPSQLMGNEDVFFDQEELFQEVETKELEKEETSRSKHVVEEKEKDEA  415

Query  667  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSS  500
            S SK    + T+   D+++P +K+AS MLG IPAP A ASE P KDAA+RL+AA Q+S S
Sbjct  416  SCSKQVDADATEFEPDYKYPLLKKASHMLGAIPAPLANASEFPTKDAAIRLHAA-QSSGS  474

Query  499  VHVTAGLIQISDLTLGSKHG---NYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  329
            VHVTAG+I ISD  +G  +G   N ++ILS    QG  +P      S   ML      F+
Sbjct  475  VHVTAGMITISDSNMGWSYGKNENLDLILSLGLVQGNTAPEKSGNSSAWAML-----IFM  529

Query  328  LFWVLILSISVKVGTFIYAR  269
             FWVL+LS+S KV   + +R
Sbjct  530  CFWVLLLSVSFKVSILVSSR  549



>gb|AAG51388.1|AC011560_20 unknown protein; 75639-73470 [Arabidopsis thaliana]
 gb|AAF76351.1| NAC, putative [Arabidopsis thaliana]
Length=558

 Score =   106 bits (264),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 81/209 (39%), Positives = 109/209 (52%), Gaps = 28/209 (13%)
 Frame = -2

Query  829  DFQDML------FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            DF+D L      FD    +GN++   +Q     +      E+      K V  E + D A
Sbjct  356  DFEDYLTFFDETFDPSQLMGNEDVFFDQEELFQEVETKELEKEETSRSKHVVEEKEKDEA  415

Query  667  SSSKP--------EP----TKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRL  527
            S SK         EP        +D+++P +K+AS MLG IPAP A ASE P KDAA+RL
Sbjct  416  SCSKQVDADATEFEPDDGSISENADYKYPLLKKASHMLGAIPAPLANASEFPTKDAAIRL  475

Query  526  NAATQASSSVHVTAGLIQISDLTLGSKHG---NYNIILSFDFSQGAQSPGSLEPVSHGKM  356
            +AA Q+S SVHVTAG+I ISD  +G  +G   N ++ILS    QG  +P      S   M
Sbjct  476  HAA-QSSGSVHVTAGMITISDSNMGWSYGKNENLDLILSLGLVQGNTAPEKSGNSSAWAM  534

Query  355  LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            L      F+ FWVL+LS+S KV   + +R
Sbjct  535  L-----IFMCFWVLLLSVSFKVSILVSSR  558


 Score = 31.6 bits (70),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 25/48 (52%), Gaps = 3/48 (6%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*FL  843
            N L+ E  +D       NDG +LETNDLS+  +    GFD  D+  F 
Sbjct  320  NYLIGEAFLDPNSNLLENDGLYLETNDLSSTQQ---DGFDFEDYLTFF  364



>ref|XP_010490948.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010490949.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=563

 Score =   104 bits (259),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 119/211 (56%), Gaps = 31/211 (15%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +  
Sbjct  367  NFEDYLNDFN---FDEDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKDS  418

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG+IPAP +FAS+   KDAA+RL+  +++S
Sbjct  419  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGSIPAPSSFASQFKSKDAAIRLH--SESS  476

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQG---AQSPGSLEPVSHG  362
             SVHVTAG+I+IS++TL +         K+GN N+ILSF   Q      + GS    +  
Sbjct  477  GSVHVTAGMIRISNMTLAADSSMGWSYDKNGNLNVILSFGVVQRDDELNATGSKTGTTET  536

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            + +      F+  WVL+LS+S K+GT + AR
Sbjct  537  RAM----LIFMCLWVLVLSVSFKIGTMVSAR  563


 Score = 33.1 bits (74),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  331  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  359



>ref|XP_010490950.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
 ref|XP_010490951.1| PREDICTED: NAC domain-containing protein 78-like isoform X4 [Camelina 
sativa]
Length=562

 Score =   104 bits (259),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 119/211 (56%), Gaps = 31/211 (15%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGND---EFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHK  680
            NF D  +DF    FD D F  +D   + L +Q P     A +  E+ V   ++ V+ +  
Sbjct  366  NFEDYLNDFN---FDEDGFTLDDPELDALLDQKP-----APEELEKEVAEGKEMVEKKDS  417

Query  679  NDIASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQAS  506
             + +SS +  + T   S  ++PF+K+ S MLG+IPAP +FAS+   KDAA+RL+  +++S
Sbjct  418  GEGSSSKQDADLTDFDSASKYPFLKKTSHMLGSIPAPSSFASQFKSKDAAIRLH--SESS  475

Query  505  SSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQG---AQSPGSLEPVSHG  362
             SVHVTAG+I+IS++TL +         K+GN N+ILSF   Q      + GS    +  
Sbjct  476  GSVHVTAGMIRISNMTLAADSSMGWSYDKNGNLNVILSFGVVQRDDELNATGSKTGTTET  535

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            + +      F+  WVL+LS+S K+GT + AR
Sbjct  536  RAM----LIFMCLWVLVLSVSFKIGTMVSAR  562


 Score = 33.1 bits (74),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  330  NYLPDEPFMDPNNSLPLNDGLYLETNDLS  358



>ref|XP_008456549.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cucumis 
melo]
Length=555

 Score =   109 bits (273),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 140/243 (58%), Gaps = 18/243 (7%)
 Frame = -2

Query  958  TLPTDFSSMMEHFLKLMIFQILSKEIPQASTCLTSX-NFYDAKDDFQDMLFD-SDIFIGN  785
            ++P D + + E FL+        +  P A   L     F+DA D+ Q + FD SDIF G+
Sbjct  316  SVPDDLALIEELFLETNDLSNPVESDPSALDVLEEYLTFFDADDNLQ-LAFDPSDIF-GS  373

Query  784  DEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQ  605
            +E +  Q+ S +K   +  E+  +  +++  T   +   S   P+  + GSD + PF K+
Sbjct  374  EEPISSQTISEEK-VNEVAEKEFMAAKQSSVTFLNDASTSKQNPKAIETGSDSKSPFFKR  432

Query  604  ASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT---------L  455
            AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVTAG+I I +LT         L
Sbjct  433  ASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVTAGMIHIRNLTSNGDLVNNPL  492

Query  454  GSKHGNYNIILSFDFSQGAQSPGSLEPVSHGKML--SGGWFYFLLFWVLILSISVKVGTF  281
              K+ + N+ILSF   Q  Q     +   +G ++   G  F+FLLFWVLILS+S KVG+ 
Sbjct  493  YGKNADVNLILSFAQHQ-HQVESDHQSEKNGIIVGSRGFLFFFLLFWVLILSVSFKVGSC  551

Query  280  IYA  272
            IY+
Sbjct  552  IYS  554



>ref|XP_008456548.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cucumis 
melo]
Length=556

 Score =   109 bits (272),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 140/243 (58%), Gaps = 18/243 (7%)
 Frame = -2

Query  958  TLPTDFSSMMEHFLKLMIFQILSKEIPQASTCLTSX-NFYDAKDDFQDMLFD-SDIFIGN  785
            ++P D + + E FL+        +  P A   L     F+DA D+ Q + FD SDIF G+
Sbjct  317  SVPDDLALIEELFLETNDLSNPVESDPSALDVLEEYLTFFDADDNLQ-LAFDPSDIF-GS  374

Query  784  DEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQ  605
            +E +  Q+ S +K   +  E+  +  +++  T   +   S   P+  + GSD + PF K+
Sbjct  375  EEPISSQTISEEK-VNEVAEKEFMAAKQSSVTFLNDASTSKQNPKAIETGSDSKSPFFKR  433

Query  604  ASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT---------L  455
            AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVTAG+I I +LT         L
Sbjct  434  ASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVTAGMIHIRNLTSNGDLVNNPL  493

Query  454  GSKHGNYNIILSFDFSQGAQSPGSLEPVSHGKML--SGGWFYFLLFWVLILSISVKVGTF  281
              K+ + N+ILSF   Q  Q     +   +G ++   G  F+FLLFWVLILS+S KVG+ 
Sbjct  494  YGKNADVNLILSFAQHQ-HQVESDHQSEKNGIIVGSRGFLFFFLLFWVLILSVSFKVGSC  552

Query  280  IYA  272
            IY+
Sbjct  553  IYS  555



>ref|XP_002871092.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47351.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
Length=568

 Score =   101 bits (252),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 118/211 (56%), Gaps = 30/211 (14%)
 Frame = -2

Query  829  DFQDML--FDSDIFIGND-EFLGEQSPSADKDACDTT------EQAVLPNEKAVDTEHKN  677
            +F+D L  FD + F  +D + +G ++   + +  D        E+ V   ++AV+ +   
Sbjct  364  NFEDYLNFFDDESFTLDDSQLMGPEAALPNLEGLDQKPTPEELEKEVAGGKEAVEEKESG  423

Query  676  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASS  503
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+   KDAA+RL+AA Q+S 
Sbjct  424  EGSSSKQDADVKDFDSASKYPFLKKTSHMLGAIPTPSSFASQFQTKDAAMRLHAA-QSSG  482

Query  502  SVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQG----AQSPGSLEPVSHG  362
            SVHVTAG+I+IS++TL +         K+GN N++LSF   Q     + S    E  +  
Sbjct  483  SVHVTAGMIRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQRDDALSASGSKTETTATR  542

Query  361  KMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             ML      F+  WVL+LS+S K+ T ++AR
Sbjct  543  AML-----VFMCLWVLLLSVSFKIVTMVFAR  568


 Score = 33.1 bits (74),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  328  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  356



>gb|KFK24891.1| hypothetical protein AALP_AA8G038000 [Arabis alpina]
Length=580

 Score =   107 bits (268),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 112/205 (55%), Gaps = 14/205 (7%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D +D     L DS++       L  Q     K + +  E+ V   ++ V+     + 
Sbjct  379  NFFDDEDAQNFTLDDSELMGSEAALLPNQEGLDQKPSSEELEKEVAEVKETVEKIESGEG  438

Query  670  ASSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSV  497
            +SS +  + T   S  ++PF K+AS M G IPAPP FASE   KD+A+RL+AA Q+S SV
Sbjct  439  SSSKQDADVTDFDSASKYPFFKKASHMFGAIPAPP-FASECKSKDSAIRLHAA-QSSGSV  496

Query  496  HVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGG  344
            HVTAG+I+ISD+TL +         K GN N++LSF   Q   +  S    + G   +  
Sbjct  497  HVTAGMIRISDMTLSADSGMGWSYDKSGNLNVVLSFGLVQRENAMSSTGSKT-GTTATRA  555

