BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8590

Length=944
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012082736.1|  PREDICTED: DNA mismatch repair protein PMS1        367   2e-115   Jatropha curcas
ref|XP_006444299.1|  hypothetical protein CICLE_v100188991mg            348   5e-114   
gb|KDO87272.1|  hypothetical protein CISIN_1g0414662mg                  340   1e-113   Citrus sinensis [apfelsine]
emb|CDP03504.1|  unnamed protein product                                362   1e-113   Coffea canephora [robusta coffee]
ref|XP_009598045.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    360   5e-113   Nicotiana tomentosiformis
ref|XP_009598044.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    360   5e-113   Nicotiana tomentosiformis
ref|XP_011079684.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    355   4e-111   
ref|XP_011079683.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    355   5e-111   Sesamum indicum [beniseed]
ref|XP_006359387.1|  PREDICTED: DNA mismatch repair protein PMS1-...    354   1e-110   Solanum tuberosum [potatoes]
gb|EYU46682.1|  hypothetical protein MIMGU_mgv1a024383mg                352   2e-110   Erythranthe guttata [common monkey flower]
ref|XP_004247536.1|  PREDICTED: DNA mismatch repair protein PMS1        351   2e-109   Solanum lycopersicum
ref|XP_010269535.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    348   2e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010269534.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    348   2e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010684604.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    344   7e-108   
ref|XP_006480112.1|  PREDICTED: DNA mismatch repair protein PMS1-...    348   2e-107   
ref|XP_008451591.1|  PREDICTED: DNA mismatch repair protein PMS1        345   3e-107   Cucumis melo [Oriental melon]
ref|XP_010684598.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    344   5e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003591551.1|  DNA mismatch repair protein                        343   2e-106   Medicago truncatula
ref|XP_011659356.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    342   3e-106   Cucumis sativus [cucumbers]
ref|XP_006575115.1|  PREDICTED: DNA mismatch repair protein PMS1-...    339   6e-105   Glycine max [soybeans]
ref|XP_003536886.1|  PREDICTED: DNA mismatch repair protein PMS1-...    337   3e-104   Glycine max [soybeans]
gb|AFW62793.1|  hypothetical protein ZEAMMB73_370746                    314   1e-103   
ref|XP_002523056.1|  DNA mismatch repair protein pms2, putative         334   5e-103   
ref|XP_004495972.1|  PREDICTED: DNA mismatch repair protein PMS1-...    333   1e-102   Cicer arietinum [garbanzo]
emb|CBI36837.3|  unnamed protein product                                329   7e-102   Vitis vinifera
ref|XP_010652177.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    330   2e-101   
ref|XP_007199731.1|  hypothetical protein PRUPE_ppa002523mg             323   3e-101   
ref|XP_010652175.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    330   4e-101   Vitis vinifera
gb|EPS64298.1|  hypothetical protein M569_10482                         327   5e-101   Genlisea aurea
ref|XP_010088502.1|  Mismatch repair endonuclease PMS2                  328   7e-101   Morus notabilis
gb|KHG16579.1|  Mismatch repair endonuclease PMS2                       328   2e-100   Gossypium arboreum [tree cotton]
gb|KHN03729.1|  Mismatch repair endonuclease PMS2                       325   2e-100   Glycine soja [wild soybean]
emb|CAN75888.1|  hypothetical protein VITISV_023640                     336   3e-100   Vitis vinifera
ref|XP_006840542.1|  PREDICTED: DNA mismatch repair protein PMS1        327   3e-100   Amborella trichopoda
ref|XP_008386660.1|  PREDICTED: DNA mismatch repair protein PMS1        327   5e-100   
gb|KJB49940.1|  hypothetical protein B456_008G146300                    327   6e-100   Gossypium raimondii
ref|XP_007144293.1|  hypothetical protein PHAVU_007G144100g             325   8e-100   Phaseolus vulgaris [French bean]
ref|XP_007050886.1|  DNA mismatch repair protein, putative isoform 2    322   4e-99    
ref|XP_010038198.1|  PREDICTED: DNA mismatch repair protein PMS1        322   1e-98    Eucalyptus grandis [rose gum]
ref|XP_008235055.1|  PREDICTED: DNA mismatch repair protein PMS1        323   2e-98    Prunus mume [ume]
ref|XP_010914441.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    320   6e-98    
ref|XP_010914440.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    320   6e-98    Elaeis guineensis
ref|XP_010914439.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    320   1e-97    Elaeis guineensis
ref|XP_010914434.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    320   1e-97    
ref|XP_011033556.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    317   1e-97    Populus euphratica
ref|XP_002321013.1|  DNA mismatch repair family protein                 319   2e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010429737.1|  PREDICTED: DNA mismatch repair protein PMS1-...    306   2e-97    
ref|XP_007050885.1|  DNA mismatch repair protein pms2, putative i...    320   2e-97    
ref|XP_011458719.1|  PREDICTED: DNA mismatch repair protein PMS1        319   3e-97    Fragaria vesca subsp. vesca
ref|XP_011033555.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    317   6e-97    Populus euphratica
gb|KHN46574.1|  Mismatch repair endonuclease PMS2                       318   6e-97    Glycine soja [wild soybean]
ref|XP_008678747.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    318   1e-96    Zea mays [maize]
ref|XP_008805742.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    317   1e-96    
ref|XP_009405473.1|  PREDICTED: DNA mismatch repair protein PMS1        316   2e-96    
ref|XP_010522786.1|  PREDICTED: DNA mismatch repair protein PMS1        316   3e-96    Tarenaya hassleriana [spider flower]
ref|NP_001047292.1|  Os02g0592300                                       314   2e-95    
gb|KFK30838.1|  hypothetical protein AALP_AA6G032200                    307   3e-95    Arabis alpina [alpine rockcress]
ref|XP_006647441.1|  PREDICTED: DNA mismatch repair protein PMS1-...    313   4e-95    Oryza brachyantha
ref|XP_003575262.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    312   6e-95    Brachypodium distachyon [annual false brome]
ref|XP_010422584.1|  PREDICTED: DNA mismatch repair protein PMS1-...    309   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_006287017.1|  hypothetical protein CARUB_v10000165mg             307   5e-93    Capsella rubella
ref|XP_010456026.1|  PREDICTED: DNA mismatch repair protein PMS1-...    307   6e-93    
gb|EMT21505.1|  Mismatch repair endonuclease PMS2                       310   2e-92    
ref|XP_009144562.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    302   3e-91    Brassica rapa
ref|XP_009144561.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    302   3e-91    Brassica rapa
emb|CDX91318.1|  BnaC02g27290D                                          301   5e-91    
gb|AAC19275.1|  T14P8.6                                                 299   6e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567236.1|  DNA mismatch repair protein PMS1                      301   1e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDX97265.1|  BnaA02g20560D                                          301   6e-90    
ref|XP_006396455.1|  hypothetical protein EUTSA_v10028404mg             296   7e-89    Eutrema salsugineum [saltwater cress]
ref|XP_002872835.1|  hypothetical protein ARALYDRAFT_490319             296   8e-89    
gb|KCW50018.1|  hypothetical protein EUGRSUZ_K03466                     275   3e-81    Eucalyptus grandis [rose gum]
ref|XP_008678748.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    265   2e-77    Zea mays [maize]
ref|XP_009791019.1|  PREDICTED: DNA mismatch repair protein PMS1        263   1e-76    Nicotiana sylvestris
ref|XP_002985153.1|  hypothetical protein SELMODRAFT_121896             258   4e-76    
ref|XP_002969817.1|  hypothetical protein SELMODRAFT_171139             256   2e-75    
ref|XP_001785478.1|  predicted protein                                  252   2e-73    
ref|XP_010467035.1|  PREDICTED: DNA mismatch repair protein PMS1        247   4e-71    
ref|XP_004955044.1|  PREDICTED: DNA mismatch repair protein PMS1-...    236   3e-67    
ref|XP_004347900.2|  hypothetical protein CAOG_04075                    217   8e-60    Capsaspora owczarzaki ATCC 30864
ref|XP_005650783.1|  hypothetical protein COCSUDRAFT_83614              201   1e-59    Coccomyxa subellipsoidea C-169
gb|KJE93263.1|  hypothetical protein CAOG_004075                        217   1e-59    Capsaspora owczarzaki ATCC 30864
gb|ETO59393.1|  hypothetical protein, variant 3                         210   4e-59    Phytophthora parasitica P1976
gb|ETI30640.1|  hypothetical protein, variant 2                         211   7e-59    Phytophthora parasitica P1569
gb|ETL77708.1|  hypothetical protein, variant 2                         211   8e-59    Phytophthora parasitica
gb|ETM30973.1|  hypothetical protein, variant 3                         211   9e-59    Phytophthora parasitica
gb|ETK71043.1|  hypothetical protein, variant 2                         211   9e-59    Phytophthora parasitica
gb|AFW62792.1|  hypothetical protein ZEAMMB73_370746                    202   9e-59    
ref|XP_005838471.1|  Pms1 mismatch repair mutL                          210   1e-58    Guillardia theta CCMP2712
gb|ETI30638.1|  hypothetical protein F443_22254                         211   1e-58    Phytophthora parasitica P1569
ref|XP_002998214.1|  mismatch repair endonuclease pms1, putative        210   1e-58    Phytophthora infestans T30-4
gb|ETP28587.1|  hypothetical protein F442_22125                         211   1e-58    Phytophthora parasitica P10297
gb|ETM30970.1|  hypothetical protein L914_21370                         211   1e-58    Phytophthora parasitica
gb|ETL77706.1|  hypothetical protein L917_21365                         211   2e-58    Phytophthora parasitica
gb|ETK71041.1|  hypothetical protein L915_21644                         211   2e-58    Phytophthora parasitica
gb|ETO59390.1|  hypothetical protein F444_22247                         211   2e-58    Phytophthora parasitica P1976
gb|ETP28589.1|  hypothetical protein, variant 2                         211   2e-58    Phytophthora parasitica P10297
gb|ETL24487.1|  hypothetical protein, variant 2                         211   3e-58    Phytophthora parasitica
ref|XP_008861480.1|  hypothetical protein H310_00455                    210   6e-58    Aphanomyces invadans
ref|XP_002595431.1|  hypothetical protein BRAFLDRAFT_69263              197   1e-57    Branchiostoma floridae
ref|XP_008915524.1|  hypothetical protein, variant 2                    208   1e-57    Phytophthora parasitica INRA-310
ref|XP_008915522.1|  hypothetical protein PPTG_18950                    208   2e-57    Phytophthora parasitica INRA-310
ref|XP_004342239.1|  DNA mismatch repair protein, C-terminal doma...    209   3e-57    Acanthamoeba castellanii str. Neff
ref|XP_009822432.1|  hypothetical protein, variant                      204   1e-56    Aphanomyces astaci
dbj|GAM22137.1|  hypothetical protein SAMD00019534_053120               206   2e-56    Acytostelium subglobosum LB1
gb|EKC38171.1|  Mismatch repair endonuclease PMS2                       205   3e-56    Crassostrea gigas
ref|XP_011417733.1|  PREDICTED: mismatch repair endonuclease PMS2...    205   4e-56    
ref|XP_009822431.1|  hypothetical protein H257_01095                    204   5e-56    Aphanomyces astaci
ref|XP_001660584.1|  AAEL010033-PA                                      204   6e-56    
ref|XP_008618743.1|  hypothetical protein SDRG_14397                    203   7e-56    Saprolegnia diclina VS20
ref|XP_001663861.1|  AAEL013690-PA                                      204   9e-56    
ref|XP_010201153.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   1e-55    Colius striatus