Query  343  WFYFLLFWVLILSISVKVGTFIYAR  269
               F+  WVL+LS+S K+GT + AR
Sbjct  556  MLIFICLWVLLLSVSYKIGTIVSAR  580


 Score = 26.9 bits (58),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = -1

Query  974  NEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*F  846
            +EP MD       ND  +LETNDL + +     GF+  D+  F
Sbjct  339  DEPFMDPNTNLPLNDDLYLETNDLFDGI-AQQDGFNFEDYLNF  380



>ref|XP_006286823.1| hypothetical protein CARUB_v10003768mg [Capsella rubella]
 gb|EOA19721.1| hypothetical protein CARUB_v10003768mg [Capsella rubella]
Length=623

 Score = 99.4 bits (246),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 120/216 (56%), Gaps = 32/216 (15%)
 Frame = -2

Query  868  TCLTSXNFYDAKDDFQDML--FDSDIFIGND-EFLGEQSPSADKDACDTTEQAVLPNEKA  698
            +C+   +F     +F+D L   D + FI +D +F+G +    D++  D   Q V+     
Sbjct  424  SCVQQDDF-----NFEDYLNFCDDEGFILDDSQFMGSEDALPDQEGLD---QKVMVRYSL  475

Query  697  VDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNA  521
            +  +  + I   S P  TK  +  ++PF+K+ S MLG IPAP +FAS+   KDAA+RL++
Sbjct  476  IHRKANHLI--DSDPSKTKSAAS-KYPFLKKTSHMLGAIPAPSSFASQFKSKDAAIRLHS  532

Query  520  ATQASSSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQG---AQSPGSLE  377
            A Q+S SVHVTAG+I+IS++TL +         K+GN N++LSF   Q      + GS  
Sbjct  533  A-QSSGSVHVTAGMIRISNMTLAADSSMGWSYDKNGNLNVVLSFGVVQRDDELSASGSKT  591

Query  376  PVSHGKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
              +  + +      F+  WVL+LS+S K+ T + AR
Sbjct  592  ATTATRAM----LIFMCLWVLLLSVSFKIVTMVSAR  623


 Score = 33.1 bits (74),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  396  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  424



>ref|XP_010243195.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 102/170 (60%), Gaps = 30/170 (18%)
 Frame = -2

Query  691  TEHKNDIASSSKPEPTKLGSDFQHP------FIKQASQMLGNIPAPPAFASEIP-KDAAL  533
            T+  +  +SS +PE T+   D Q+        +K+ S+MLG+I APPAFA+E P K+AA+
Sbjct  389  TQGSDGASSSKQPETTQFTPDVQYDEGWDSNIVKRVSRMLGSIHAPPAFAAEFPVKEAAI  448

Query  532  RLNAATQASSSVHVTAGLIQISDLTLGSKHGNY--------NIILSFDFSQGAQ------  395
              N++ +AS+ VHVTAG+I+IS +T+ S  GNY        +++LS+  ++G        
Sbjct  449  GQNSSAEASNPVHVTAGMIRISGMTIRSA-GNYSSFGKNNVDLLLSYGMTRGDMIAAKQL  507

Query  394  --SPGSLEPVSH------GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
                 + +P+++      G ++  G FYF+ FWVLILS+S K+ ++IY R
Sbjct  508  IGGTAATDPMANILSGKAGSVMIHGGFYFIFFWVLILSVSFKIASYIYTR  557



>ref|XP_010243196.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nelumbo 
nucifera]
Length=556

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 102/170 (60%), Gaps = 30/170 (18%)
 Frame = -2

Query  691  TEHKNDIASSSKPEPTKLGSDFQHP------FIKQASQMLGNIPAPPAFASEIP-KDAAL  533
            T+  +  +SS +PE T+   D Q+        +K+ S+MLG+I APPAFA+E P K+AA+
Sbjct  388  TQGSDGASSSKQPETTQFTPDVQYDEGWDSNIVKRVSRMLGSIHAPPAFAAEFPVKEAAI  447

Query  532  RLNAATQASSSVHVTAGLIQISDLTLGSKHGNY--------NIILSFDFSQGAQ------  395
              N++ +AS+ VHVTAG+I+IS +T+ S  GNY        +++LS+  ++G        
Sbjct  448  GQNSSAEASNPVHVTAGMIRISGMTIRSA-GNYSSFGKNNVDLLLSYGMTRGDMIAAKQL  506

Query  394  --SPGSLEPVSH------GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
                 + +P+++      G ++  G FYF+ FWVLILS+S K+ ++IY R
Sbjct  507  IGGTAATDPMANILSGKAGSVMIHGGFYFIFFWVLILSVSFKIASYIYTR  556



>ref|XP_002882677.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58936.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score = 99.0 bits (245),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 113/198 (57%), Gaps = 14/198 (7%)
 Frame = -2

Query  847  FYDAKDD-FQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            F+D  D+  Q++ FD    +GN++   +Q     +      ++      K V  E + D 
Sbjct  366  FFDEDDESAQNLTFDPSQLMGNEDIFVDQEELFQEVETKELKKEETSGSKHVVEEKEKDE  425

Query  670  ASSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASS  503
            AS SK    + T+   D+++PF+K+AS ML  IPAPPAFASE+P KDAA+RL+AA Q+S 
Sbjct  426  ASCSKQVDADATEFEPDYKYPFLKKASHMLAAIPAPPAFASELPTKDAAIRLHAA-QSSG  484

Query  502  SVHVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYF  332
            SVHVTAG+I ISD  +G    K+GN+++ILS    QG  +       S   ML      F
Sbjct  485  SVHVTAGMITISDGNMGWSYGKNGNFDLILSLGLVQGNTASEKSGNSSAWAML-----IF  539

Query  331  LLFWVLILSISVKVGTFI  278
            +  WVL+LS+S KV   +
Sbjct  540  MCLWVLVLSVSFKVSILV  557


 Score = 30.4 bits (67),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 3/47 (6%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*F  846
            N L  E  +D       NDG +LETNDLS+  +    GFD  D+  F
Sbjct  323  NYLTGEAFLDPNSNLLQNDGLYLETNDLSSTQQ---DGFDFEDYLTF  366



>ref|XP_010267268.1| PREDICTED: NAC domain-containing protein 78-like [Nelumbo nucifera]
Length=589

 Score =   103 bits (258),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 94/162 (58%), Gaps = 28/162 (17%)
 Frame = -2

Query  670  ASSSKPEPTKLGSDFQHP------FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQ  512
            +S  KP+ TK   D QH        +K  S+MLG+IPAPP+FA+E P K+AA+  N A +
Sbjct  428  SSKQKPDTTKFSPDVQHGNGWDNNLVKHVSRMLGSIPAPPSFAAEFPLKEAAIGQNKANE  487

Query  511  ASSSVHVTAGLIQISDLTL--GSK-----HGNYNIILSFDFSQGA--------QSPGSLE  377
            AS+ V VTAG+IQIS +T+  G K       N ++ LS+  ++           +  +LE
Sbjct  488  ASNPVRVTAGMIQISGMTVSGGRKCYSLGKSNADLFLSYGMARDGVMAAEQLINNSVALE  547

Query  376  PVSH------GKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            P+++      G ++    FYF  FWVLILS+S K+G++IY R
Sbjct  548  PMANILSGKSGSLMIRCGFYFTFFWVLILSVSFKIGSYIYTR  589



>ref|XP_004150380.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cucumis 
sativus]
 gb|KGN62198.1| hypothetical protein Csa_2G327500 [Cucumis sativus]
Length=555

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 137/252 (54%), Gaps = 17/252 (7%)
 Frame = -2

Query  985  IAYSMNHSW-TLPTDFSSMMEHFLKLMIFQILSKEIPQASTCLTSX-NFYDAKDDFQDML  812
            I Y ++  + ++P D +   E FL+        +  P A   L     F+DA D+ Q + 
Sbjct  306  INYLLDEPYPSVPDDLALNEELFLEANDLSNPVESDPSALDVLEEYFTFFDADDNLQ-LA  364

Query  811  FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGS  632
            FD      ++E +  Q+ S +K   +  E+  +  +++  T   +   S   P+  +  S
Sbjct  365  FDPSDLFDSEEPISSQTTSEEK-VSEVAEKEFMAAKQSSVTFVNDASTSKQDPKAIETSS  423

Query  631  DFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT-  458
            D + PF K AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVTAG+I I +LT 
Sbjct  424  DSKSPFFKGASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVTAGMIHIRNLTS  483

Query  457  --------LGSKHGNYNIILSFDFSQGAQSPGSLEPVSHGKML--SGGWFYFLLFWVLIL  308
                    L  K+ + N+ILSF   Q  Q     +   +G ++   G  F+FLLFWVLIL
Sbjct  484  NGDLVNDPLYGKNADVNLILSFAQHQ-HQVESDHQSEKNGTIVGSRGFLFFFLLFWVLIL  542

Query  307  SISVKVGTFIYA  272
            S+S KVG+ IY+
Sbjct  543  SVSFKVGSCIYS  554



>ref|XP_011649428.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cucumis 
sativus]
Length=556

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 137/252 (54%), Gaps = 17/252 (7%)
 Frame = -2

Query  985  IAYSMNHSW-TLPTDFSSMMEHFLKLMIFQILSKEIPQASTCLTSX-NFYDAKDDFQDML  812
            I Y ++  + ++P D +   E FL+        +  P A   L     F+DA D+ Q + 
Sbjct  307  INYLLDEPYPSVPDDLALNEELFLEANDLSNPVESDPSALDVLEEYFTFFDADDNLQ-LA  365

Query  811  FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGS  632
            FD      ++E +  Q+ S +K   +  E+  +  +++  T   +   S   P+  +  S
Sbjct  366  FDPSDLFDSEEPISSQTTSEEK-VSEVAEKEFMAAKQSSVTFVNDASTSKQDPKAIETSS  424

Query  631  DFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT-  458
            D + PF K AS MLGNIPAPPAFASE P KD A+RLN+A Q SSSVHVTAG+I I +LT 
Sbjct  425  DSKSPFFKGASYMLGNIPAPPAFASEYPSKDMAIRLNSAAQTSSSVHVTAGMIHIRNLTS  484

Query  457  --------LGSKHGNYNIILSFDFSQGAQSPGSLEPVSHGKML--SGGWFYFLLFWVLIL  308
                    L  K+ + N+ILSF   Q  Q     +   +G ++   G  F+FLLFWVLIL
Sbjct  485  NGDLVNDPLYGKNADVNLILSFAQHQ-HQVESDHQSEKNGTIVGSRGFLFFFLLFWVLIL  543

Query  307  SISVKVGTFIYA  272
            S+S KVG+ IY+
Sbjct  544  SVSFKVGSCIYS  555



>gb|AAF09254.1|AF201456_1 NAC2 [Arabidopsis thaliana]
Length=569

 Score = 93.6 bits (231),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 114/220 (52%), Gaps = 40/220 (18%)
 Frame = -2

Query  850  NFYDAKDDFQD--MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKN  677
            NF D    F D  + FD  + +G ++FL    P+ +     T EQ   P E   +   + 
Sbjct  364  NFEDYLSFFDDEGLTFDESLLMGPEDFL----PNPE-----TLEQKPAPKEMEKERGRRR  414

Query  676  DIASSSKPEPTKL-----GSDFQ-------HPFIKQASQMLGNIPAPPAFASEIPKDAAL  533
              +S  K +  K+      +DF+       +PF+K+ S MLG IP P +FAS+     A+
Sbjct  415  QRSSGGKGKWRKIFFQNKYTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAM  474

Query  532  RLNAATQASSSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ---GAQSP  389
            RL+AA Q+S SVHVTAG+++IS++TL +         K+GN N++LSF   Q      + 
Sbjct  475  RLHAA-QSSGSVHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQQDDAMTAS  533

Query  388  GSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTFIYAR  269
            GS   ++  + +      F+  WVL+LS+S K+ T + AR
Sbjct  534  GSKTGITATRAM----LVFMCLWVLLLSVSFKIVTMVSAR  569


 Score = 33.1 bits (74),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  328  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  356



>gb|KEH17171.1| NAC transcription factor-like protein [Medicago truncatula]
Length=539

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 84/128 (66%), Gaps = 11/128 (9%)
 Frame = -2

Query  625  QHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT---  458
            ++ F+KQA+++L  IPAPPAFASE P K+ A+ +++A + S+S H+T G+I I+D+T   
Sbjct  409  ENAFVKQANKLLAGIPAPPAFASEFPSKEFAVGMHSAAEFSNSAHITTGIISITDITYSG  468

Query  457  -----LGSKHGNYNIILSFDFSQGA--QSPGSLEPVSHGKMLSGGWFYFLLFWVLILSIS  299
                 +  K+G ++ I+S +FSQ A   S   L       MLS GW Y + F V+ILS+S
Sbjct  469  NMMDWMAGKNGGFDTIMSNEFSQTAAINSATGLVCRKTACMLSHGWVYLMGFSVVILSMS  528

Query  298  VKVGTFIY  275
            +K+G+F+Y
Sbjct  529  LKIGSFMY  536



>ref|XP_007144249.1| hypothetical protein PHAVU_007G140500g [Phaseolus vulgaris]
 gb|ESW16243.1| hypothetical protein PHAVU_007G140500g [Phaseolus vulgaris]
Length=588

 Score = 92.8 bits (229),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 101/185 (55%), Gaps = 22/185 (12%)
 Frame = -2

Query  766  QSPSADKDACDTTEQAVLPNE---KAVDTEHKNDIASSSKP------EPTKLGSDFQHPF  614
            +S ++D +      Q  L  E   KAV ++H +D  +S +       E  KL  +  +PF
Sbjct  402  ESENSDSNQGSPLTQQTLEGETADKAVVSKHDSDAQTSKEAFSVQNREEEKLAPENSNPF  461

Query  613  IKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG-----  452
            +K+A   L +IPA PA A E P KD  L +++A Q+S + H+T G+I I+D+T       
Sbjct  462  VKEAYGWLASIPAAPAHAFEFPAKDITLGIHSAAQSSHTAHITTGMISITDITFRGNAMD  521

Query  451  ---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFYFLLFWVLILSISVKV  290
                K G +N  +S +FSQ   +  +L P+S GK   +LS GW +   F VLILS+S K+
Sbjct  522  WPMGKSGGFNTAISTEFSQPDVNCAALIPLS-GKTAFVLSHGWIFLTGFSVLILSLSFKI  580

Query  289  GTFIY  275
            G+ +Y
Sbjct  581  GSMMY  585


 Score = 30.0 bits (66),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 5/38 (13%)
 Frame = -1

Query  956  TTDRFQFNDGTFLETNDLS-----NPVEGNTSGFDMFD  858
            T D    +DG+FLETNDL+     NP E + S  DM D
Sbjct  342  TQDLPAADDGSFLETNDLAIGNEGNPTEADPSANDMLD  379



>gb|KEH43320.1| NAC transcription factor-like protein [Medicago truncatula]
Length=452

 Score = 97.1 bits (240),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 18/129 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  458
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  324  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  380

Query  457  --LGSKHGNYNIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  302
              +  K+G +N ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  381  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  440

Query  301  SVKVGTFIY  275
            S K+G+F+Y
Sbjct  441  SFKIGSFMY  449



>gb|KEH43318.1| NAC transcription factor-like protein [Medicago truncatula]
Length=492

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 18/129 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  458
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  364  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  420

Query  457  --LGSKHGNYNIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  302
              +  K+G +N ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  421  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  480

Query  301  SVKVGTFIY  275
            S K+G+F+Y
Sbjct  481  SFKIGSFMY  489



>gb|KEH43319.1| NAC transcription factor-like protein [Medicago truncatula]
Length=589

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 18/129 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  458
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  461  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  517

Query  457  --LGSKHGNYNIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  302
              +  K+G +N ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  518  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  577

Query  301  SVKVGTFIY  275
            S K+G+F+Y
Sbjct  578  SFKIGSFMY  586



>gb|KEH43321.1| NAC transcription factor-like protein [Medicago truncatula]
Length=630

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 18/129 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  458
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  502  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  558

Query  457  --LGSKHGNYNIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  302
              +  K+G +N ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  559  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  618

Query  301  SVKVGTFIY  275
            S K+G+F+Y
Sbjct  619  SFKIGSFMY  627



>gb|KEH43317.1| NAC transcription factor-like protein [Medicago truncatula]
Length=629

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 81/129 (63%), Gaps = 18/129 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLT------  458
            F+K    +L NIPAPPAFASE P K+ A  ++ A ++S+S H+TAG+I I+D+T      
Sbjct  501  FVKH---LLANIPAPPAFASEFPAKELACEIHPAAESSNSAHITAGMISITDITFRGNAM  557

Query  457  --LGSKHGNYNIILSFDFSQGAQSPGSLEPVS------HGKMLSGGWFYFLLFWVLILSI  302
              +  K+G +N ++S  FSQ   +P +L P+S         MLS GW + + F V+ILS+
Sbjct  558  DWMVGKNGGFNTVMSTGFSQTDVNPATLVPISGLVCSKTAFMLSHGWVFLMGFSVVILSL  617

Query  301  SVKVGTFIY  275
            S K+G+F+Y
Sbjct  618  SFKIGSFMY  626



>gb|EPS65703.1| nam-like protein 9 [Genlisea aurea]
Length=542

 Score = 86.7 bits (213),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 100/210 (48%), Gaps = 26/210 (12%)
 Frame = -2

Query  847  FYDAK-DDFQDMLFDSDIFIGNDEFLGEQ------SPSADKDACDTTEQAVLPNEKAVDT  689
            F+DA  D+ Q+  FD  +  G  +F+          P   K   +  + + +P  K  D 
Sbjct  336  FFDANVDNTQEFGFDPSLAFGTPDFMAPDLNQMLLPPEEPKGVAEGEDDSTIP--KLFD-  392

Query  688  EHKNDIASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASE--IPKDAALRLNAAT  515
               +D A+    +      D + PF+K+A++MLG+  APPAFASE       +L LN  +
Sbjct  393  ---DDAAAYVSDKLDSSTHDLESPFVKRANRMLGSFDAPPAFASEPSFSSKDSLSLNLLS  449

Query  514  QASSSVHVTAGLIQISD-----LTLGSKHGNYNIILSFDFSQGAQSPGSLE------PVS  368
             AS SV VTAG+I+ISD           H   NI++S  F +G     SLE      P  
Sbjct  450  GASGSVRVTAGMIRISDGYDEASAKYDDHSKLNIVVSLGFCRGDDGSASLESSVRILPGK  509

Query  367  HGKMLSGGWFYFLLFWVLILSISVKVGTFI  278
                +S  WFYF    +++ SI++K+G  +
Sbjct  510  AVAAISRSWFYFTCLCIVLFSITIKLGMCV  539


 Score = 33.9 bits (76),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = -1

Query  1070  QPIHDFDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNP-  894
              P  D     VK E++GESS +   E ++   ++   D+T    + +G  +E +++  P 
Sbjct  260   SPPSDAKAVVVKHEFIGESSKTADPEKMDFSSDDYFFDSTANLPYGNGEIIEGDNMPVPN  319

Query  893   VEGNTSGFDMFD  858
             VE N+S  D+ D
Sbjct  320   VETNSSPLDLLD  331



>ref|XP_009125558.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=505

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 107/205 (52%), Gaps = 41/205 (20%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D  +D Q+   D    +G++E L ++ PS              P E   + E     
Sbjct  329  NFFD-DEDAQNWSLDVSQLLGSEEGLDQKQPS--------------PEELEKEKESGEGS  373

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI--PKDAALRLNAATQASSSV  497
            +S    + T L S  +HPF+K+ S M     APP+FAS     K+AA+RL+AA Q+S SV
Sbjct  374  SSKQDADVTDLDSASKHPFLKKGSHMF----APPSFASSQFQTKEAAIRLHAA-QSSGSV  428

Query  496  HVTAGLIQISDLT-------LG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            HVTAG+I+IS++T       +G    K+GN N++LS          G ++  + G   + 
Sbjct  429  HVTAGMIRISNMTTLAAESSMGWSYDKNGNLNVVLSL---------GLVQSKTGGTTATR  479

Query  346  GWFYFLLFWVLILSISVKVGTFIYA  272
              F F+ FW+L+L +S K+GT + A
Sbjct  480  AMFIFMCFWILLLYVSFKIGTIVSA  504



>gb|AAN46239.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46240.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46241.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46242.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46243.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46244.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46245.1| unknown protein, partial [Arabidopsis thaliana]
 gb|AAN46246.1| unknown protein, partial [Arabidopsis thaliana]
Length=358

 Score = 87.0 bits (214),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 13/161 (8%)
 Frame = -2

Query  850  NFYDAKDDFQD--MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKN  677
            NF D    F D  + FD  + +G ++FL +Q     K A    E+ V   ++AV+ +   
Sbjct  187  NFEDYLSFFDDEGLTFDDSLLMGPEDFLPDQEALDQKPAPKELEKEVAGGKEAVEEKESG  246

Query  676  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSS  500
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S S
Sbjct  247  EGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSSGS  305

Query  499  VHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ  404
            VHVTAG+++IS++TL +         K+GN N++LSF   Q
Sbjct  306  VHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQ  346


 Score = 33.5 bits (75),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  151  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  179