ref|XP_009450861.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   1e-55    
gb|AAI39775.1|  Pms2 protein                                            190   2e-55    Mus musculus [mouse]
gb|ELT88556.1|  hypothetical protein CAPTEDRAFT_218769                  197   3e-55    Capitella teleta
gb|KDO31448.1|  hypothetical protein SPRG_04063                         201   5e-55    Saprolegnia parasitica CBS 223.65
ref|XP_002508138.1|  DNA mismatch repair protein-MLH2/PMS1/Pms2 f...    201   6e-55    Micromonas commoda
dbj|BAC81643.1|  PMS2-C terminal -like                                  188   7e-55    Homo sapiens [man]
gb|EHJ64985.1|  putative DNA mismatch repair protein pms2               201   8e-55    
ref|XP_011561970.1|  PREDICTED: mismatch repair endonuclease PMS2       199   3e-54    Plutella xylostella [cabbage moth]
gb|EFA00116.1|  hypothetical protein TcasGA2_TC002932                   198   8e-54    
ref|XP_003961536.1|  PREDICTED: mismatch repair endonuclease PMS2       198   1e-53    
ref|XP_008190970.1|  PREDICTED: mismatch repair endonuclease PMS2       198   1e-53    Tribolium castaneum [rust-red flour beetle]
emb|CAG04443.1|  unnamed protein product                                198   1e-53    Tetraodon nigroviridis
ref|XP_001626114.1|  predicted protein                                  197   1e-53    Nematostella vectensis
ref|XP_003243755.1|  PREDICTED: mismatch repair endonuclease PMS2       195   2e-53    
ref|XP_006265348.1|  PREDICTED: mismatch repair endonuclease PMS2       197   3e-53    Alligator mississippiensis
ref|XP_003388127.1|  PREDICTED: mismatch repair endonuclease PMS2...    196   3e-53    
ref|XP_004691992.1|  PREDICTED: mismatch repair endonuclease PMS2       192   4e-53    
dbj|BAD89426.1|  postmeiotic segregation increased 2 nirs variant 2     191   5e-53    Homo sapiens [man]
ref|XP_002617364.1|  hypothetical protein CLUG_02808                    196   5e-53    Clavispora lusitaniae ATCC 42720
ref|XP_007339460.1|  hypothetical protein AURDEDRAFT_55752              185   5e-53    
ref|XP_004997038.1|  Pms2 protein                                       196   7e-53    Salpingoeca rosetta
ref|XP_009450859.1|  PREDICTED: mismatch repair endonuclease PMS2...    184   7e-53    
ref|XP_008162801.1|  PREDICTED: mismatch repair endonuclease PMS2       193   1e-52    Chrysemys picta bellii
ref|XP_005697949.1|  PREDICTED: mismatch repair endonuclease PMS2       195   1e-52    
ref|XP_006031530.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    195   1e-52    
ref|XP_001623519.1|  predicted protein                                  194   2e-52    Nematostella vectensis
ref|XP_007498329.1|  PREDICTED: mismatch repair endonuclease PMS2       194   2e-52    Monodelphis domestica
ref|XP_005902992.1|  PREDICTED: mismatch repair endonuclease PMS2       194   2e-52    Bos mutus
ref|NP_001192867.1|  mismatch repair endonuclease PMS2                  194   2e-52    Bos taurus [bovine]
ref|XP_007425217.1|  PREDICTED: mismatch repair endonuclease PMS2       194   2e-52    Python bivittatus
ref|XP_006097753.1|  PREDICTED: mismatch repair endonuclease PMS2       194   2e-52    Myotis lucifugus
ref|XP_010844057.1|  PREDICTED: mismatch repair endonuclease PMS2       194   2e-52    Bison bison bison
gb|KGL83152.1|  Mismatch repair endonuclease PMS2                       194   2e-52    Tinamus guttatus
ref|XP_006765487.1|  PREDICTED: mismatch repair endonuclease PMS2       194   2e-52    Myotis davidii
ref|XP_004021103.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   2e-52    Ovis aries [domestic sheep]
ref|XP_006044367.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   2e-52    
ref|XP_011996895.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   2e-52    Ovis aries musimon
ref|XP_011996896.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   2e-52    Ovis aries musimon
ref|XP_011960028.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   3e-52    Ovis aries [domestic sheep]
ref|XP_005982161.1|  PREDICTED: mismatch repair endonuclease PMS2       194   3e-52    Pantholops hodgsonii [Tibetan antelope]
emb|CDK28467.1|  unnamed protein product                                194   3e-52    Kuraishia capsulata CBS 1993
ref|XP_005879477.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   3e-52    Myotis brandtii
ref|XP_005225190.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   3e-52    Bos taurus [bovine]
ref|XP_008154252.1|  PREDICTED: mismatch repair endonuclease PMS2       194   3e-52    
gb|KFP11708.1|  Mismatch repair endonuclease PMS2                       194   3e-52    Egretta garzetta
gb|KFV60132.1|  Mismatch repair endonuclease PMS2                       192   3e-52    Tyto alba [Schleiereule]
gb|ETN61231.1|  DNA mismatch repair protein pms2                        194   3e-52    Anopheles darlingi [American malaria mosquito]
ref|XP_308635.4|  AGAP007126-PA                                         194   3e-52    Anopheles gambiae str. PEST
gb|KFB50618.1|  AGAP007126-PA-like protein                              194   3e-52    Anopheles sinensis
ref|XP_005879476.1|  PREDICTED: mismatch repair endonuclease PMS2...    194   4e-52    
ref|XP_006715807.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   4e-52    Homo sapiens [man]
ref|XP_002932025.1|  PREDICTED: mismatch repair endonuclease PMS2       193   5e-52    Xenopus tropicalis [western clawed frog]
gb|EMC89990.1|  Mismatch repair endonuclease PMS2                       194   5e-52    
ref|XP_009065197.1|  hypothetical protein LOTGIDRAFT_108533             193   5e-52    Lottia gigantea
ref|NP_001099378.1|  mismatch repair endonuclease PMS2                  190   5e-52    Rattus norvegicus [brown rat]
emb|CBJ31872.1|  postmeiotic segregation increased 2                    194   6e-52    Ectocarpus siliculosus
ref|XP_007320377.1|  hypothetical protein SERLADRAFT_471892             185   6e-52    Serpula lacrymans var. lacrymans S7.9
gb|KFO79942.1|  Mismatch repair endonuclease PMS2                       193   6e-52    Cuculus canorus
gb|ETE59428.1|  Mismatch repair endonuclease PMS2                       192   6e-52    Ophiophagus hannah
gb|KFP92882.1|  Mismatch repair endonuclease PMS2                       193   7e-52    Haliaeetus albicilla
ref|XP_007525140.1|  PREDICTED: mismatch repair endonuclease PMS2       193   7e-52    Erinaceus europaeus [common hedgehog]
gb|KFQ67704.1|  Mismatch repair endonuclease PMS2                       193   7e-52    Phaethon lepturus
emb|CCI43565.1|  unnamed protein product                                192   7e-52    Albugo candida
ref|XP_006637418.1|  PREDICTED: mismatch repair endonuclease PMS2...    193   7e-52    
ref|XP_007060701.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    193   7e-52    
gb|EXX79123.1|  Pms1p                                                   193   8e-52    Rhizophagus irregularis DAOM 197198w
ref|XP_007891996.1|  PREDICTED: mismatch repair endonuclease PMS2       194   8e-52    Callorhinchus milii [Australian ghost shark]
gb|KFZ53439.1|  Mismatch repair endonuclease PMS2                       193   8e-52    Podiceps cristatus
gb|ESA07485.1|  hypothetical protein GLOINDRAFT_98750                   192   9e-52    
gb|KFQ88947.1|  Mismatch repair endonuclease PMS2                       192   9e-52    Phoenicopterus ruber ruber
gb|ADE76812.1|  unknown                                                 179   9e-52    Picea sitchensis
ref|XP_001494013.2|  PREDICTED: mismatch repair endonuclease PMS2       192   9e-52    
emb|CCI43563.1|  unnamed protein product                                191   1e-51    Albugo candida
ref|XP_006150253.1|  PREDICTED: mismatch repair endonuclease PMS2...    192   1e-51    Tupaia chinensis
gb|KFQ38873.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Mesitornis unicolor
ref|XP_011124903.1|  hypothetical protein AOL_s00109g120                194   1e-51    Arthrobotrys oligospora ATCC 24927
emb|CCI43564.1|  unnamed protein product                                191   1e-51    Albugo candida
ref|XP_010221538.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    193   1e-51    Tinamus guttatus
emb|CCI43566.1|  unnamed protein product                                191   1e-51    Albugo candida
ref|XP_004666302.1|  PREDICTED: mismatch repair endonuclease PMS2       191   1e-51    
gb|KFQ18344.1|  Mismatch repair endonuclease PMS2                       189   1e-51    Merops nubicus
gb|KFP50069.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Cathartes aura
gb|KFV61600.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Picoides pubescens
gb|KFQ53529.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Pelecanus crispus
gb|KFO59077.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Corvus brachyrhynchos
ref|XP_006150251.1|  PREDICTED: mismatch repair endonuclease PMS2...    192   1e-51    Tupaia chinensis
gb|KFP59441.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Cariama cristata
ref|XP_004622885.1|  PREDICTED: LOW QUALITY PROTEIN: PMS2 postmei...    191   1e-51    Sorex araneus [Eurasian shrew]
gb|KDR15822.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Zootermopsis nevadensis
ref|XP_005339809.1|  PREDICTED: mismatch repair endonuclease PMS2       191   1e-51    
ref|XP_006150252.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   1e-51    Tupaia chinensis
gb|KFV08218.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Pterocles gutturalis
gb|KFV44088.1|  Mismatch repair endonuclease PMS2                       192   1e-51    Gavia stellata
gb|KGL86612.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Charadrius vociferus
gb|KFP79673.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Apaloderma vittatum
ref|XP_006150250.1|  PREDICTED: mismatch repair endonuclease PMS2...    192   2e-51    Tupaia chinensis
gb|KFO93754.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Buceros rhinoceros silvestris
ref|XP_008016903.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   2e-51    Chlorocebus sabaeus
gb|KFQ99804.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Nipponia nippon
gb|KFW64318.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Pygoscelis adeliae
gb|KFP35113.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Chlamydotis macqueenii
ref|XP_004440915.1|  PREDICTED: mismatch repair endonuclease PMS2       192   2e-51    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFV18589.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Tauraco erythrolophus
gb|KFV85651.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Struthio camelus australis
ref|XP_008119094.1|  PREDICTED: mismatch repair endonuclease PMS2       191   2e-51    Anolis carolinensis [Carolina anole]
ref|XP_008016901.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   2e-51    Chlorocebus sabaeus
gb|KFQ01553.1|  Mismatch repair endonuclease PMS2                       192   2e-51    Leptosomus discolor
ref|XP_011513730.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   2e-51    
ref|XP_009450891.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   2e-51    Pan troglodytes
ref|XP_005549553.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   3e-51    
gb|KDD73673.1|  hypothetical protein H632_c1940p0                       188   3e-51    Helicosporidium sp. ATCC 50920
gb|EHH17126.1|  PMS2 like protein                                       191   3e-51    Macaca mulatta [rhesus macaque]
ref|XP_008016900.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   3e-51    Chlorocebus sabaeus
gb|EOB00894.1|  Mismatch repair endonuclease PMS2                       191   3e-51    Anas platyrhynchos [duck]
gb|AAH93921.1|  PMS2 postmeiotic segregation increased 2 (S. cere...    191   3e-51    Homo sapiens [man]
ref|XP_001141671.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   3e-51    Pan troglodytes
ref|XP_008822235.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   3e-51    Nannospalax galili
dbj|BAD89429.1|  postmeiotic segregation increased 2 nirs variant 5     191   3e-51    Homo sapiens [man]
ref|XP_011513731.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   3e-51    