>gb|AAN46238.1| unknown protein, partial [Arabidopsis thaliana]
Length=358

 Score = 86.3 bits (212),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 91/161 (57%), Gaps = 13/161 (8%)
 Frame = -2

Query  850  NFYDAKDDFQD--MLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKN  677
            NF D    F D  + FD  + +G ++FL  Q     K A    E+ V   ++AV+ +   
Sbjct  187  NFEDYLSFFDDEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVAGGKEAVEEKESG  246

Query  676  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSS  500
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+     A+RL+AA Q+S S
Sbjct  247  EGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAA-QSSGS  305

Query  499  VHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ  404
            VHVTAG+++IS++TL +         K+GN N++LSF   Q
Sbjct  306  VHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQ  346


 Score = 33.5 bits (75),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  151  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  179



>gb|AGV29486.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=185

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 27/160 (17%)
 Frame = -2

Query  691  TEHKNDIASSSKP--EPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIP-KDAALRLNA  521
            T    + ASSSKP  E  +  S+ ++PFI   +++LGNIPAPPAFA+E P KD A RLNA
Sbjct  34   TASSGNDASSSKPVAEVPESESELEYPFI---NRVLGNIPAPPAFAAEFPTKDLAARLNA  90

Query  520  ATQASSSVHVTAGLIQISDLTLG--------SKHGNYNIILSFDFSQGAQSPGSLEPVSH  365
            A   S ++ VTAG+++I + T          SK G  N++LSF+  +    P  L+ +S 
Sbjct  91   A---SDTIRVTAGMVRIRNTTANGNGTRWSLSKDGKVNVVLSFNVPESVVGPVGLDHLSG  147

Query  364  GKMLSG--------GWFYFLLFWVLILSISVKVGTFIYAR  269
              MLSG        GWF F  F VL+L+ISVK+GT IYA+
Sbjct  148  --MLSGKAASTVARGWFGFFFFLVLLLAISVKMGTCIYAK  185



>ref|XP_010485171.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=106

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = -2

Query  595  MLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG---SKHGNYNI  428
            MLG IPAPPAFASE P K AA +LNA  Q+S SVHVTAG+I IS+  +G    K+ N ++
Sbjct  1    MLGAIPAPPAFASEFPTKAAAFQLNAG-QSSGSVHVTAGMITISESNMGWSYDKNANRDL  59

Query  427  ILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTFI  278
            ILS+   Q   + G L     G  L+     F+ FWVLILS+S KV T +
Sbjct  60   ILSYRLVQ-ENASGKL-----GNSLTRAMLIFMCFWVLILSVSFKVSTLV  103



>emb|CDY44853.1| BnaC09g50530D [Brassica napus]
Length=560

 Score = 87.0 bits (214),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 109/209 (52%), Gaps = 34/209 (16%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D +D         ++ +G  + LG Q    ++++ D         ++ V  + ++  
Sbjct  371  NFFDDEDA-------QNLTLGVSQLLGSQDAPPEQESLDQKPSPEELEKEVVVEKKESGE  423

Query  670  ASSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  500
             SSSK +   T   SD ++PF+K++S M G    PP+FAS+   KDAA+RL+AA Q+S S
Sbjct  424  GSSSKQDADVTDFDSDSKYPFLKKSSHMFG---VPPSFASQFQTKDAAIRLHAA-QSSGS  479

Query  499  VHVTAGLIQISDLT------------LGSKHGNYNIILSFDFSQGAQSPGSLEPVSHGKM  356
            VHVTAG+I+IS++T               K+G+ +++LSF   Q           +  K 
Sbjct  480  VHVTAGMIRISNMTPAVDSDMGWANGANDKNGDLSVVLSFGLVQRDD--------AMSKT  531

Query  355  LSGGWFYFLLFWVLILSISVKVGTFIYAR  269
             +     FL  WVL+LS+S K+ T + AR
Sbjct  532  ATRAMLVFLCLWVLLLSVSFKIVTMVSAR  560


 Score = 30.4 bits (67),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSN  897
            N L +EP MD ++  Q  D  +LETNDLS 
Sbjct  328  NYLPDEPFMDPSNNLQLCDDLYLETNDLSG  357



>ref|XP_009125559.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=504

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 107/205 (52%), Gaps = 42/205 (20%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D  +D Q+   D    +G++E L +Q PS              P E   + E     
Sbjct  329  NFFD-DEDAQNWSLDVSQLLGSEEGL-DQKPS--------------PEELEKEKESGEGS  372

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI--PKDAALRLNAATQASSSV  497
            +S    + T L S  +HPF+K+ S M     APP+FAS     K+AA+RL+AA Q+S SV
Sbjct  373  SSKQDADVTDLDSASKHPFLKKGSHMF----APPSFASSQFQTKEAAIRLHAA-QSSGSV  427

Query  496  HVTAGLIQISDLT-------LG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            HVTAG+I+IS++T       +G    K+GN N++LS          G ++  + G   + 
Sbjct  428  HVTAGMIRISNMTTLAAESSMGWSYDKNGNLNVVLSL---------GLVQSKTGGTTATR  478

Query  346  GWFYFLLFWVLILSISVKVGTFIYA  272
              F F+ FW+L+L +S K+GT + A
Sbjct  479  AMFIFMCFWILLLYVSFKIGTIVSA  503



>emb|CDY58437.1| BnaC03g71220D [Brassica napus]
Length=556

 Score = 91.7 bits (226),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 109/202 (54%), Gaps = 16/202 (8%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+D  +D Q++  D    +G+++ L +Q  S    + +  E+ V   ++AV+ +   + +
Sbjct  362  FFD-DEDAQNLTLDVSQLLGSEDALPDQEGSDQMPSSEDLEKNVAEGKEAVEKDESGEGS  420

Query  667  SSSK-PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVH  494
            SS +  + T   S  ++PF+K+ASQM G   A  +FAS+   KD  L    A Q+S SVH
Sbjct  421  SSKQDADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKDGRLH---AGQSSGSVH  474

Query  493  VTAGLIQISDLTLGS-------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFY  335
            VTAG+I+IS++ L +       K+ N N++LSF   Q      S    + G   +     
Sbjct  475  VTAGIIRISNMNLAADMGWSYDKNNNLNVVLSFGLVQRDDGMSSSVNKTGGVPATRAMLI  534

Query  334  FLLFWVLILSISVKVGTFIYAR  269
            F+  WVL+LS+S K+GT + AR
Sbjct  535  FICLWVLLLSVSFKIGTMVSAR  556


 Score = 25.8 bits (55),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 6/48 (13%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFDMFDFX*FL  843
            N + +E  +D ++    +DG +LE NDL N +       D FDF  +L
Sbjct  319  NYMPDESFIDPSNNLPLSDGLYLEGNDLGNALP------DDFDFEDYL  360



>gb|AAN46250.1| unknown protein, partial [Arabidopsis lyrata]
Length=359

 Score = 82.8 bits (203),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 95/162 (59%), Gaps = 21/162 (13%)
 Frame = -2

Query  829  DFQDML--FDSDIFIGND-EFLGEQSPSADKDACDTT------EQAVLPNEKAVDTEHKN  677
            +F+D L  FD + F  +D +F+G +    + +  D        E+ V   ++AV+ +   
Sbjct  187  NFEDYLNFFDDESFTLDDSQFMGPEDALPNLEGLDQKPTPEELEKEVAGGKEAVEEKESG  246

Query  676  DIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASS  503
            + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+   KDAA+RL+AA Q+S 
Sbjct  247  EGSSSKQDADVKDFDSASKYPFLKKTSHMLGAIPTPSSFASQFQTKDAAMRLHAA-QSSG  305

Query  502  SVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ  404
            SVHVTAG+I+IS++TL +         K+GN N++LSF   Q
Sbjct  306  SVHVTAGMIRISNMTLSADSGMGWSYDKNGNLNVVLSFGVVQ  347


 Score = 33.1 bits (74),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -1

Query  986  NCLLNEPLMDTTDRFQFNDGTFLETNDLS  900
            N L +EP MD  +    NDG +LETNDLS
Sbjct  151  NYLPDEPFMDPNNNLPLNDGLYLETNDLS  179



>gb|KHN00951.1| NAC domain-containing protein 78 [Glycine soja]
Length=479

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 124/242 (51%), Gaps = 16/242 (7%)
 Frame = -2

Query  958  TLPTDFSSMMEHFLKLMIFQILSKEIPQASTCLTSXNFYDAKDDFQDMLFDSDIFIGNDE  779
             LPTD S +  + + +      ++  P A+  L         D ++ + FDS     ++ 
Sbjct  237  NLPTDGSFLEYNDIAIGNGSRSTEADPPANDILDEYLSLPDDDIYKYISFDSPQIQESEN  296

Query  778  FLGEQ-SPSADKDA-CDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQ  605
            F+  Q SP   ++   +T ++AV+ N  + +++ +N+ +S       K      +P +KQ
Sbjct  297  FIPNQGSPFTRQNVEGETADKAVVSNHNS-ESQTRNEASSVQNTHEAKFAPGSTNPLVKQ  355

Query  604  ASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG--------  452
            A   L +IPA PA A E P K+ AL L+   Q+S   H+T G+I I+D+TL         
Sbjct  356  AYGWLASIPAAPAHAMEFPAKEIALGLHPVAQSSHPAHITTGMISITDITLRGNAMDWTM  415

Query  451  SKHGNYNIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFYFLLFWVLILSISVKVGTF  281
             K+G ++ ++S  F Q   +  +L PVS GK   +LS GW +   F VLILS+S K+G+ 
Sbjct  416  GKNGGFSTVISTGFCQPDVNSDALIPVS-GKTAFVLSHGWIFLTGFSVLILSLSCKIGSI  474

Query  280  IY  275
            +Y
Sbjct  475  MY  476



>ref|XP_003556302.1| PREDICTED: NAC domain-containing protein 78-like [Glycine max]
Length=604

 Score = 91.7 bits (226),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 75/242 (31%), Positives = 123/242 (51%), Gaps = 16/242 (7%)
 Frame = -2

Query  958  TLPTDFSSMMEHFLKLMIFQILSKEIPQASTCLTSXNFYDAKDDFQDMLFDSDIFIGNDE  779
             LPTD S +  + + +      ++  P A+  L         D ++ + FDS     ++ 
Sbjct  362  NLPTDGSFLEYNDIAIGNGSRSTEADPPANDILDEYLTLPDDDIYKYISFDSPQIQESEN  421

Query  778  FLGEQ-SPSADKDA-CDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQ  605
            F+  Q SP   ++   +T ++AV+ N  + +++ +N+ +S       K      +P +KQ
Sbjct  422  FIPNQGSPFTRQNVEGETADKAVVSNHNS-ESQTRNEASSVQNTHEAKFAPGSTNPLVKQ  480

Query  604  ASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG--------  452
            A   L  IPA PA A E P K+ AL L+   Q+S   H+T G+I I+D+TL         
Sbjct  481  AYGWLAGIPAAPAHAMEFPAKEIALGLHPVAQSSHPAHITTGMISITDITLRGNAMDWTM  540

Query  451  SKHGNYNIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFYFLLFWVLILSISVKVGTF  281
             K+G ++ ++S  F Q   +  +L PVS GK   +LS GW +   F VLILS+S K+G+ 
Sbjct  541  GKNGGFSTVISTGFCQPDVNSDALIPVS-GKTAFVLSHGWIFLTGFSVLILSLSCKIGSI  599

Query  280  IY  275
            +Y
Sbjct  600  MY  601



>gb|AHA84185.1| NAC domain-containing protein 78 [Phaseolus vulgaris]
Length=572

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 101/185 (55%), Gaps = 22/185 (12%)
 Frame = -2

Query  766  QSPSADKDACDTTEQAVLPNE---KAVDTEHKNDIASSSKP------EPTKLGSDFQHPF  614
            +S ++D +      Q  L  E   KAV ++H +D  +S +       E  KL  +  +PF
Sbjct  386  ESENSDSNQGSPLTQQTLEGETADKAVVSKHDSDAQTSKEAFSVQNREEEKLAPENSNPF  445

Query  613  IKQASQMLGNIPAPPAFASEIP-KDAALRLNAATQASSSVHVTAGLIQISDLTLG-----  452
            +K+A   L +IPA PA A E P KD  L +++A Q+S + H+T G+I I+D+T       
Sbjct  446  VKEAYGWLASIPAAPAHAFEFPAKDITLGIHSAAQSSHTAHITTGMISITDITFRGNAMD  505

Query  451  ---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGK---MLSGGWFYFLLFWVLILSISVKV  290
                K G +N  +S +FSQ   +  +L P+S GK   +LS GW +   F VLILS+S K+
Sbjct  506  WPMGKSGGFNTAISTEFSQPDVNCAALIPLS-GKTAFVLSHGWIFLTGFSVLILSLSFKI  564

Query  289  GTFIY  275
            G+ ++
Sbjct  565  GSMMH  569



>emb|CDX70227.1| BnaA10g25760D [Brassica napus]
Length=554

 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 20/146 (14%)
 Frame = -2

Query  670  ASSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  500
             SSSK +   T   SD ++PF+K++S M G    PP+FAS+   KDAA+RL+AA Q+S S
Sbjct  417  GSSSKQDADVTDFDSDSKYPFLKKSSHMFG---VPPSFASQFQTKDAAIRLHAA-QSSGS  472

Query  499  VHVTAGLIQISDLT------LG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            VHVTAG+I+IS++T      +G    K G+ N++LSF   Q   +      +S  + +  
Sbjct  473  VHVTAGMIRISNMTPAVDSDMGWAYDKSGDLNVVLSFGLVQRDDAMSKTGGISATRAM--  530

Query  346  GWFYFLLFWVLILSISVKVGTFIYAR  269
                FL  WVL+LS+S K+ T + AR
Sbjct  531  --LIFLCLWVLLLSVSFKIVTMVSAR  554



>emb|CDY14157.1| BnaC02g02740D [Brassica napus]
Length=516

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 110/206 (53%), Gaps = 49/206 (24%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D  +D Q +  D    +G++E L +Q PS              P E  ++ E ++  
Sbjct  348  NFFD-DEDAQSLSLDVSQLLGSEEGL-DQKPS--------------PEE--LEKEKESGE  389

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI--PKDAALRLNAATQASSSV  497
             SSS+ +     +D   PF+K+AS M     APP+F+S     KDAA+RL+AA Q+S SV
Sbjct  390  GSSSRQD-----ADVTDPFLKKASHMF----APPSFSSSQFQTKDAAIRLHAA-QSSGSV  439

Query  496  HVTAGLIQISDLT-------LG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            HVTAG+++IS++T       +G    K+GN NI++S          G ++  + G   + 
Sbjct  440  HVTAGMMRISNMTTLAAESSMGWSYDKNGNLNIVMSL---------GLVQSKTGGITTTR  490

Query  346  GWFYFLLFWVLILSISVKVGTFIYAR  269
                F+ FW+L+L IS K+GT + AR
Sbjct  491  AMLIFMCFWILLLYISFKIGTIVSAR  516



>ref|XP_009130822.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=566

 Score = 85.1 bits (209),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 103/197 (52%), Gaps = 15/197 (8%)
 Frame = -2

Query  832  DDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIASSS-  659
            +D Q++  D    +G+++ L EQ    ++  +    E+ V   ++AV+ +   + ++S  
Sbjct  376  EDGQNLTLDVSQLLGSEDALPEQEGGLEQIPSSGDLEKEVAQGKEAVEKDESGEGSTSKH  435

Query  658  KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGL  479
              + T   S  ++PF+K+ASQM G   A  +FAS+    A L    A Q S SVHVTAG+
Sbjct  436  DADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKARLH---AGQPSGSVHVTAGI  489

Query  478  IQISDLTLGS-------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFW  320
            I+IS++ L +       K+ N N++LSF   Q      S    + G   +     FL  W
Sbjct  490  IRISNMNLAADMGWSYDKNNNLNVVLSFGSVQRDDGMSSSVNKTGGVPATRAMLIFLCLW  549

Query  319  VLILSISVKVGTFIYAR  269
            +L+LS+S K+GT + AR
Sbjct  550  ILLLSVSFKIGTMVSAR  566


 Score = 26.6 bits (57),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 17/70 (24%)
 Frame = -1

Query  1019  ESSNSMTSESLNCLLNEPLMDT-----------TDRFQFNDGTFLETNDLSNPVEGNTSG  873
             E+SNS    + NC  + P+ DT           ++     DG +LE NDL N +      
Sbjct  307   ETSNSNVFAAENCYSDIPIDDTNYMPDESFIDPSNNLPLTDGLYLEGNDLGNALP-----  361

Query  872   FDMFDFX*FL  843
              D FDF  +L
Sbjct  362   -DDFDFEDYL  370



>emb|CDY41354.1| BnaA01g31650D [Brassica napus]
Length=537

 Score = 87.4 bits (215),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 101/200 (51%), Gaps = 22/200 (11%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+D  D  Q++ FD    +G ++ + +Q            E+      K V  E +ND A
Sbjct  353  FFDEDD--QNLTFDPSQLMGTEDVVPDQEELFQMAETKELEKEEASGGKQVVEEKENDEA  410

Query  667  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  500
              SK    + T+   D+++  +K+AS M G IP P  FASEI  KD  +RL A  Q+S S
Sbjct  411  CCSKQVNADTTEFEPDYKNSVLKKASHMFGAIPTPTEFASEILTKDGVVRLQAG-QSSGS  469

Query  499  VHVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  329
            VHV+  +I +SD  +G   SK+G+    LSF   Q    PG  E       L+     F+
Sbjct  470  VHVS--MITVSDSNMGWSYSKNGD----LSFGMVQ-ENVPGKSE-----NNLTRVMLIFI  517

Query  328  LFWVLILSISVKVGTFIYAR  269
             FWVL+LS+S KV T + +R
Sbjct  518  CFWVLVLSVSFKVSTLVSSR  537


 Score = 24.3 bits (51),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 6/31 (19%)
 Frame = -1

Query  935  NDGTFLETNDLSNPVEGNTSGFDMFDFX*FL  843
            NDG +LETNDL      N++  D F+F  +L
Sbjct  327  NDGLYLETNDL------NSTDQDGFNFEDYL  351



>ref|XP_009122601.1| PREDICTED: NAC domain-containing protein 78-like [Brassica rapa]
Length=554

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 86/146 (59%), Gaps = 20/146 (14%)
 Frame = -2

Query  670  ASSSKPEP--TKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  500
             SSSK +   T   SD ++PF+K++S M G    PP+FAS+   KDAA+RL+AA Q+S S
Sbjct  417  GSSSKQDADVTDFDSDSKYPFLKKSSHMFG---VPPSFASQFQTKDAAIRLHAA-QSSGS  472

Query  499  VHVTAGLIQISDLT------LG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG  347
            VHVTAG+I+IS++T      +G    K G+ N++LSF   Q   +       + G   + 
Sbjct  473  VHVTAGMIRISNMTPAVDSDMGWAYDKSGDLNVVLSFGLVQRDDAMSK----TGGTSATR  528

Query  346  GWFYFLLFWVLILSISVKVGTFIYAR  269
                FL  WVL+LS+S K+ T + AR
Sbjct  529  AMLIFLCLWVLLLSVSFKIVTMVSAR  554



>ref|XP_009130821.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=567

 Score = 84.7 bits (208),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 103/198 (52%), Gaps = 16/198 (8%)
 Frame = -2

Query  832  DDFQDMLFDSDIFIGNDEFLGEQSPSADK--DACDTTEQAVLPNEKAVDTEHKNDIASSS  659
            +D Q++  D    +G+++ L EQ    ++   +    E+ V   ++AV+ +   + ++S 
Sbjct  376  EDGQNLTLDVSQLLGSEDALPEQEGGLEQIQPSSGDLEKEVAQGKEAVEKDESGEGSTSK  435

Query  658  -KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAG  482
               + T   S  ++PF+K+ASQM G   A  +FAS+    A L    A Q S SVHVTAG
Sbjct  436  HDADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKARLH---AGQPSGSVHVTAG  489

Query  481  LIQISDLTLGS-------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLF  323
            +I+IS++ L +       K+ N N++LSF   Q      S    + G   +     FL  
Sbjct  490  IIRISNMNLAADMGWSYDKNNNLNVVLSFGSVQRDDGMSSSVNKTGGVPATRAMLIFLCL  549

Query  322  WVLILSISVKVGTFIYAR  269
            W+L+LS+S K+GT + AR
Sbjct  550  WILLLSVSFKIGTMVSAR  567


 Score = 26.6 bits (57),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 17/70 (24%)
 Frame = -1

Query  1019  ESSNSMTSESLNCLLNEPLMDT-----------TDRFQFNDGTFLETNDLSNPVEGNTSG  873
             E+SNS    + NC  + P+ DT           ++     DG +LE NDL N +      
Sbjct  307   ETSNSNVFAAENCYSDIPIDDTNYMPDESFIDPSNNLPLTDGLYLEGNDLGNALP-----  361

Query  872   FDMFDFX*FL  843
              D FDF  +L
Sbjct  362   -DDFDFEDYL  370