gb|KFP70277.1|  Mismatch repair endonuclease PMS2                       191   3e-51    Acanthisitta chloris
sp|P54278.2|PMS2_HUMAN  RecName: Full=Mismatch repair endonucleas...    191   3e-51    Homo sapiens [man]
ref|XP_006504875.1|  PREDICTED: mismatch repair endonuclease PMS2...    190   3e-51    Mus musculus [mouse]
ref|NP_000526.1|  mismatch repair endonuclease PMS2 isoform a           191   3e-51    
ref|XP_009450892.1|  PREDICTED: mismatch repair endonuclease PMS2...    190   3e-51    Pan troglodytes
gb|AAA50390.1|  similar to S. cerevisiae PMS1 Swiss-Prot Accessio...    191   3e-51    Homo sapiens [man]
ref|XP_010727980.1|  PREDICTED: mismatch repair endonuclease PMS2       191   3e-51    
ref|XP_006982718.1|  PREDICTED: mismatch repair endonuclease PMS2       191   4e-51    Peromyscus maniculatus bairdii
ref|XP_006112999.1|  PREDICTED: mismatch repair endonuclease PMS2       192   4e-51    
ref|XP_011513729.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   4e-51    
gb|KFW73933.1|  Mismatch repair endonuclease PMS2                       191   4e-51    Phalacrocorax carbo [common cormorant]
ref|XP_006715805.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   4e-51    
sp|P54279.1|PMS2_MOUSE  RecName: Full=Mismatch repair endonucleas...    191   4e-51    Mus musculus [mouse]
ref|XP_005182742.1|  PREDICTED: mismatch repair endonuclease PMS2       191   4e-51    Musca domestica
gb|KFO06164.1|  Mismatch repair endonuclease PMS2                       191   4e-51    Balearica regulorum gibbericeps
gb|KFZ46917.1|  Mismatch repair endonuclease PMS2                       191   4e-51    Antrostomus carolinensis
ref|XP_009197158.1|  PREDICTED: mismatch repair endonuclease PMS2       191   4e-51    
ref|XP_004080263.1|  PREDICTED: mismatch repair endonuclease PMS2       190   4e-51    Oryzias latipes [Japanese rice fish]
ref|XP_005079993.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    191   4e-51    
ref|XP_002736491.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   5e-51    Saccoglossus kowalevskii
gb|EDL19031.1|  postmeiotic segregation increased 2 (S. cerevisia...    191   5e-51    Mus musculus [mouse]
ref|XP_006248924.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   5e-51    Rattus norvegicus [brown rat]
dbj|BAE27115.1|  unnamed protein product                                191   5e-51    Mus musculus [mouse]
ref|XP_005998427.1|  PREDICTED: mismatch repair endonuclease PMS2       191   5e-51    Latimeria chalumnae
ref|NP_032912.2|  mismatch repair endonuclease PMS2                     190   6e-51    Mus musculus [mouse]
ref|XP_011912398.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    191   6e-51    Cercocebus atys
gb|KFQ43091.1|  Mismatch repair endonuclease PMS2                       190   6e-51    Nestor notabilis
dbj|BAG57831.1|  unnamed protein product                                190   6e-51    Homo sapiens [man]
ref|XP_003702377.2|  PREDICTED: mismatch repair endonuclease PMS2       189   7e-51    Megachile rotundata
ref|XP_011362154.1|  PREDICTED: mismatch repair endonuclease PMS2...    191   7e-51    
ref|XP_011362155.1|  PREDICTED: mismatch repair endonuclease PMS2...    190   7e-51    Pteropus vampyrus
ref|XP_005368091.1|  PREDICTED: mismatch repair endonuclease PMS2       190   7e-51    Microtus ochrogaster [prairie voles]
ref|XP_010366040.1|  PREDICTED: mismatch repair endonuclease PMS2       190   7e-51    Rhinopithecus roxellana
ref|XP_010016408.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    190   8e-51    Nestor notabilis
ref|XP_008071097.1|  PREDICTED: mismatch repair endonuclease PMS2       190   8e-51    Carlito syrichta
ref|XP_006906607.1|  PREDICTED: mismatch repair endonuclease PMS2...    190   8e-51    Pteropus alecto
ref|XP_006906606.1|  PREDICTED: mismatch repair endonuclease PMS2...    190   9e-51    
gb|ESW99759.1|  DNA mismatch repair protein PMS1                        189   9e-51    Ogataea parapolymorpha DL-1
emb|CCX32857.1|  Similar to DNA mismatch repair protein pms1; acc...    191   1e-50    Pyronema omphalodes CBS 100304
ref|XP_005397952.1|  PREDICTED: mismatch repair endonuclease PMS2       189   1e-50    Chinchilla lanigera
ref|XP_005661902.1|  PREDICTED: mismatch repair endonuclease PMS2...    189   1e-50    
gb|KFW84396.1|  Mismatch repair endonuclease PMS2                       189   1e-50    Manacus vitellinus
ref|XP_003124331.1|  PREDICTED: mismatch repair endonuclease PMS2...    189   1e-50    Sus scrofa [pigs]
ref|XP_011108494.1|  hypothetical protein H072_2507                     191   1e-50    
gb|KFU93880.1|  Mismatch repair endonuclease PMS2                       189   1e-50    Chaetura pelagica
ref|XP_010641062.1|  PREDICTED: mismatch repair endonuclease PMS2       189   1e-50    Fukomys damarensis [Damara mole rat]
ref|XP_004629762.1|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
ref|XP_003496322.1|  PREDICTED: mismatch repair endonuclease PMS2...    189   2e-50    Cricetulus griseus [Chinese hamsters]
ref|XP_002806632.2|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
ref|XP_004351750.1|  MutL DNA mismatch repair protein                   190   2e-50    
ref|XP_006210434.1|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
gb|KFV95334.1|  Mismatch repair endonuclease PMS2                       189   2e-50    
ref|XP_007513353.1|  predicted protein                                  189   2e-50    
ref|XP_004459758.1|  PREDICTED: mismatch repair endonuclease PMS2...    188   2e-50    
gb|ELK17415.1|  Mismatch repair endonuclease PMS2                       189   2e-50    
ref|XP_007646882.1|  PREDICTED: mismatch repair endonuclease PMS2...    189   2e-50    
gb|EHB07895.1|  Mismatch repair endonuclease PMS2                       189   2e-50    
ref|XP_001747286.1|  hypothetical protein                               189   2e-50    
ref|XP_004892400.1|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
ref|XP_010990506.1|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
ref|XP_006173931.1|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
ref|XP_003470079.1|  PREDICTED: mismatch repair endonuclease PMS2       189   2e-50    
ref|XP_005718906.1|  unnamed protein product                            190   2e-50    
ref|XP_010963998.1|  PREDICTED: mismatch repair endonuclease PMS2       189   3e-50    
ref|XP_008313318.1|  PREDICTED: mismatch repair endonuclease PMS2       188   3e-50    
ref|XP_010904189.1|  PREDICTED: mismatch repair endonuclease PMS2       189   3e-50    
ref|XP_005448203.1|  PREDICTED: mismatch repair endonuclease PMS2       188   3e-50    
gb|KFR10344.1|  Mismatch repair endonuclease PMS2                       188   3e-50    
ref|XP_004534945.1|  PREDICTED: mismatch repair endonuclease PMS2...    188   3e-50    
ref|XP_004823362.1|  PREDICTED: mismatch repair endonuclease PMS2       188   3e-50    
ref|XP_006859821.1|  PREDICTED: mismatch repair endonuclease PMS2       188   4e-50    
ref|XP_536879.3|  PREDICTED: mismatch repair endonuclease PMS2          188   4e-50    
gb|ELK28950.1|  Mismatch repair endonuclease PMS2                       188   4e-50    
ref|XP_006747167.1|  PREDICTED: mismatch repair endonuclease PMS2       188   4e-50    
ref|XP_003761534.1|  PREDICTED: mismatch repair endonuclease PMS2       189   4e-50    
ref|XP_004394227.1|  PREDICTED: mismatch repair endonuclease PMS2       188   4e-50    
ref|XP_003934288.1|  PREDICTED: mismatch repair endonuclease PMS2       188   4e-50    
gb|KFO97904.1|  Mismatch repair endonuclease PMS2                       188   4e-50    
ref|XP_004775029.1|  PREDICTED: mismatch repair endonuclease PMS2...    188   4e-50    
ref|XP_005721744.1|  PREDICTED: mismatch repair endonuclease PMS2...    188   5e-50    
ref|XP_004317337.1|  PREDICTED: mismatch repair endonuclease PMS2       188   5e-50    
ref|XP_010788658.1|  PREDICTED: mismatch repair endonuclease PMS2       187   5e-50    
ref|XP_007186795.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   5e-50    
ref|XP_011176016.1|  PREDICTED: mismatch repair endonuclease PMS2       186   6e-50    
gb|EPQ15908.1|  Mismatch repair endonuclease PMS2                       187   6e-50    
ref|XP_008696559.1|  PREDICTED: mismatch repair endonuclease PMS2       188   6e-50    
ref|XP_002927619.1|  PREDICTED: mismatch repair endonuclease PMS2       187   6e-50    
ref|XP_004268980.1|  PREDICTED: mismatch repair endonuclease PMS2       187   6e-50    
emb|CCA17251.1|  mismatch repair endonuclease pms1 putative             186   6e-50    
ref|XP_008580517.1|  PREDICTED: mismatch repair endonuclease PMS2       187   7e-50    
ref|XP_005101861.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   7e-50    
gb|KFM12333.1|  Mismatch repair endonuclease PMS2                       187   7e-50    
ref|XP_005932908.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   7e-50    
ref|XP_004459759.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   8e-50    
ref|XP_004705610.1|  PREDICTED: mismatch repair endonuclease PMS2       187   9e-50    
ref|XP_004562400.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   9e-50    
ref|XP_007940862.1|  PREDICTED: mismatch repair endonuclease PMS2       187   1e-49    
ref|XP_007448937.1|  PREDICTED: mismatch repair endonuclease PMS2       187   1e-49    
ref|XP_006941974.1|  PREDICTED: mismatch repair endonuclease PMS2...    186   1e-49    
ref|XP_008301963.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_006801008.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_007081165.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_007081164.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_008301962.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_008301961.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_007251227.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_010594672.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    189   1e-49    
ref|XP_006941972.1|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_004933000.1|  PREDICTED: mismatch repair endonuclease PMS2...    186   1e-49    
ref|XP_006889823.1|  PREDICTED: mismatch repair endonuclease PMS2       186   1e-49    
ref|XP_003998500.2|  PREDICTED: mismatch repair endonuclease PMS2...    187   1e-49    
ref|XP_004380874.1|  PREDICTED: mismatch repair endonuclease PMS2       186   2e-49    
ref|XP_002051016.1|  GJ19872                                            186   2e-49    
gb|EFA79872.1|  MutL DNA mismatch repair protein                        186   3e-49    
ref|XP_011862637.1|  PREDICTED: mismatch repair endonuclease PMS2       184   3e-49    
ref|XP_003740613.1|  PREDICTED: mismatch repair endonuclease PMS2       185   3e-49    
ref|XP_001975517.1|  GG22356                                            185   4e-49    
gb|KEZ46501.1|  Uncharacterized protein SAPIO_CDS0843                   186   4e-49    
ref|XP_638844.1|  MutL DNA mismatch repair protein                      186   4e-49    
ref|XP_011685656.1|  PREDICTED: mismatch repair endonuclease PMS2       184   5e-49    
ref|XP_002110081.1|  hypothetical protein TRIADDRAFT_21244              184   6e-49    
ref|XP_001986963.1|  GH21651                                            185   6e-49    
ref|XP_002033967.1|  GM20141                                            185   6e-49    
gb|EFX87911.1|  putative PMS1, postmeiotic segregation increased ...    184   8e-49    
gb|EFN75866.1|  Mismatch repair endonuclease PMS2                       183   8e-49    
ref|XP_011152383.1|  PREDICTED: mismatch repair endonuclease PMS2       183   9e-49    
ref|XP_007558945.1|  PREDICTED: mismatch repair endonuclease PMS2...    184   9e-49    
gb|EQB59193.1|  DNA mismatch repair protein MutL                        174   9e-49    
ref|XP_008436367.1|  PREDICTED: mismatch repair endonuclease PMS2...    184   1e-48    
ref|XP_002770025.1|  DEHA2A10868p                                       185   1e-48    
ref|XP_693648.5|  PREDICTED: mismatch repair endonuclease PMS2          184   1e-48    
ref|XP_008436368.1|  PREDICTED: mismatch repair endonuclease PMS2...    183   1e-48    