>emb|CDY11289.1| BnaA03g01250D [Brassica napus]
Length=566

 Score = 83.6 bits (205),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 107/198 (54%), Gaps = 17/198 (9%)
 Frame = -2

Query  832  DDFQDMLFDSDIFIGNDEFLGEQSPSADK-DACDTTEQAVLPNEKAVDTEHKNDIASSS-  659
            +D Q++  D    +G+++ L EQ    ++  +    E+ V   ++AV+ +   + ++S  
Sbjct  376  EDGQNLTLDVSQLLGSEDALPEQEGGLEQIPSSGDLEKEVAQGKEAVEKDESGEGSTSKH  435

Query  658  KPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAG  482
              + T   S  ++PF+K+ASQM G   A  +FAS+   KD   RL+A  Q+S SVHVTAG
Sbjct  436  DADVTDFDSASKYPFLKKASQMCG---ATSSFASQFQTKD---RLHAG-QSSGSVHVTAG  488

Query  481  LIQISDLTLGS-------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFLLF  323
            +I+IS++ L +       K+ N N++LSF   Q      S    + G   +     FL  
Sbjct  489  IIRISNMNLAADMGWSYDKNNNLNVVLSFGSVQRDDGMSSSVNKTGGVPATRAMLIFLCL  548

Query  322  WVLILSISVKVGTFIYAR  269
            W+L+LS+S K+GT + AR
Sbjct  549  WILLLSVSFKIGTMVSAR  566


 Score = 26.6 bits (57),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 17/70 (24%)
 Frame = -1

Query  1019  ESSNSMTSESLNCLLNEPLMDT-----------TDRFQFNDGTFLETNDLSNPVEGNTSG  873
             E+SNS    + NC  + P+ DT           ++     DG +LE NDL N +      
Sbjct  307   ETSNSNVFAAENCYSDIPIDDTNYMPDESFIDPSNNLPLTDGLYLEGNDLGNALP-----  361

Query  872   FDMFDFX*FL  843
              D FDF  +L
Sbjct  362   -DDFDFEDYL  370



>ref|XP_009122853.1| PREDICTED: NAC domain-containing protein 78 [Brassica rapa]
Length=537

 Score = 82.8 bits (203),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 100/200 (50%), Gaps = 22/200 (11%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIA  668
            F+D  D  Q++ FD    +G ++ + +Q            E+      K V  E +ND A
Sbjct  353  FFDEDD--QNLTFDPSQLMGTEDVVPDQEELFQMAEAKEVEKEEASGGKQVVEEKENDEA  410

Query  667  SSSK---PEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSS  500
              SK    + T+   D ++  +K+AS M G IP P  FASEI  KD  +RL A  Q+S S
Sbjct  411  CCSKQVNADTTEFEPDNKNSVLKKASHMFGAIPTPTEFASEILTKDGVVRLQAG-QSSGS  469

Query  499  VHVTAGLIQISDLTLG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGWFYFL  329
            VHV+  +I +SD  +G   SK+G+    LSF   Q    PG  E      ML      F+
Sbjct  470  VHVS--MITVSDSNMGWSYSKNGD----LSFGMVQ-ENVPGKSENNLTRMML-----IFV  517

Query  328  LFWVLILSISVKVGTFIYAR  269
             FWVL+LS+S KV T + +R
Sbjct  518  CFWVLVLSVSFKVSTLVSSR  537


 Score = 23.9 bits (50),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 6/31 (19%)
 Frame = -1

Query  935  NDGTFLETNDLSNPVEGNTSGFDMFDFX*FL  843
            NDG +LETNDL      N++  D F+F  +L
Sbjct  327  NDGLYLETNDL------NSTEQDGFNFEDYL  351



>gb|AAN46247.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46248.1| unknown protein, partial [Arabidopsis lyrata]
 gb|AAN46249.1| unknown protein, partial [Arabidopsis lyrata]
Length=359

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 76/119 (64%), Gaps = 12/119 (10%)
 Frame = -2

Query  727  EQAVLPNEKAVDTEHKNDIASSSKPEPTK-LGSDFQHPFIKQASQMLGNIPAPPAFASEI  551
            E+ V   ++AV+ +   + +SS +    K   S  ++PF+K+ S MLG IP P +FAS+ 
Sbjct  230  EKEVAGGKEAVEEKESGEGSSSKQDADVKDFDSASKYPFLKKTSHMLGAIPTPSSFASQF  289

Query  550  -PKDAALRLNAATQASSSVHVTAGLIQISDLTLGS---------KHGNYNIILSFDFSQ  404
              KDAA+RL+AA Q+S SVHVTAG+I+IS+LTL +         K+GN N++LSF   Q
Sbjct  290  QTKDAAMRLHAA-QSSGSVHVTAGMIRISNLTLAADSGMGWSYDKNGNLNVVLSFGVVQ  347



>emb|CDY61762.1| BnaAnng17650D [Brassica napus]
Length=519

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 103/204 (50%), Gaps = 44/204 (22%)
 Frame = -2

Query  850  NFYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDI  671
            NF+D  +D Q++  D    +G++E L +Q PS              P E   + E     
Sbjct  350  NFFD-DEDAQNLSLDVSQLLGSEEGL-DQKPS--------------PEELEKEKESGEGS  393

Query  670  ASSSKPEPTKLGSDFQHPFIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHV  491
            +S    + T L S  ++PF+K+AS +     A   F +   KDAA+RL+AA   S SVHV
Sbjct  394  SSKQDADVTDLDSASKYPFLKKASHIF----ASSQFQT---KDAAIRLHAAQ--SGSVHV  444

Query  490  TAGLIQISDLT-------LG---SKHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSGGW  341
            TAG+I+IS++T       +G    K+GN NI+LS          G ++  + G   +   
Sbjct  445  TAGMIRISNMTTLAADSSMGWSYDKNGNLNIVLSL---------GLVQSKTGGITATRAM  495

Query  340  FYFLLFWVLILSISVKVGTFIYAR  269
              F+ FW+L+L +S K+GT + AR
Sbjct  496  LIFMCFWILVLYVSFKIGTIVSAR  519



>gb|AAN46251.1| unknown protein, partial [Arabidopsis lyrata]
Length=359

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 11/84 (13%)
 Frame = -2

Query  625  QHPFIKQASQMLGNIPAPPAFASEI-PKDAALRLNAATQASSSVHVTAGLIQISDLTLGS  449
            ++PF+K+ S MLG IP P +FAS+   KDAA+RL+AA Q+S SVHVTAG+I+IS+LTL +
Sbjct  265  KYPFLKKTSHMLGAIPTPSSFASQFQTKDAAMRLHAA-QSSGSVHVTAGMIRISNLTLAA  323

Query  448  ---------KHGNYNIILSFDFSQ  404
                     K+GN N++LSF   Q
Sbjct  324  DSGMGWSYDKNGNLNVVLSFGVVQ  347



>gb|KDO47588.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=433

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -1

Query  1055  FDPKPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTS  876
              D +PVK EY+ +SSN + +  +N  LNEP +D TD  QF+DG +LE NDLS+ VE ++ 
Sbjct  269   MDARPVKDEYI-DSSNGVNAGGVNYFLNEPYLDATDNPQFSDGLYLEANDLSSTVEADSQ  327

Query  875   GFDMFD  858
             GFDM +
Sbjct  328   GFDMVE  333


 Score = 33.5 bits (75),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = -2

Query  850  NFYDAKDDFQDML-FDSDIFIGNDEFLGEQSPSADKDACDTTEQAVLPNEKAVDTEHKND  674
            NF+DA DD  + L FD+   +G+ +   +Q P    +  + T+Q  +  +  V+  H ND
Sbjct  337  NFFDANDDNSEYLTFDASEILGSGDNNSDQVPLT-TEVTEVTDQMSMAGQHQVEV-HGND  394

Query  673  IASSSKPEPTKLGSD  629
            +AS+S+ +P  + S+
Sbjct  395  VASTSEQKPDIVKSE  409



>ref|XP_006648145.1| PREDICTED: NAC domain-containing protein 78-like [Oryza brachyantha]
Length=636

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 14/129 (11%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  449
            F K+ + MLG+IPAPPA ASE+P      +   +A   +SS+ VTAG+IQ+  LT  GS 
Sbjct  509  FGKRLASMLGSIPAPPAMASELPPSTGKSVGPLSAVNPNSSIRVTAGIIQLGSLTFTGST  568

Query  448  ----KHGNYNIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  296
                K+G++N++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  569  ERLQKNGDFNLVLSFTV-EGDVSTKSIDFEPDRQMSTTPMVFRSGMYLFFVSAMILMLSY  627

Query  295  KVGTFIYAR  269
            KVG  IY+R
Sbjct  628  KVGLCIYSR  636



>ref|XP_010940544.1| PREDICTED: uncharacterized protein LOC105059077 [Elaeis guineensis]
Length=688

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 77/136 (57%), Gaps = 24/136 (18%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  449
              K+   MLG+I APPA A+E P  +  R+   +AT ++SS+HVT G+IQI  +T+ GS 
Sbjct  557  ITKRLVNMLGSISAPPAIAAEYPAGSEKRVGRISATHSTSSIHVTTGMIQIRGITVTGST  616

Query  448  ------KHGNYNIILSFDFSQGAQSPGSLE----------PVSHGKMLSGGWFYFLLFWV  317
                  K+G+ +++LS+  + G +   S+           PVS   +L GG + F L   
Sbjct  617  EHWSLPKNGDMSLLLSYSLA-GDEVRKSMRFDSISKLQGGPVS--MVLRGGCYLFFLS-A  672

Query  316  LILSISVKVGTFIYAR  269
            LIL+IS K+G  IY+R
Sbjct  673  LILTISYKLGLCIYSR  688



>gb|AAO72552.1| NAC-like protein [Oryza sativa Japonica Group]
Length=507

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 72/129 (56%), Gaps = 14/129 (11%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  449
            F K+ + MLG+IPAPPA ASE P      +   +A   SSS+ VTAG+IQ+  +T  GS 
Sbjct  380  FGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGITFTGST  439

Query  448  ----KHGNYNIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  296
                K+G++N++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  440  EHLQKNGDFNLLLSFTV-EGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMILMLSY  498

Query  295  KVGTFIYAR  269
            KVG  IY+R
Sbjct  499  KVGLCIYSR  507



>gb|EAY88066.1| hypothetical protein OsI_09496 [Oryza sativa Indica Group]
Length=633

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 72/129 (56%), Gaps = 14/129 (11%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  449
            F K+ + MLG+IPAPPA ASE P      +   +A   SSS+ VTAG+IQ+  +T  GS 
Sbjct  506  FGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGITFTGST  565

Query  448  ----KHGNYNIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  296
                K+G++N++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  566  ERMQKNGDFNLLLSFTV-EGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMILMLSY  624

Query  295  KVGTFIYAR  269
            KVG  IY+R
Sbjct  625  KVGLCIYSR  633



>ref|NP_001048559.1| Os02g0822400 [Oryza sativa Japonica Group]
 dbj|BAD22894.1| putative NAC2 [Oryza sativa Japonica Group]
 dbj|BAD23126.1| putative NAC2 [Oryza sativa Japonica Group]
 dbj|BAF10473.1| Os02g0822400 [Oryza sativa Japonica Group]
 gb|EAZ25123.1| hypothetical protein OsJ_08923 [Oryza sativa Japonica Group]
 dbj|BAG95424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=632

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 72/129 (56%), Gaps = 14/129 (11%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  449
            F K+ + MLG+IPAPPA ASE P      +   +A   SSS+ VTAG+IQ+  +T  GS 
Sbjct  505  FGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGITFTGST  564

Query  448  ----KHGNYNIILSFDFSQGAQSPGSL--EP---VSHGKMLSGGWFYFLLFWVLILSISV  296
                K+G++N++LSF   +G  S  S+  EP   +S   M+     Y      +IL +S 
Sbjct  565  EHLQKNGDFNLLLSFTV-EGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMILMLSY  623

Query  295  KVGTFIYAR  269
            KVG  IY+R
Sbjct  624  KVGLCIYSR  632



>ref|XP_003570443.1| PREDICTED: NAC domain-containing protein 78 [Brachypodium distachyon]
Length=648

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 15/131 (11%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTLGS--  449
            F K+ + +LG+IPAPPA ASE P      +   +A    SS+HVTAG++Q+  LT     
Sbjct  518  FGKRFASVLGSIPAPPAMASEFPPATGKSVASLSAVNGPSSIHVTAGIVQLGGLTFSGSS  577

Query  448  ------KHGNYNIILSFDFSQ--GAQSPGSLEP---VSHGKMLSGGWFYFLLFWVLILSI  302
                  K+G+++++LSF        +S G  EP   +S   M+  G  Y      +IL  
Sbjct  578  EHWPLQKNGDFSLLLSFTVESDVSTKSVGFDEPATQLSTVPMVLRGGLYLFFVSAMILMF  637

Query  301  SVKVGTFIYAR  269
            S KVG+ IY+R
Sbjct  638  SYKVGSCIYSR  648



>ref|XP_008779162.1| PREDICTED: uncharacterized protein LOC103698888 [Phoenix dactylifera]
Length=688

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 18/133 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS-  449
              K+   MLG+I APPA A+E P  +  R    + T ++SS+HVTAG+IQI  LT+ GS 
Sbjct  557  ITKRLVNMLGSISAPPAIAAEYPAGSEKRAGQISTTNSASSIHVTAGMIQIRGLTVTGST  616

Query  448  ------KHGNYNIILSFDFSQGAQSPGSLEPVSHGKMLSG-------GWFYFLLFWVLIL  308
                  K+G+   +LS+  + G +   S+   S  KM  G       G FY      L+L
Sbjct  617  EHWSLQKNGDVGFLLSYGLA-GNEVRKSILLDSISKMQGGPVSMMLRGGFYLFFLSALLL  675

Query  307  SISVKVGTFIYAR  269
            +IS K+G  IY++
Sbjct  676  TISYKMGLCIYSK  688



>ref|XP_002453065.1| hypothetical protein SORBIDRAFT_04g037720 [Sorghum bicolor]
 gb|EES06041.1| hypothetical protein SORBIDRAFT_04g037720 [Sorghum bicolor]
Length=652

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 14/130 (11%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLNA-ATQASSSVHVTAGLIQISDLTLGS---  449
            + K+ + MLG+IPAPPA ASE P      +   +  +SSS+ VTAG+IQ+  LT  S   
Sbjct  523  YGKRLASMLGSIPAPPAMASEFPPSTGKSVGMLSAVSSSSIRVTAGIIQLDGLTFSSGSD  582

Query  448  -----KHGNYNIILSFDFSQGAQS--PGSLE---PVSHGKMLSGGWFYFLLFWVLILSIS  299
                 K+G+ ++++SF       S  P  LE    +S   M+    FY      +IL +S
Sbjct  583  RWPLQKNGDLSLLVSFAVESDVSSKLPVGLEDATRISTVPMVMRSGFYLFFMSAMILLLS  642

Query  298  VKVGTFIYAR  269
             KVG+ IY+R
Sbjct  643  YKVGSCIYSR  652



>ref|XP_008787444.1| PREDICTED: NAC domain-containing protein 78 [Phoenix dactylifera]
Length=661

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 73/134 (54%), Gaps = 23/134 (17%)
 Frame = -2

Query  610  KQASQMLGNIPAPPAFASEIP---KDAALRLNAATQASSSVHVTAGLIQISDLTLGS---  449
            K+   MLG+I APPA A+E P    +  +   + T ++SSVHVTAG+IQI DLT+     
Sbjct  531  KRLVNMLGSISAPPALAAEYPVGRSEKPVGQISETHSASSVHVTAGMIQIRDLTVTGHTK  590

Query  448  -----KHGNYNIILSFDFSQGAQSPGSL--EPVSHGKMLSG-------GWFYFLLFWVLI  311
                 K+G+ + +LS+  + G +   S+  +P+S  KM  G       G FY      LI
Sbjct  591  HWSLQKNGDADFLLSYSMA-GNEVSNSIGFDPIS--KMQGGPLSVVLRGGFYLFFLSALI  647

Query  310  LSISVKVGTFIYAR  269
            L++S +VG  I +R
Sbjct  648  LTVSYRVGLCICSR  661



>gb|ACF82881.1| unknown [Zea mays]
Length=258

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 80/184 (43%), Gaps = 41/184 (22%)
 Frame = -2

Query  772  GEQSPSADKDACDTTEQAVLPNEKAVDTEHKNDIASSSKPEPTKLGSDFQHPFIKQASQM  593
            G  S  + +D    TE   +P +   D  + N +AS                       M
Sbjct  100  GASSSGSHEDLYTDTEFLGVPTDDTADKTYGNRLAS-----------------------M  136

Query  592  LGNIPAPPAFASEIP---KDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------K  446
            LG+IPAPPA ASE P     +A  L+A +  SSS+  TAG+IQ+  LT  S        K
Sbjct  137  LGSIPAPPAMASEFPPSTGKSAGMLSAVS--SSSIRFTAGIIQLDGLTFSSGSGQWPLQK  194

Query  445  HGNYNIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLILSISVKVGTF  281
            +G+ ++++SF       S      G    +S   M+    FY      +IL  S KVG+ 
Sbjct  195  NGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMILLFSYKVGSC  254

Query  280  IYAR  269
            IY+R
Sbjct  255  IYSR  258



>ref|XP_009418258.1| PREDICTED: uncharacterized protein LOC103998499 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 21/128 (16%)
 Frame = -2

Query  598  QMLGNIPAPPAFASEIPKDAALRL--NAATQASSSVHVTAGLIQISDLTLGS--------  449
             MLG+IPAPPAFA+E P  AA  +   +A   +SS+HVT G + I D T+          
Sbjct  551  NMLGSIPAPPAFAAEYPAGAAKSMAQTSAVHPASSIHVTTGFVYICDPTVSGSVGHWSLQ  610

Query  448  KHGNYNIILSFDFSQGAQ--------SPGSLEPVSHGKMLSGGWFYFLLFWVLILSISVK  293
            K+G+ + ILS+  +            S   ++ VS   +L GG  Y L    L L+IS K
Sbjct  611  KNGHASFILSYRMADNVSRKTSDFVPSKNQVDAVS--VVLRGG-LYVLFLLPLFLTISYK  667

Query  292  VGTFIYAR  269
            VG  I  R
Sbjct  668  VGITICGR  675



>ref|XP_004954444.1| PREDICTED: NAC domain-containing protein 78-like [Setaria italica]
Length=638

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 13/129 (10%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKDAALRLNAATQAS-SSVHVTAGLIQISDLTLGS---  449
            F K+ + MLG+IPAPPA ASE P      +   +  S SS+ VTAG+IQ+  L+      
Sbjct  510  FGKRFAGMLGSIPAPPAMASEFPPATGKSVGVLSAVSPSSIRVTAGIIQLDGLSFTGASE  569

Query  448  -----KHGNYNIILSF----DFSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLILSISV  296
                 K+G+++++LSF    D S  A        +S   M+     Y      +IL +S 
Sbjct  570  RWPLQKNGDFSLLLSFTVESDMSTKAACFEQASRMSTIPMVLRSGMYLFFVSAMILVLSY  629

Query  295  KVGTFIYAR  269
            K+G+ IY+R
Sbjct  630  KIGSCIYSR  638



>gb|EMS63008.1| NAC domain-containing protein 78 [Triticum urartu]
Length=628

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 63/126 (50%), Gaps = 16/126 (13%)
 Frame = -2

Query  601  SQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTL----GS----K  446
            + MLG+ PAPPA ASE P      + AA    S + VTAG++Q+ D +     GS    K
Sbjct  504  TNMLGSYPAPPAMASEFPPTTGKSI-AALSGPSQIRVTAGIVQLGDHSFTGNEGSWPLQK  562

Query  445  HGNYNIILSFDFSQGAQSPGSL---EP----VSHGKMLSGGWFYFLLFWVLILSISVKVG  287
            +G +N++LSF       +       EP    VS   M+  G  Y      +IL +S KVG
Sbjct  563  NGVFNLLLSFTVENNVSTKSITFDDEPAATRVSTVPMVLRGGLYLFFVSAMILMLSFKVG  622

Query  286  TFIYAR  269
            + IY+R
Sbjct  623  SCIYSR  628



>ref|XP_010935812.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Elaeis 
guineensis]
Length=689

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 20/132 (15%)
 Frame = -2

Query  610  KQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS---  449
            K+   MLG+I APPA A+E P  +   +   + T ++SS+H TAG+IQI  LT+ GS   
Sbjct  560  KRLVNMLGSISAPPAIAAEYPVRSEKPVGQISETHSASSIHFTAGMIQIRGLTVTGSTEH  619

Query  448  ----KHGNYNIILSF--DFSQGAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILS  305
                K+G+ + +LS+  D  +  +S G  EP+S  +      +L GG FY      LIL+
Sbjct  620  WSLQKNGDVDFLLSYGMDGDEARKSIG-FEPISKIQGGLASVVLRGG-FYLFFLSALILT  677

Query  304  ISVKVGTFIYAR  269
            +S  VG  I +R
Sbjct  678  VSYGVGLCICSR  689



>ref|XP_010935813.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Elaeis 
guineensis]
Length=668