emb|CEF98495.1|  DNA mismatch repair protein Pms1/Mlh2                  184   1e-48    
ref|XP_005811756.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    183   1e-48    
ref|XP_503794.1|  YALI0E10769p                                          184   1e-48    
gb|AAL39978.1|  SD07911p                                                184   2e-48    
ref|NP_477023.1|  Pms2                                                  184   2e-48    
ref|XP_786592.3|  PREDICTED: mismatch repair endonuclease PMS2          184   2e-48    
ref|XP_002092377.1|  GE14157                                            184   2e-48    
gb|KIW78871.1|  hypothetical protein Z517_08710                         184   2e-48    
gb|KII84937.1|  hypothetical protein PLICRDRAFT_117097                  175   2e-48    
emb|CCD55285.1|  hypothetical protein BofuT4_P156810.1                  176   2e-48    
ref|XP_002074706.1|  GK23208                                            183   2e-48    
ref|XP_007385990.1|  hypothetical protein PUNSTDRAFT_72337              176   3e-48    
ref|XP_011349393.1|  PREDICTED: mismatch repair endonuclease PMS2       181   3e-48    
gb|AAC19245.1|  mutL homolog PMS2                                       183   4e-48    
ref|XP_003031353.1|  hypothetical protein SCHCODRAFT_16115              178   4e-48    
ref|XP_003490132.1|  PREDICTED: mismatch repair endonuclease PMS2...    181   4e-48    
ref|XP_011647670.1|  PREDICTED: mismatch repair endonuclease PMS2       181   5e-48    
ref|XP_004599351.1|  PREDICTED: mismatch repair endonuclease PMS2       183   5e-48    
ref|XP_011209746.1|  PREDICTED: mismatch repair endonuclease PMS2...    182   6e-48    
ref|XP_002557980.1|  Pc12g11630                                         182   6e-48    
gb|KIL56445.1|  hypothetical protein M378DRAFT_89291                    173   7e-48    
gb|KDN40420.1|  hypothetical protein K437DRAFT_269978                   184   8e-48    
ref|XP_002836027.1|  hypothetical protein                               182   1e-47    
ref|XP_003697126.1|  PREDICTED: LOW QUALITY PROTEIN: mismatch rep...    180   1e-47    
ref|XP_003393628.1|  PREDICTED: mismatch repair endonuclease PMS2...    180   1e-47    
ref|XP_011196565.1|  PREDICTED: mismatch repair endonuclease PMS2       181   1e-47    
ref|XP_009219093.1|  hypothetical protein GGTG_03051                    182   1e-47    
gb|KIW24905.1|  hypothetical protein PV07_10588                         182   1e-47    
ref|XP_007110510.1|  PREDICTED: mismatch repair endonuclease PMS2       181   1e-47    
ref|XP_001886812.1|  predicted protein                                  172   1e-47    
gb|KIK18874.1|  hypothetical protein PISMIDRAFT_108669                  173   1e-47    
gb|KJJ26568.1|  DNA mismatch repair protein Pms1Mlh2                    182   2e-47    
ref|XP_007654350.1|  PREDICTED: mismatch repair endonuclease PMS2       181   2e-47    
ref|XP_007832416.1|  hypothetical protein PFICI_05644                   182   2e-47    
pdb|4E4W|B  Chain B, Structure Of The C-terminal Domain Of The Sa...    171   2e-47    
pdb|4FMN|B  Chain B, Structure Of The C-terminal Domain Of The Sa...    171   2e-47    
gb|EDK37866.2|  hypothetical protein PGUG_01964                         181   2e-47    
ref|XP_003714713.1|  hypothetical protein MGG_15760                     182   2e-47    
gb|ELQ40472.1|  DNA mismatch repair protein pms1                        182   2e-47    
gb|KGO42901.1|  DNA mismatch repair protein, C-terminal                 181   3e-47    
ref|XP_008543169.1|  PREDICTED: mismatch repair endonuclease PMS2       179   3e-47    
gb|KEQ95134.1|  hypothetical protein AUEXF2481DRAFT_5375                181   3e-47    
emb|CDQ72557.1|  unnamed protein product                                180   3e-47    
gb|KGO74651.1|  DNA mismatch repair protein, C-terminal                 181   3e-47    
ref|XP_011659357.1|  PREDICTED: DNA mismatch repair protein PMS1 ...    179   4e-47    
gb|KDQ22880.1|  hypothetical protein PLEOSDRAFT_1050272                 171   4e-47    
ref|XP_003677517.1|  hypothetical protein NCAS_0G02780                  179   5e-47    
ref|XP_002165510.2|  PREDICTED: mismatch repair endonuclease PMS2...    179   6e-47    
emb|CCU74286.1|  DNA mismatch repair protein pms1                       180   7e-47    
gb|EKV06374.1|  DNA mismatch repair protein (Pms1), putative            180   8e-47    
ref|XP_007752464.1|  DNA mismatch repair protein PMS2                   180   8e-47    
ref|XP_007742841.1|  hypothetical protein A1O5_04042                    180   8e-47    
gb|KDN71693.1|  putative DNA mismatch repair protein MutL               180   9e-47    
gb|KIV98235.1|  hypothetical protein PV10_01903                         180   9e-47    
gb|KIJ49649.1|  hypothetical protein M422DRAFT_161270                   170   1e-46    
ref|XP_007879476.1|  hypothetical protein PFL1_03761                    180   1e-46    
ref|XP_002496298.1|  ZYRO0C15180p                                       179   1e-46    
ref|XP_007144294.1|  hypothetical protein PHAVU_007G144100g             178   1e-46    
ref|XP_009041955.1|  hypothetical protein AURANDRAFT_55567              177   2e-46    
emb|CDM34480.1|  DNA mismatch repair protein                            179   2e-46    
ref|XP_007868321.1|  Pms2 protein                                       167   2e-46    
ref|XP_002951883.1|  hypothetical protein VOLCADRAFT_61856              166   2e-46    
gb|EPQ65457.1|  ATP-binding protein                                     179   2e-46    
gb|KIW16343.1|  hypothetical protein PV08_06394                         179   2e-46    
ref|XP_003288390.1|  hypothetical protein DICPUDRAFT_152626             179   2e-46    
gb|KIY00361.1|  hypothetical protein Z520_04046                         179   2e-46    
ref|XP_007771758.1|  hypothetical protein CONPUDRAFT_61519              171   2e-46    
ref|XP_001959765.1|  GF11871                                            178   2e-46    
ref|NP_594417.1|  MutL family mismatch-repair protein Pms1              177   2e-46    
ref|XP_001361342.2|  GA20862                                            178   2e-46    
ref|XP_007597510.1|  DNA mismatch repair protein MutL                   179   2e-46    
ref|XP_006456424.1|  hypothetical protein AGABI2DRAFT_122323            178   3e-46    
emb|CCF33836.1|  DNA mismatch repair protein MutL                       178   3e-46    
ref|XP_004182718.1|  hypothetical protein TBLA_0J02050                  177   3e-46    
gb|EFN70759.1|  Mismatch repair endonuclease PMS2                       176   3e-46    
ref|XP_002399323.1|  DNA mismatch repair protein, putative              177   3e-46    
gb|KIJ97474.1|  hypothetical protein K443DRAFT_105649                   168   4e-46    
ref|XP_011252685.1|  PREDICTED: mismatch repair endonuclease PMS2       176   4e-46    
gb|EFQ27556.1|  DNA mismatch repair protein MutL                        178   4e-46    
ref|XP_003959280.1|  hypothetical protein KAFR_0J00770                  176   4e-46    
emb|CDS31812.1|  mismatch repair endonuclease PMS2                      176   5e-46    
ref|XP_001418550.1|  predicted protein                                  176   5e-46    
gb|ENN73117.1|  hypothetical protein YQE_10258                          175   5e-46    
gb|KKA27315.1|  hypothetical protein TD95_004009                        177   5e-46    
gb|KIW96256.1|  hypothetical protein Z519_03324                         177   7e-46    
ref|NP_985276.1|  AER421Wp                                              176   7e-46    
gb|KIW45468.1|  hypothetical protein PV06_03859                         177   7e-46    
gb|AEY97409.1|  FAER421Wp                                               176   7e-46    
gb|KKA20951.1|  DNA mismatch repair protein (Pms1)                      177   9e-46    
ref|XP_011068367.1|  PREDICTED: mismatch repair endonuclease PMS2       174   9e-46    
ref|XP_006623631.1|  PREDICTED: mismatch repair endonuclease PMS2...    174   1e-45    
gb|AGO14214.1|  AaceriAER421Wp                                          176   1e-45    
gb|EDZ69678.1|  YNL082Wp-like protein                                   171   1e-45    
ref|XP_447944.1|  hypothetical protein                                  176   1e-45    
ref|XP_008721879.1|  hypothetical protein G647_00254                    176   1e-45    
ref|XP_001526024.1|  hypothetical protein LELG_02582                    176   1e-45    
ref|XP_007286241.1|  DNA mismatch repair protein pms1                   176   1e-45    
ref|XP_002493530.1|  ATP-binding protein required for mismatch re...    176   2e-45    
ref|XP_012056362.1|  PREDICTED: mismatch repair endonuclease PMS2       174   2e-45    
ref|XP_008206667.1|  PREDICTED: mismatch repair endonuclease PMS2       174   2e-45    
ref|XP_006572416.1|  PREDICTED: mismatch repair endonuclease PMS2...    173   2e-45    
ref|XP_004202519.1|  Piso0_001357                                       175   3e-45    
ref|XP_003686067.1|  hypothetical protein TPHA_0F01490                  175   3e-45    
gb|EUB64680.1|  Mismatch repair endonuclease PMS2                       173   3e-45    
gb|ENH63070.1|  Mismatch repair endonuclease PMS2                       175   3e-45    
ref|XP_009029561.1|  hypothetical protein HELRODRAFT_157945             169   4e-45    
gb|EPS33702.1|  hypothetical protein PDE_08664                          175   4e-45    
emb|CCD59361.1|  DNA mismatch repair protein PMS2, putative             173   4e-45    
gb|EXM22351.1|  DNA mismatch repair protein PMS2                        175   4e-45    
ref|XP_002555409.1|  KLTH0G08624p                                       174   5e-45    
ref|XP_001486293.1|  hypothetical protein PGUG_01964                    174   5e-45    
emb|CAK96402.1|  unnamed protein product                                174   5e-45    
gb|KIN08533.1|  hypothetical protein OIDMADRAFT_107841                  174   5e-45    
gb|EWZ00841.1|  DNA mismatch repair protein PMS2                        174   6e-45    
emb|CDH08560.1|  related to DNA mismatch repair protein PMS1            174   6e-45    
gb|EXK44179.1|  DNA mismatch repair protein PMS2                        174   6e-45    
ref|XP_003039889.1|  hypothetical protein NECHADRAFT_50420              174   7e-45    
ref|XP_007615074.1|  PREDICTED: mismatch repair endonuclease PMS2...    173   7e-45    
ref|XP_007398846.1|  hypothetical protein PHACADRAFT_260955             167   7e-45    
ref|XP_004201894.1|  Piso0_001357                                       174   7e-45    
gb|EWZ46876.1|  DNA mismatch repair protein PMS2                        174   8e-45    
gb|EMR91049.1|  putative dna mismatch repair protein                    174   8e-45    
gb|EPE08337.1|  dna mismatch repair protein                             174   8e-45    
gb|KFA61542.1|  hypothetical protein S40285_04022                       174   8e-45    
gb|KIN98531.1|  hypothetical protein M404DRAFT_1005195                  169   9e-45    
gb|KEQ86592.1|  DNA mismatch repair protein MutL                        173   1e-44    
emb|CDR42708.1|  CYFA0S10e01376g1_1                                     173   1e-44    
gb|EPY51471.1|  MutL family mismatch-repair protein Pms1                172   1e-44    
gb|EXK91607.1|  DNA mismatch repair protein PMS2                        173   1e-44    
gb|KIE01082.1|  DNA mismatch repair protein                             169   1e-44    
gb|EXA43550.1|  DNA mismatch repair protein PMS2                        173   1e-44    
gb|EGU81226.1|  hypothetical protein FOXB_08259                         173   1e-44    
gb|AJT26314.1|  Pms1p                                                   172   2e-44    
ref|XP_007709212.1|  hypothetical protein COCCADRAFT_34139              173   2e-44    
ref|XP_007814234.1|  putative DNA mismatch repair protein PMS1          172   2e-44    
gb|KIW73773.1|  hypothetical protein PV04_01866                         173   2e-44    
gb|EHA22707.1|  DNA mismatch repair protein                             173   2e-44    