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 20/132 (15%)
 Frame = -2

Query  610  KQASQMLGNIPAPPAFASEIPKDAALRLN--AATQASSSVHVTAGLIQISDLTL-GS---  449
            K+   MLG+I APPA A+E P  +   +   + T ++SS+H TAG+IQI  LT+ GS   
Sbjct  539  KRLVNMLGSISAPPAIAAEYPVRSEKPVGQISETHSASSIHFTAGMIQIRGLTVTGSTEH  598

Query  448  ----KHGNYNIILSF--DFSQGAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILS  305
                K+G+ + +LS+  D  +  +S G  EP+S  +      +L GG FY      LIL+
Sbjct  599  WSLQKNGDVDFLLSYGMDGDEARKSIG-FEPISKIQGGLASVVLRGG-FYLFFLSALILT  656

Query  304  ISVKVGTFIYAR  269
            +S  VG  I +R
Sbjct  657  VSYGVGLCICSR  668



>gb|EMT07836.1| hypothetical protein F775_28266 [Aegilops tauschii]
Length=559

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 18/127 (14%)
 Frame = -2

Query  601  SQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTL----GS----K  446
            + MLG+ PAPPA ASE P      + AA    S + VTAG++Q+ D +     GS    K
Sbjct  404  TNMLGSYPAPPAMASEFPPTTGKSI-AALSGPSQIRVTAGIVQLGDHSFTGNEGSWPLQK  462

Query  445  HGNYNIILSFDFSQGAQS--------PGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKV  290
            +G +N++LSF       +        P +    +   +L GG + F +   +IL +S KV
Sbjct  463  NGVFNLLLSFTVESNVSTKSISFGDEPATTRVSAVPTVLRGGLYLFFV-SAMILMLSFKV  521

Query  289  GTFIYAR  269
            G+ IY+R
Sbjct  522  GSCIYSR  528



>gb|ACN34478.1| unknown [Zea mays]
Length=524

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 18/132 (14%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIPKD---AALRLNAATQASSSVHVTAGLIQISDLTLGS-  449
            +  + + MLG+IPAPPA ASE P     +A  L+A +  SSS+  TAG+IQ+  LT  S 
Sbjct  395  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGMLSAVS--SSSIRFTAGIIQLDGLTFSSG  452

Query  448  -------KHGNYNIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLILS  305
                   K+G+ ++++SF       S      G    +S   M+    FY      +IL 
Sbjct  453  SGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMILL  512

Query  304  ISVKVGTFIYAR  269
             S KVG+ IY+R
Sbjct  513  FSYKVGSCIYSR  524



>dbj|BAJ97673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=641

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 18/127 (14%)
 Frame = -2

Query  601  SQMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------K  446
            + MLG+ PAPPA ASE P      + AA    S + VTAG++Q+ D +           K
Sbjct  517  ANMLGSYPAPPAMASEFPPTTGKSI-AALSGPSQIRVTAGIVQLGDHSFTGNSDNWPLQK  575

Query  445  HGNYNIILSFDFSQGAQS--------PGSLEPVSHGKMLSGGWFYFLLFWVLILSISVKV  290
            +G +N++LSF       +        P +    +   +L GG + F +   +IL +S KV
Sbjct  576  NGVFNLLLSFTVESNVSTKLIGFDDEPATTRVSTVPTVLRGGLYLFFVS-AMILMLSFKV  634

Query  289  GTFIYAR  269
            G+ IY+R
Sbjct  635  GSCIYSR  641



>ref|XP_008677410.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Zea mays]
Length=551

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP----KDAALRLNAATQASSSVHVTAGLIQISDLTLGS  449
            +  + + MLG+IPAPPA ASE P    K A + L+A +  SSS+  TAG+IQ+  LT  S
Sbjct  422  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGM-LSAVS--SSSIRFTAGIIQLDGLTFSS  478

Query  448  --------KHGNYNIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLIL  308
                    K+G+ ++++SF       S      G    +S   M+    FY      +IL
Sbjct  479  GSGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMIL  538

Query  307  SISVKVGTFIYAR  269
              S KVG+ IY+R
Sbjct  539  LFSYKVGSCIYSR  551



>gb|ACN28830.1| unknown [Zea mays]
 gb|AFW63946.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|AIB04476.1| NAC transcription factor, partial [Zea mays]
Length=657

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP----KDAALRLNAATQASSSVHVTAGLIQISDLTLGS  449
            +  + + MLG+IPAPPA ASE P    K A + L+A +  SSS+  TAG+IQ+  LT  S
Sbjct  528  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGM-LSAVS--SSSIRFTAGIIQLDGLTFSS  584

Query  448  --------KHGNYNIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLIL  308
                    K+G+ ++++SF       S      G    +S   M+    FY      +IL
Sbjct  585  GSGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMIL  644

Query  307  SISVKVGTFIYAR  269
              S KVG+ IY+R
Sbjct  645  LFSYKVGSCIYSR  657



>ref|NP_001152531.1| NAC domain-containing protein 78 [Zea mays]
 gb|ACG48054.1| NAC domain-containing protein 78 [Zea mays]
Length=657

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -2

Query  616  FIKQASQMLGNIPAPPAFASEIP----KDAALRLNAATQASSSVHVTAGLIQISDLTLGS  449
            +  + + MLG+IPAPPA ASE P    K A + L+A +  SSS+  TAG+IQ+  LT  S
Sbjct  528  YGNRLASMLGSIPAPPAMASEFPPSTGKSAGM-LSAVS--SSSIRFTAGIIQLDGLTFSS  584

Query  448  --------KHGNYNIILSFDFSQGAQSP-----GSLEPVSHGKMLSGGWFYFLLFWVLIL  308
                    K+G+ ++++SF       S      G    +S   M+    FY      +IL
Sbjct  585  GSGQWPLQKNGDLSLLVSFAVEGDVASKLPVGLGRATRISTVPMVLRSGFYLFFMSAMIL  644

Query  307  SISVKVGTFIYAR  269
              S KVG+ IY+R
Sbjct  645  LFSYKVGSCIYSR  657



>ref|XP_009418629.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 28/126 (22%)
 Frame = -2

Query  598  QMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------KH  443
             MLG+I APPAFA+E P  A+L          S HVT G++ +  L+  S        K+
Sbjct  544  NMLGSISAPPAFAAEYP--ASLE---------STHVTVGMVDVHGLSATSSTGHCSLQKN  592

Query  442  GNYNIILSFDFSQ--GAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILSISVKVG  287
            GN +++LS+  ++  G +     +P    +      +L GG + F L   L+L+IS KVG
Sbjct  593  GNGDLLLSYSIAENLGRKKSSGFQPFRKIQDWTVSFLLRGGCYPFFLS-ALVLTISYKVG  651

Query  286  TFIYAR  269
              IY +
Sbjct  652  MCIYGK  657



>ref|XP_009418630.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 28/126 (22%)
 Frame = -2

Query  598  QMLGNIPAPPAFASEIPKDAALRLNAATQASSSVHVTAGLIQISDLTLGS--------KH  443
             MLG+I APPAFA+E P  A+L          S HVT G++ +  L+  S        K+
Sbjct  503  NMLGSISAPPAFAAEYP--ASLE---------STHVTVGMVDVHGLSATSSTGHCSLQKN  551

Query  442  GNYNIILSFDFSQ--GAQSPGSLEPVSHGK------MLSGGWFYFLLFWVLILSISVKVG  287
            GN +++LS+  ++  G +     +P    +      +L GG + F L   L+L+IS KVG
Sbjct  552  GNGDLLLSYSIAENLGRKKSSGFQPFRKIQDWTVSFLLRGGCYPFFLS-ALVLTISYKVG  610

Query  286  TFIYAR  269
              IY +
Sbjct  611  MCIYGK  616



>ref|XP_009383926.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 64/134 (48%), Gaps = 23/134 (17%)
 Frame = -2

Query  610  KQASQMLGNIPAPPAFASEIPKDAALRLNA--ATQASSSVHVTAGLIQISDLTLGS----  449
            K    MLG+IPAPPA A+E P  +   +       ++SS+HVTAG   I   T+      
Sbjct  514  KHLLNMLGSIPAPPACAAEFPSGSGKSVAQIPGNHSASSIHVTAGFFHICGSTMSENAGY  573

Query  448  ----KHGNYNIILSFD----------FSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLI  311
                K+G+ ++ILS++             G  +   ++ VS   ML  G + F L   LI
Sbjct  574  WSLQKNGHVDLILSYNSMADNLVRKTVGPGCIAKNQVDVVS--VMLRVGLYVFFLS-ALI  630

Query  310  LSISVKVGTFIYAR  269
            L+IS KVG  I  R
Sbjct  631  LTISHKVGMSICGR  644



>ref|XP_009383919.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=672

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 64/134 (48%), Gaps = 23/134 (17%)
 Frame = -2

Query  610  KQASQMLGNIPAPPAFASEIPKDAALRLNA--ATQASSSVHVTAGLIQISDLTLGS----  449
            K    MLG+IPAPPA A+E P  +   +       ++SS+HVTAG   I   T+      
Sbjct  542  KHLLNMLGSIPAPPACAAEFPSGSGKSVAQIPGNHSASSIHVTAGFFHICGSTMSENAGY  601

Query  448  ----KHGNYNIILSFD----------FSQGAQSPGSLEPVSHGKMLSGGWFYFLLFWVLI  311
                K+G+ ++ILS++             G  +   ++ VS   ML  G + F L   LI
Sbjct  602  WSLQKNGHVDLILSYNSMADNLVRKTVGPGCIAKNQVDVVS--VMLRVGLYVFFLS-ALI  658

Query  310  LSISVKVGTFIYAR  269
            L+IS KVG  I  R
Sbjct  659  LTISHKVGMSICGR  672



>ref|XP_007010051.1| NAC domain containing protein 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18861.1| NAC domain containing protein 2, putative isoform 2 [Theobroma 
cacao]
Length=423

 Score = 52.4 bits (124),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -1

Query  1046  KPVKREYMGESSNSMTSESLNCLLNEPLMDTTDRFQFNDGTFLETNDLSNPVEGNTSGFD  867
             KPVK EY+ E   ++     N  L+EP +D TD    NDG FLE NDLSNP+   +  FD
Sbjct  319   KPVKDEYVVEPIENVNPADNNYFLDEPYLDVTDYLPANDGFFLEANDLSNPIGPESDVFD  378


 Score = 21.9 bits (45),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 2/32 (6%)
 Frame = -2

Query  847  FYDAKDDFQDMLFDSDIFIGNDEFLGEQSPSA  752
            F DA D  Q + FDSD  +G++  + +Q P A
Sbjct  385  FIDADD--QPLAFDSDQMVGSEIPVSDQEPLA  414



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2964304573080