>ref|XP_012082736.1| PREDICTED: DNA mismatch repair protein PMS1 [Jatropha curcas]
 gb|KDP28142.1| hypothetical protein JCGZ_13913 [Jatropha curcas]
Length=954

 Score =   367 bits (942),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/201 (85%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERL +STILNQQPLLRPL +DLSPE
Sbjct  746  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLCQSTILNQQPLLRPLWLDLSPE  805

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIVVSMNMD IRKNGF+LEEDLHAPPG RF LKAVPFSKNITFGV DVK+LIS LA SQ
Sbjct  806  EEIVVSMNMDIIRKNGFALEEDLHAPPGQRFKLKAVPFSKNITFGVEDVKDLISTLADSQ  865

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC I  SY+ DT DS+CP RVRAMLASRACRSS+MIGDPLGRNEMQKILEHLA LKSPW
Sbjct  866  GDCSIIGSYKMDTHDSVCPSRVRAMLASRACRSSIMIGDPLGRNEMQKILEHLADLKSPW  925

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DLT+++KR
Sbjct  926  NCPHGRPTMRHLLDLTSIYKR  946



>ref|XP_006444299.1| hypothetical protein CICLE_v100188991mg, partial [Citrus clementina]
 gb|ESR57539.1| hypothetical protein CICLE_v100188991mg, partial [Citrus clementina]
Length=400

 Score =   348 bits (892),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+ST+LNQQPLLRPLK+DL+PE
Sbjct  192  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTVLNQQPLLRPLKLDLTPE  251

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MD IRKNGFSLEED HA  GLRF LKAVPFSK ITFGV DVK+LIS LA +Q
Sbjct  252  EEVVASMHMDIIRKNGFSLEEDPHALAGLRFRLKAVPFSKKITFGVEDVKDLISTLADNQ  311

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ DT+DS+CP RVRAMLASRACRSS+MIGD LGRNEMQKILEHLA L SPW
Sbjct  312  GECSIISSYKMDTADSVCPSRVRAMLASRACRSSIMIGDALGRNEMQKILEHLADLNSPW  371

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  372  NCPHGRPTMRHLVDLTTIRK  391



>gb|KDO87272.1| hypothetical protein CISIN_1g0414662mg, partial [Citrus sinensis]
Length=206

 Score =   340 bits (871),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +3

Query  12   VIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEEI  191
            VIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+ST+LNQQPLLRPLK+DL+PEEE+
Sbjct  1    VIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTVLNQQPLLRPLKLDLTPEEEV  60

Query  192  VVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQEDC  371
            V SM+MD IRKNGFSLEED HA  GLRF LKAVPFSK ITFGV DVK+LIS LA +Q +C
Sbjct  61   VASMHMDIIRKNGFSLEEDPHALAGLRFRLKAVPFSKKITFGVEDVKDLISTLADNQGEC  120

Query  372  HITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNCP  551
             I  SY+ DT+DS+CP RVRAMLASRACRSS+MIGD LGRNEMQKILEHLA L SPWNCP
Sbjct  121  SIISSYKMDTADSVCPSRVRAMLASRACRSSIMIGDALGRNEMQKILEHLADLNSPWNCP  180

Query  552  HGRPTMRHLIDLTTVHK  602
            HGRPTMRHL+DLTT+ K
Sbjct  181  HGRPTMRHLVDLTTIRK  197



>emb|CDP03504.1| unnamed protein product [Coffea canephora]
Length=927

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFII KLD DLFIVDQHAADEKYNYERLS+ST+LNQQPLL+PL+++LSPE
Sbjct  719  RMKVIGQFNLGFIIAKLDHDLFIVDQHAADEKYNYERLSQSTVLNQQPLLQPLRLELSPE  778

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV SM+MD IR+NGFSLEED+HAPPG RF +KAVPFSKNI FGVADVK+L+SILA SQ
Sbjct  779  EEIVTSMHMDIIRRNGFSLEEDVHAPPGQRFKIKAVPFSKNIIFGVADVKDLLSILADSQ  838

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SYR DT+DS+CPPRVRAMLASRACRSSVM+GDPLGRNEMQKILEHLA LKSPW
Sbjct  839  GECSIIGSYRSDTADSVCPPRVRAMLASRACRSSVMVGDPLGRNEMQKILEHLAGLKSPW  898

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DLTTV  R
Sbjct  899  NCPHGRPTMRHLVDLTTVRGR  919



>ref|XP_009598045.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Nicotiana 
tomentosiformis]
Length=939

 Score =   360 bits (925),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIG+LD DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPLKM+LSPE
Sbjct  729  KMKVIGQFNLGFIIGRLDEDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLKMELSPE  788

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV+S++ DT RKNGF LEEDLHAPPG RF LKAVPFSKNITFGVADVKELISILA SQ
Sbjct  789  EEIVISIHNDTFRKNGFLLEEDLHAPPGHRFKLKAVPFSKNITFGVADVKELISILADSQ  848

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            E+C +  +Y+ DT+DS+CPPRVRAMLASRAC+SS++IGDPLGRNEMQKIL++L+ L+SPW
Sbjct  849  EECSMMGTYKDDTADSLCPPRVRAMLASRACKSSIVIGDPLGRNEMQKILDNLSRLRSPW  908

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL TVH+R
Sbjct  909  NCPHGRPTMRHLVDLRTVHRR  929



>ref|XP_009598044.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Nicotiana 
tomentosiformis]
Length=940

 Score =   360 bits (925),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIG+LD DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPLKM+LSPE
Sbjct  730  KMKVIGQFNLGFIIGRLDEDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLKMELSPE  789

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV+S++ DT RKNGF LEEDLHAPPG RF LKAVPFSKNITFGVADVKELISILA SQ
Sbjct  790  EEIVISIHNDTFRKNGFLLEEDLHAPPGHRFKLKAVPFSKNITFGVADVKELISILADSQ  849

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            E+C +  +Y+ DT+DS+CPPRVRAMLASRAC+SS++IGDPLGRNEMQKIL++L+ L+SPW
Sbjct  850  EECSMMGTYKDDTADSLCPPRVRAMLASRACKSSIVIGDPLGRNEMQKILDNLSRLRSPW  909

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL TVH+R
Sbjct  910  NCPHGRPTMRHLVDLRTVHRR  930



>ref|XP_011079684.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Sesamum 
indicum]
Length=899

 Score =   355 bits (910),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QMKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYNYERLS++T+LNQQPLLRPLK+++SPE
Sbjct  691  QMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNYERLSQTTVLNQQPLLRPLKLEVSPE  750

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV+SM+MDT RKNGF L+E++HAP G RF LKAVPFSKNITFG+ D+KELISIL+ S 
Sbjct  751  EEIVISMHMDTFRKNGFLLDENMHAPSGQRFILKAVPFSKNITFGIGDIKELISILSDSH  810

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR DT+DS+CPP+VRAMLASRACRSS+MIGD LGRNEMQKILEHLA LKSPW
Sbjct  811  GECSMIGSYRSDTADSVCPPKVRAMLASRACRSSIMIGDSLGRNEMQKILEHLAVLKSPW  870

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL TVH+
Sbjct  871  NCPHGRPTMRHLVDLRTVHR  890



>ref|XP_011079683.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Sesamum 
indicum]
Length=923

 Score =   355 bits (910),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QMKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYNYERLS++T+LNQQPLLRPLK+++SPE
Sbjct  715  QMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNYERLSQTTVLNQQPLLRPLKLEVSPE  774

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV+SM+MDT RKNGF L+E++HAP G RF LKAVPFSKNITFG+ D+KELISIL+ S 
Sbjct  775  EEIVISMHMDTFRKNGFLLDENMHAPSGQRFILKAVPFSKNITFGIGDIKELISILSDSH  834

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR DT+DS+CPP+VRAMLASRACRSS+MIGD LGRNEMQKILEHLA LKSPW
Sbjct  835  GECSMIGSYRSDTADSVCPPKVRAMLASRACRSSIMIGDSLGRNEMQKILEHLAVLKSPW  894

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL TVH+
Sbjct  895  NCPHGRPTMRHLVDLRTVHR  914



>ref|XP_006359387.1| PREDICTED: DNA mismatch repair protein PMS1-like [Solanum tuberosum]
Length=939

 Score =   354 bits (909),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIG+LD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPLK++LSPE
Sbjct  731  RMKVIGQFNLGFIIGRLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLKLELSPE  790

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEI++S++ DT RKNGF LEEDL APPG RF LKAVPFSKN+TFG+ADVKELISILA S+
Sbjct  791  EEIIISIHNDTFRKNGFLLEEDLCAPPGHRFKLKAVPFSKNLTFGIADVKELISILADSE  850

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            E+C I  +Y+ DT+DS+CPPRVRAMLASRAC+SSV+IGDPLGRNEMQKIL++L+ LKSPW
Sbjct  851  EECSIMGAYKNDTADSLCPPRVRAMLASRACKSSVVIGDPLGRNEMQKILDNLSRLKSPW  910

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL TVH+R
Sbjct  911  NCPHGRPTMRHLVDLRTVHRR  931



>gb|EYU46682.1| hypothetical protein MIMGU_mgv1a024383mg [Erythranthe guttata]
Length=876

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QMKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYNYERLS +T+LNQQPLLRPLKM+L+PE
Sbjct  670  QMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNYERLSRTTVLNQQPLLRPLKMELAPE  729

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV+SM+MDT RKNGF LEED++AP G RF LKAVPFSKNITFGV DVKELISIL+ S 
Sbjct  730  EEIVISMHMDTFRKNGFLLEEDMYAPSGHRFILKAVPFSKNITFGVPDVKELISILSDSH  789

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC +  SYR DT+DS+CPP++RAMLASRACRSS+MIGD LG+NEM K+LEHLA LKSPW
Sbjct  790  GDCSMIGSYRSDTADSVCPPKIRAMLASRACRSSIMIGDSLGKNEMHKVLEHLAILKSPW  849

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL TV +R
Sbjct  850  NCPHGRPTMRHLVDLKTVRRR  870



>ref|XP_004247536.1| PREDICTED: DNA mismatch repair protein PMS1 [Solanum lycopersicum]
Length=940

 Score =   351 bits (901),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIG+LD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPLK++LSPE
Sbjct  732  RMKVIGQFNLGFIIGRLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLKLELSPE  791

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV+S++ DT R+NGF LEED  APPG RF LKAVPFSKNITFG+AD+KELISILA S+
Sbjct  792  EEIVISIHNDTFRRNGFLLEEDPCAPPGHRFKLKAVPFSKNITFGIADMKELISILADSE  851

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            E+C I  +YR DT+DS+CPPRVRAMLASRAC+SSV+IGDPLGRNEMQKIL++L+ LKSPW
Sbjct  852  EECSIMGAYRNDTADSLCPPRVRAMLASRACKSSVVIGDPLGRNEMQKILDNLSRLKSPW  911

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL TVH+R
Sbjct  912  NCPHGRPTMRHLVDLRTVHRR  932



>ref|XP_010269535.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Nelumbo 
nucifera]
Length=913

 Score =   348 bits (893),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGK+D DLFIVDQHAADEK+N+ERLS++T+LNQQPLL+P++++LSPE
Sbjct  700  RMKVIGQFNLGFIIGKIDEDLFIVDQHAADEKFNFERLSQTTVLNQQPLLQPIRLELSPE  759

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MD IRKNGF+LEED+HAPPG  F LKAVPFSKN+TFG  DVKELIS LA S+
Sbjct  760  EEVVASMHMDIIRKNGFTLEEDIHAPPGCHFKLKAVPFSKNVTFGAEDVKELISTLADSE  819

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR DT DS+CP RVRAMLASRACRSSVMIGDPLG+NEMQKILEHLA LKSPW
Sbjct  820  GECSMVSSYRLDTPDSVCPSRVRAMLASRACRSSVMIGDPLGKNEMQKILEHLADLKSPW  879

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHLIDL T++KR
Sbjct  880  NCPHGRPTMRHLIDLATIYKR  900



>ref|XP_010269534.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Nelumbo 
nucifera]
Length=944

 Score =   348 bits (893),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGK+D DLFIVDQHAADEK+N+ERLS++T+LNQQPLL+P++++LSPE
Sbjct  731  RMKVIGQFNLGFIIGKIDEDLFIVDQHAADEKFNFERLSQTTVLNQQPLLQPIRLELSPE  790

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MD IRKNGF+LEED+HAPPG  F LKAVPFSKN+TFG  DVKELIS LA S+
Sbjct  791  EEVVASMHMDIIRKNGFTLEEDIHAPPGCHFKLKAVPFSKNVTFGAEDVKELISTLADSE  850

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR DT DS+CP RVRAMLASRACRSSVMIGDPLG+NEMQKILEHLA LKSPW
Sbjct  851  GECSMVSSYRLDTPDSVCPSRVRAMLASRACRSSVMIGDPLGKNEMQKILEHLADLKSPW  910

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHLIDL T++KR
Sbjct  911  NCPHGRPTMRHLIDLATIYKR  931



>ref|XP_010684604.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=801

 Score =   344 bits (882),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD DLFIVDQHAADEKYN+ERLSE T++NQQPLLRP++M+LSPE
Sbjct  592  RMKVIGQFNLGFIIGKLDEDLFIVDQHAADEKYNFERLSEVTVMNQQPLLRPIRMELSPE  651

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV SM+MD IRKNGFSLEEDL A PG RF LK+VPFSKN+TFGV DVKELIS L+  Q
Sbjct  652  EEIVASMHMDIIRKNGFSLEEDLDASPGNRFKLKSVPFSKNVTFGVEDVKELISTLSDGQ  711

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  +Y+ DTSDS+CP RVRAMLASRACRSS+MIGD LGRNEMQKILEHLA LKSPW
Sbjct  712  GECSIMSTYKLDTSDSVCPTRVRAMLASRACRSSIMIGDALGRNEMQKILEHLAELKSPW  771

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL++L  + +R
Sbjct  772  NCPHGRPTMRHLVNLAVIRER  792



>ref|XP_006480112.1| PREDICTED: DNA mismatch repair protein PMS1-like [Citrus sinensis]
Length=1058

 Score =   348 bits (893),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3     QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
             +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+ST+LNQQPLLRPLK+DL+PE
Sbjct  850   RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTVLNQQPLLRPLKLDLTPE  909

Query  183   EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             EE+V SM+MD IRKNGFSLEED HA  GLRF LKAVPFSK ITFGV DVK+LIS LA +Q
Sbjct  910   EEVVASMHMDIIRKNGFSLEEDPHALAGLRFRLKAVPFSKKITFGVEDVKDLISTLADNQ  969

Query  363   EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
              +C I  SY+ DT+DS+CP RVRAMLASRACRSS+MIGD LGRNEMQKILEHLA L SPW
Sbjct  970   GECSIISSYKMDTADSVCPSRVRAMLASRACRSSIMIGDALGRNEMQKILEHLADLNSPW  1029

Query  543   NCPHGRPTMRHLIDLTTVHK  602
             NCPHGRPTMRHL+DLTT+ K
Sbjct  1030  NCPHGRPTMRHLVDLTTIRK  1049



>ref|XP_008451591.1| PREDICTED: DNA mismatch repair protein PMS1 [Cucumis melo]
Length=921

 Score =   345 bits (885),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPL ++LS E
Sbjct  714  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLGLELSAE  773

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+VVS++MD  RKNGF++EED HA PG RF LKAVPFSKNITFGV DVK+LIS LA S+
Sbjct  774  EEVVVSIHMDVFRKNGFTIEEDPHALPGNRFRLKAVPFSKNITFGVEDVKDLISTLADSE  833

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I   YR DT+DS+CP RVRAMLASRACRSSVMIGDPLGRNEMQKILEHLA LKSPW
Sbjct  834  GECSIIGCYRMDTADSVCPSRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAELKSPW  893

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTTV +
Sbjct  894  NCPHGRPTMRHLVDLTTVKR  913



>ref|XP_010684598.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=909

 Score =   344 bits (883),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD DLFIVDQHAADEKYN+ERLSE T++NQQPLLRP++M+LSPE
Sbjct  700  RMKVIGQFNLGFIIGKLDEDLFIVDQHAADEKYNFERLSEVTVMNQQPLLRPIRMELSPE  759

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV SM+MD IRKNGFSLEEDL A PG RF LK+VPFSKN+TFGV DVKELIS L+  Q
Sbjct  760  EEIVASMHMDIIRKNGFSLEEDLDASPGNRFKLKSVPFSKNVTFGVEDVKELISTLSDGQ  819

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  +Y+ DTSDS+CP RVRAMLASRACRSS+MIGD LGRNEMQKILEHLA LKSPW
Sbjct  820  GECSIMSTYKLDTSDSVCPTRVRAMLASRACRSSIMIGDALGRNEMQKILEHLAELKSPW  879

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL++L  + +R
Sbjct  880  NCPHGRPTMRHLVNLAVIRER  900



>ref|XP_003591551.1| DNA mismatch repair protein [Medicago truncatula]
 gb|AES61802.1| DNA mismatch repair protein PMS2, putative [Medicago truncatula]
Length=933

 Score =   343 bits (880),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E LS+STILNQQPLLRP++++LSPE
Sbjct  724  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFECLSQSTILNQQPLLRPIRLELSPE  783

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA--S  356
            EEIV S++MD IRKNGF+LEEDL+APPG R+ LK+VP+SKN  FGV DVK+LIS L+   
Sbjct  784  EEIVASIHMDIIRKNGFTLEEDLNAPPGCRYKLKSVPYSKNTMFGVEDVKDLISTLSDGD  843

Query  357  SQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
               +C I  SYR+D+SDSICPPRVRAMLASRACRSS+MIGD LGRNEMQKILEHLA LKS
Sbjct  844  GHGECSIIGSYRQDSSDSICPPRVRAMLASRACRSSIMIGDALGRNEMQKILEHLAELKS  903

Query  537  PWNCPHGRPTMRHLIDLTTVHKR  605
            PWNCPHGRPTMRHL+DLT +HKR
Sbjct  904  PWNCPHGRPTMRHLVDLTKIHKR  926



>ref|XP_011659356.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Cucumis 
sativus]
 gb|KGN44927.1| hypothetical protein Csa_7G396420 [Cucumis sativus]
Length=921

 Score =   342 bits (878),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPL ++LS E
Sbjct  714  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLGLELSAE  773

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+VVS++MD  RKNGF++EED  + PG RF LKAVPFSKNITFGV DVK+LIS LA S+
Sbjct  774  EEVVVSIHMDVFRKNGFTIEEDPRSLPGNRFRLKAVPFSKNITFGVEDVKDLISTLADSE  833

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SYR DT+DS+CP RVRAMLASRACRSSVMIGDPLGRNEMQKILEHLA LKSPW
Sbjct  834  GECSIIGSYRMDTADSVCPSRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAELKSPW  893

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTTV +
Sbjct  894  NCPHGRPTMRHLVDLTTVKR  913



>ref|XP_006575115.1| PREDICTED: DNA mismatch repair protein PMS1-like [Glycine max]
Length=946

 Score =   339 bits (870),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFII KLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRP+K++LSPE
Sbjct  737  RMKVIGQFNLGFIICKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPIKLELSPE  796

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV SM+MD IRKNGF+LEED +APPG RF LK+VPFSKN  FG+ DVKELISIL+   
Sbjct  797  EEIVASMHMDIIRKNGFTLEEDPNAPPGCRFKLKSVPFSKNTMFGIEDVKELISILSDGD  856

Query  363  E--DCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
               +C I  SY+ DTSDS+CP RVRAMLASRACRSS+M+GD LGRNEMQKILEH+A LKS
Sbjct  857  GHVECSIVGSYKLDTSDSVCPSRVRAMLASRACRSSIMVGDALGRNEMQKILEHMAELKS  916

Query  537  PWNCPHGRPTMRHLIDLTTVHK  602
            PWNCPHGRPTMRHL+DLT +HK
Sbjct  917  PWNCPHGRPTMRHLVDLTKIHK  938



>ref|XP_003536886.1| PREDICTED: DNA mismatch repair protein PMS1-like isoform X1 [Glycine 
max]
Length=944

 Score =   337 bits (865),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFII KLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRP+K++LSPE
Sbjct  735  RMKVIGQFNLGFIICKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPIKLELSPE  794

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EEIV SM+MD IRKNGF+LEED +APPG RF LK+VPFSKN  FG+ DVKELISIL+   
Sbjct  795  EEIVASMHMDIIRKNGFTLEEDPNAPPGCRFKLKSVPFSKNTMFGIEDVKELISILSDGD  854

Query  363  E--DCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
               +C I  SY+ DTSDS+CP RVRAMLASRACRSS+M+GD LGRNEMQKILEH+A LKS
Sbjct  855  GHVECSIVGSYKLDTSDSVCPSRVRAMLASRACRSSIMVGDALGRNEMQKILEHMAELKS  914

Query  537  PWNCPHGRPTMRHLIDLTTVH  599
            PWNCPHGRPTMRHL+DLT +H
Sbjct  915  PWNCPHGRPTMRHLVDLTKIH  935



>gb|AFW62793.1| hypothetical protein ZEAMMB73_370746 [Zea mays]
Length=205

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  12   VIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEEI  191
            V+GQF+LGFIIGKL +DLFIVDQHA+DEKYN+E LS+STILN QPLL PL++DLSPEEE+
Sbjct  2    VVGQFNLGFIIGKLGQDLFIVDQHASDEKYNFECLSQSTILNVQPLLEPLRLDLSPEEEV  61

Query  192  VVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQEDC  371
            +VSMNM TIRKNGF L EDLHA PG  + LKAVPFSKNITFGV DVKELIS+LA SQ DC
Sbjct  62   IVSMNMSTIRKNGFVLAEDLHASPGNHYLLKAVPFSKNITFGVQDVKELISMLADSQGDC  121

Query  372  HITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNCP  551
             I  SY+ DT+DS+CP RVRAMLASRACR S MIGDPL + EM+KIL+++A L+SPWNCP
Sbjct  122  SIISSYKLDTADSVCPSRVRAMLASRACRMSTMIGDPLTKAEMKKILKNMAGLRSPWNCP  181

Query  552  HGRPTMRHLIDLTTVHKR  605
            HGRPTMRHL DL T+  +
Sbjct  182  HGRPTMRHLADLRTMKAK  199



>ref|XP_002523056.1| DNA mismatch repair protein pms2, putative [Ricinus communis]
 gb|EEF39241.1| DNA mismatch repair protein pms2, putative [Ricinus communis]
Length=924

 Score =   334 bits (856),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E L +STILNQQPLLR L+++LSPE
Sbjct  716  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFEHLCQSTILNQQPLLRSLRLELSPE  775

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SMNM+ IRKNGF+LEED HAPPG RF LKAVPFSKNITFGV DVK+LIS LA SQ
Sbjct  776  EEVVASMNMELIRKNGFALEEDPHAPPGHRFKLKAVPFSKNITFGVEDVKDLISTLADSQ  835

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC I  SY+ D SDS+CP RVR MLASRACRSSVMIGDPLGRNEMQKILEHLA L SPW
Sbjct  836  GDCSIIGSYKMDKSDSVCPSRVRTMLASRACRSSVMIGDPLGRNEMQKILEHLADLNSPW  895

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+D+T+++KR
Sbjct  896  NCPHGRPTMRHLVDMTSIYKR  916



>ref|XP_004495972.1| PREDICTED: DNA mismatch repair protein PMS1-like [Cicer arietinum]
Length=939

 Score =   333 bits (854),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 179/203 (88%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E LS+STIL+QQPLLRP++++LSPE
Sbjct  730  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFECLSQSTILSQQPLLRPIRLELSPE  789

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA--S  356
            EEIV S++MD IRKNGF+LEED +APPG R+ LK+VP+SKNI FGV DVKELIS L+   
Sbjct  790  EEIVASIHMDIIRKNGFTLEEDQNAPPGCRYKLKSVPYSKNIMFGVEDVKELISTLSDGD  849

Query  357  SQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
               +C I  SY++D+ DSICPPRVRAMLASRACRSS+MIGD LGRNEM KILEHLA LKS
Sbjct  850  GHGECSIIGSYKQDSLDSICPPRVRAMLASRACRSSIMIGDALGRNEMHKILEHLAELKS  909

Query  537  PWNCPHGRPTMRHLIDLTTVHKR  605
            PWNCPHGRPTMRHL DLT +HKR
Sbjct  910  PWNCPHGRPTMRHLADLTKIHKR  932



>emb|CBI36837.3| unnamed protein product [Vitis vinifera]
Length=854

 Score =   329 bits (844),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E L++ST+LNQQPLLRPL++DLSPE
Sbjct  634  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFEHLAQSTVLNQQPLLRPLRLDLSPE  693

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++ S++MD IRKNGF+LEEDLHAPPG RF LKAVPFSKNITFGV DVKELIS LA  Q
Sbjct  694  EEVIASIHMDIIRKNGFALEEDLHAPPGQRFKLKAVPFSKNITFGVEDVKELISTLADGQ  753

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  +Y+ DT DSICP RVRAMLASRACRSSVMIGDPLGR EMQ+ILEHL+ LKSPW
Sbjct  754  GECSILGTYKMDTCDSICPSRVRAMLASRACRSSVMIGDPLGRKEMQRILEHLSDLKSPW  813

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT++K
Sbjct  814  NCPHGRPTMRHLVDLTTIYK  833



>ref|XP_010652177.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Vitis 
vinifera]
Length=943

 Score =   330 bits (845),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E L++ST+LNQQPLLRPL++DLSPE
Sbjct  723  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFEHLAQSTVLNQQPLLRPLRLDLSPE  782

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++ S++MD IRKNGF+LEEDLHAPPG RF LKAVPFSKNITFGV DVKELIS LA  Q
Sbjct  783  EEVIASIHMDIIRKNGFALEEDLHAPPGQRFKLKAVPFSKNITFGVEDVKELISTLADGQ  842

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  +Y+ DT DSICP RVRAMLASRACRSSVMIGDPLGR EMQ+ILEHL+ LKSPW
Sbjct  843  GECSILGTYKMDTCDSICPSRVRAMLASRACRSSVMIGDPLGRKEMQRILEHLSDLKSPW  902

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT++K
Sbjct  903  NCPHGRPTMRHLVDLTTIYK  922



>ref|XP_007199731.1| hypothetical protein PRUPE_ppa002523mg [Prunus persica]
 gb|EMJ00930.1| hypothetical protein PRUPE_ppa002523mg [Prunus persica]
Length=662

 Score =   323 bits (828),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPL++DLSP+
Sbjct  454  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLRLDLSPQ  513

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM++D IRKNGFSLEED HAPPG  F LKAVPFSKNITFGV DVK+LIS LA S 
Sbjct  514  EEVVASMHIDIIRKNGFSLEEDPHAPPGQHFKLKAVPFSKNITFGVEDVKDLISTLADSH  573

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ DT DS+CP RVRAMLASRACRSSVMIGD LGRNEMQ+ILEHLA LKSPW
Sbjct  574  GECSIIGSYKMDTVDSVCPSRVRAMLASRACRSSVMIGDALGRNEMQRILEHLAGLKSPW  633

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL T+ +
Sbjct  634  NCPHGRPTMRHLVDLKTIRR  653



>ref|XP_010652175.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Vitis 
vinifera]
 ref|XP_010652176.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Vitis 
vinifera]
Length=958

 Score =   330 bits (845),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E L++ST+LNQQPLLRPL++DLSPE
Sbjct  738  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFEHLAQSTVLNQQPLLRPLRLDLSPE  797

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++ S++MD IRKNGF+LEEDLHAPPG RF LKAVPFSKNITFGV DVKELIS LA  Q
Sbjct  798  EEVIASIHMDIIRKNGFALEEDLHAPPGQRFKLKAVPFSKNITFGVEDVKELISTLADGQ  857

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  +Y+ DT DSICP RVRAMLASRACRSSVMIGDPLGR EMQ+ILEHL+ LKSPW
Sbjct  858  GECSILGTYKMDTCDSICPSRVRAMLASRACRSSVMIGDPLGRKEMQRILEHLSDLKSPW  917

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT++K
Sbjct  918  NCPHGRPTMRHLVDLTTIYK  937



>gb|EPS64298.1| hypothetical protein M569_10482, partial [Genlisea aurea]
Length=855

 Score =   327 bits (839),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 175/200 (88%), Gaps = 2/200 (1%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            MKVIGQF+LGFIIGKL+ DLFIVDQHAADEKYNYE L+ +T+LNQQPLLRPLKM++SPEE
Sbjct  652  MKVIGQFNLGFIIGKLNSDLFIVDQHAADEKYNYESLARTTVLNQQPLLRPLKMEMSPEE  711

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            EIV+SMNM+  RKNGF LEED+ APPG RF LKAVPFSKN+ FGV+DVK+L+SIL S   
Sbjct  712  EIVISMNMNIFRKNGFLLEEDIDAPPGHRFILKAVPFSKNVVFGVSDVKDLVSIL-SDGY  770

Query  366  DCHITLS-YRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            DC I  S YR DT DS+CPP+V  MLASRACRSSVMIGDPLG NEM+KI+E+LA LKSPW
Sbjct  771  DCSIPCSSYRSDTRDSVCPPKVGEMLASRACRSSVMIGDPLGMNEMRKIVENLATLKSPW  830

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL TVHK
Sbjct  831  NCPHGRPTMRHLVDLRTVHK  850



>ref|XP_010088502.1| Mismatch repair endonuclease PMS2 [Morus notabilis]
 gb|EXB36415.1| Mismatch repair endonuclease PMS2 [Morus notabilis]
Length=938

 Score =   328 bits (842),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEK+N+ERLS+STILN QPLLRPL+++LSPE
Sbjct  730  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKFNFERLSQSTILNLQPLLRPLRLELSPE  789

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MD IRKNGF+LEED +APPG  F LKAVPFSKNITFGV DVK+LIS LA   
Sbjct  790  EEVVASMHMDIIRKNGFALEEDPNAPPGHHFKLKAVPFSKNITFGVEDVKDLISTLADDH  849

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SYR DT+DSICPPRVRAMLASRACRSSVMIGD LGRNEMQKILEHLA LKSPW
Sbjct  850  GECSIIGSYRMDTADSICPPRVRAMLASRACRSSVMIGDALGRNEMQKILEHLARLKSPW  909

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DLTT++KR
Sbjct  910  NCPHGRPTMRHLVDLTTIYKR  930



>gb|KHG16579.1| Mismatch repair endonuclease PMS2 [Gossypium arboreum]
Length=969

 Score =   328 bits (840),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKV+GQF+LGFIIGKLD DLFIVDQHAADEKYN+E L++STILNQQPLLRPL+++LSPE
Sbjct  761  RMKVVGQFNLGFIIGKLDEDLFIVDQHAADEKYNFEHLAQSTILNQQPLLRPLRLELSPE  820

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MD IRKNGF LEED HAPPG  FNL+AVPFSKNITFGV DVK+LIS L+ SQ
Sbjct  821  EEVVASMHMDIIRKNGFILEEDPHAPPGHHFNLRAVPFSKNITFGVEDVKDLISTLSDSQ  880

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ DTSDS+CP RVRAMLASRACRSSVM+GDPLGRNEMQKI+EHLA LKSPW
Sbjct  881  GECSIIGSYKMDTSDSVCPTRVRAMLASRACRSSVMVGDPLGRNEMQKIVEHLADLKSPW  940

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  941  NCPHGRPTMRHLVDLTTLSK  960



>gb|KHN03729.1| Mismatch repair endonuclease PMS2 [Glycine soja]
Length=847

 Score =   325 bits (834),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 178/213 (84%), Gaps = 13/213 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFII KLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRP+K++LSPE
Sbjct  627  RMKVIGQFNLGFIICKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPIKLELSPE  686

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVAD-----------V  329
            EEIV SM+MD IRKNGF+LEED +APPG RF LK+VPFSKN  FG+             V
Sbjct  687  EEIVASMHMDIIRKNGFTLEEDPNAPPGCRFKLKSVPFSKNTMFGIEGRSRKSIFIGPYV  746

Query  330  KELISILASSQE--DCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQ  503
            KELISIL+      +C I  SY+ DTSDS+CP RVRAMLASRACRSS+M+GD LGRNEMQ
Sbjct  747  KELISILSDGDGHVECSIVGSYKLDTSDSVCPSRVRAMLASRACRSSIMVGDALGRNEMQ  806

Query  504  KILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  602
            KILEH+A LKSPWNCPHGRPTMRHL++LT +HK
Sbjct  807  KILEHMAELKSPWNCPHGRPTMRHLVELTKIHK  839



>emb|CAN75888.1| hypothetical protein VITISV_023640 [Vitis vinifera]
Length=3804

 Score =   336 bits (862),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 181/222 (82%), Gaps = 22/222 (10%)
 Frame = +3

Query  3     QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLR---------  155
             +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+E L++ST+LNQQPLLR         
Sbjct  3434  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFEHLAQSTVLNQQPLLRYGVQNIHEV  3493

Query  156   -------------PLKMDLSPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPF  296
                          PL++DLSPEEE++  ++MD IRKNGF+LEEDLHAPPG RF LKAVPF
Sbjct  3494  TSIELLCVSYTIGPLRLDLSPEEEVIAFIHMDIIRKNGFALEEDLHAPPGQRFKLKAVPF  3553

Query  297   SKNITFGVADVKELISILASSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIG  476
             SKNITFGV DVKELIS LA  Q +C I  +Y+ DT DSICP RVRAMLASRACRSSVMIG
Sbjct  3554  SKNITFGVEDVKELISTLADGQGECSILGTYKMDTCDSICPSRVRAMLASRACRSSVMIG  3613

Query  477   DPLGRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  602
             DPLGR EMQ+ILEHL+ LKSPWNCPHGRPTMRHL+DLTT++K
Sbjct  3614  DPLGRKEMQRILEHLSDLKSPWNCPHGRPTMRHLVDLTTIYK  3655



>ref|XP_006840542.1| PREDICTED: DNA mismatch repair protein PMS1 [Amborella trichopoda]
 gb|ERN02217.1| hypothetical protein AMTR_s00045p00213360 [Amborella trichopoda]
Length=963

 Score =   327 bits (839),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFIIG+LD+DLFI+DQHAADEKYN+ERLS STILNQQPLL+P++++LSPE
Sbjct  763  RMQVIGQFNLGFIIGRLDQDLFIIDQHAADEKYNFERLSHSTILNQQPLLKPIRLELSPE  822

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+  S++MD IRKNGF+L E+ +APPG  F LKAVPFSKNITFGV DVKELI+ L+ SQ
Sbjct  823  EEVTASIHMDIIRKNGFTLVENFNAPPGNHFLLKAVPFSKNITFGVEDVKELIATLSDSQ  882

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            ++C +  SY+ D S+SICP R+RAMLASRACRSS+MIGDPL +NEMQK+L HLA LKSPW
Sbjct  883  DECTMISSYKIDDSNSICPSRIRAMLASRACRSSIMIGDPLRKNEMQKVLRHLAELKSPW  942

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL+TV K
Sbjct  943  NCPHGRPTMRHLVDLSTVRK  962



>ref|XP_008386660.1| PREDICTED: DNA mismatch repair protein PMS1 [Malus domestica]
Length=985

 Score =   327 bits (838),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPL+++LSP+
Sbjct  776  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLRLELSPQ  835

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM++D IRKNGFSLEED  APPG  FNLKAVPFSKNITFGV DVK+LIS LA S 
Sbjct  836  EEVVASMHIDIIRKNGFSLEEDPQAPPGQHFNLKAVPFSKNITFGVEDVKDLISTLADSH  895

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SY+ DT DS+CP RVRAMLASRACRSSVMIGD LGRNEMQKILEHLA LKSPW
Sbjct  896  GECSVMGSYKTDTVDSVCPSRVRAMLASRACRSSVMIGDALGRNEMQKILEHLAGLKSPW  955

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL T+ +R
Sbjct  956  NCPHGRPTMRHLVDLKTIRRR  976



>gb|KJB49940.1| hypothetical protein B456_008G146300 [Gossypium raimondii]
Length=967

 Score =   327 bits (837),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKV+GQF+LGFIIGKLD DLFIVDQHAADEKYN+E L++STI NQQPLLRPL+++LSPE
Sbjct  760  RMKVVGQFNLGFIIGKLDEDLFIVDQHAADEKYNFEHLAQSTIFNQQPLLRPLRLELSPE  819

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MD IRKNGF LEED HAPPG  FNL+AVPFSKNITFGV DVK+LIS L+ SQ
Sbjct  820  EEVVASMHMDIIRKNGFILEEDPHAPPGHHFNLRAVPFSKNITFGVEDVKDLISTLSDSQ  879

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ DTSDS+CP RVRAMLASRACRSSVM+GDPLGRNEMQKI+EHLA LKSPW
Sbjct  880  GECSIIGSYKMDTSDSVCPTRVRAMLASRACRSSVMVGDPLGRNEMQKIVEHLADLKSPW  939

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  940  NCPHGRPTMRHLVDLTTLSK  959



>ref|XP_007144293.1| hypothetical protein PHAVU_007G144100g [Phaseolus vulgaris]
 gb|ESW16287.1| hypothetical protein PHAVU_007G144100g [Phaseolus vulgaris]
Length=929

 Score =   325 bits (834),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFII KLD+DLFIVDQHAADEK+N+ERLS+STILNQQPLLRP+ ++LSPE
Sbjct  720  RMKVIGQFNLGFIICKLDQDLFIVDQHAADEKFNFERLSQSTILNQQPLLRPITLELSPE  779

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISIL--AS  356
            EEIV SM MD IRKNGF+LEED +A PG RF LK+VPFSKN  FG+ DVKELIS L    
Sbjct  780  EEIVASMYMDVIRKNGFTLEEDPNAQPGCRFKLKSVPFSKNTMFGIEDVKELISTLCDGD  839

Query  357  SQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
               +C I  S++ D+SDS+CP RVRAMLASRACRSS+M+GD LGRNEMQKILEH+A LKS
Sbjct  840  GHMECSIVGSFKLDSSDSMCPSRVRAMLASRACRSSIMVGDALGRNEMQKILEHMAELKS  899

Query  537  PWNCPHGRPTMRHLIDLTTVHKR  605
            PWNCPHGRPTMRHL+DL  +H+R
Sbjct  900  PWNCPHGRPTMRHLVDLAKIHRR  922



>ref|XP_007050886.1| DNA mismatch repair protein, putative isoform 2 [Theobroma cacao]
 gb|EOX95043.1| DNA mismatch repair protein, putative isoform 2 [Theobroma cacao]
Length=847

 Score =   322 bits (825),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            ++VIGQF+LGFIIGKLD+DLF+VDQHAADEKYN+ERL++STILNQQPLLRPL+++LSPEE
Sbjct  640  VQVIGQFNLGFIIGKLDQDLFMVDQHAADEKYNFERLAQSTILNQQPLLRPLRLELSPEE  699

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E+V SM+MD IRKNGF LEED HA PG RF L+AVPFSKNITFGV DVK+LIS LA SQ 
Sbjct  700  EVVASMHMDIIRKNGFLLEEDPHASPGHRFKLRAVPFSKNITFGVEDVKDLISTLADSQG  759

Query  366  DCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWN  545
            +C I  SY+ DTSDS+CP RVRAMLASRACRSSVMIGDPLGRNEMQKI+E LA LKSPWN
Sbjct  760  ECSIISSYKMDTSDSVCPTRVRAMLASRACRSSVMIGDPLGRNEMQKIIERLADLKSPWN  819

Query  546  CPHGRPTMRHLIDLTTVHK  602
            CPHGRPTMRHL+DLT + K
Sbjct  820  CPHGRPTMRHLVDLTALSK  838



>ref|XP_010038198.1| PREDICTED: DNA mismatch repair protein PMS1 [Eucalyptus grandis]
 gb|KCW50017.1| hypothetical protein EUGRSUZ_K03466 [Eucalyptus grandis]
Length=922

 Score =   322 bits (825),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM+VIGQF+LGFIIGKLD DLFIVDQHAADEK+N+ERL  STIL QQPLLRPL+++LSPE
Sbjct  716  QMQVIGQFNLGFIIGKLDEDLFIVDQHAADEKFNFERLCHSTILKQQPLLRPLRLELSPE  775

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+MDTIRKNGF LEED HAPPG  F L A+PFSKNITFGV DVK+LIS LA SQ
Sbjct  776  EEVVASMHMDTIRKNGFVLEEDPHAPPGCHFRLTAIPFSKNITFGVEDVKDLISTLADSQ  835

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SYR DT  S+CP RVRAMLASRACRSSVMIGDPLG++EMQKILEHLA LKSPW
Sbjct  836  GECSILGSYRSDTISSVCPSRVRAMLASRACRSSVMIGDPLGKSEMQKILEHLADLKSPW  895

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL+DL TV KR
Sbjct  896  NCPHGRPTMRHLVDLATVGKR  916



>ref|XP_008235055.1| PREDICTED: DNA mismatch repair protein PMS1 [Prunus mume]
Length=981

 Score =   323 bits (827),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPL+++LSP+
Sbjct  773  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLRLELSPQ  832

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM++D IRKNGFSLEED HAPPG  F LKAVPFSKNITFGV DVK+LIS LA S 
Sbjct  833  EEVVASMHIDIIRKNGFSLEEDPHAPPGHHFKLKAVPFSKNITFGVEDVKDLISTLADSH  892

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ DT DS+CP RVRAMLASRACRSSVMIGD LGRNEMQ+ILEHLA LKSPW
Sbjct  893  GECSIIGSYKMDTVDSVCPSRVRAMLASRACRSSVMIGDALGRNEMQRILEHLAGLKSPW  952

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL T+ +
Sbjct  953  NCPHGRPTMRHLVDLKTIRR  972



>ref|XP_010914441.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X4 [Elaeis 
guineensis]
Length=906

 Score =   320 bits (820),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFIVDQHAADEK N+E+LS+ST LN QPLL+P++++LSPE
Sbjct  679  RMEVVGQFNLGFIIGKLDDDLFIVDQHAADEKCNFEQLSQSTTLNLQPLLQPMRLELSPE  738

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+M+ IR NGF L ED HAPPG RF LKAVPFSKNITFG  DVK+LI  LA SQ
Sbjct  739  EEVVASMHMEVIRGNGFVLMEDAHAPPGHRFLLKAVPFSKNITFGAEDVKDLICTLADSQ  798

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            EDC I  SY+ DTSDSICP RVRAMLASRACR+SVMIGDPL R EMQ+IL +LA LKSPW
Sbjct  799  EDCSIIGSYKMDTSDSICPSRVRAMLASRACRTSVMIGDPLTRKEMQRILHNLADLKSPW  858

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL DL ++H
Sbjct  859  NCPHGRPTMRHLADLISIH  877



>ref|XP_010914440.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X3 [Elaeis 
guineensis]
Length=922

 Score =   320 bits (821),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFIVDQHAADEK N+E+LS+ST LN QPLL+P++++LSPE
Sbjct  717  RMEVVGQFNLGFIIGKLDDDLFIVDQHAADEKCNFEQLSQSTTLNLQPLLQPMRLELSPE  776

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+M+ IR NGF L ED HAPPG RF LKAVPFSKNITFG  DVK+LI  LA SQ
Sbjct  777  EEVVASMHMEVIRGNGFVLMEDAHAPPGHRFLLKAVPFSKNITFGAEDVKDLICTLADSQ  836

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            EDC I  SY+ DTSDSICP RVRAMLASRACR+SVMIGDPL R EMQ+IL +LA LKSPW
Sbjct  837  EDCSIIGSYKMDTSDSICPSRVRAMLASRACRTSVMIGDPLTRKEMQRILHNLADLKSPW  896

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL DL ++H
Sbjct  897  NCPHGRPTMRHLADLISIH  915



>ref|XP_010914439.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Elaeis 
guineensis]
Length=932

 Score =   320 bits (820),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFIVDQHAADEK N+E+LS+ST LN QPLL+P++++LSPE
Sbjct  717  RMEVVGQFNLGFIIGKLDDDLFIVDQHAADEKCNFEQLSQSTTLNLQPLLQPMRLELSPE  776

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+M+ IR NGF L ED HAPPG RF LKAVPFSKNITFG  DVK+LI  LA SQ
Sbjct  777  EEVVASMHMEVIRGNGFVLMEDAHAPPGHRFLLKAVPFSKNITFGAEDVKDLICTLADSQ  836

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            EDC I  SY+ DTSDSICP RVRAMLASRACR+SVMIGDPL R EMQ+IL +LA LKSPW
Sbjct  837  EDCSIIGSYKMDTSDSICPSRVRAMLASRACRTSVMIGDPLTRKEMQRILHNLADLKSPW  896

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL DL ++H
Sbjct  897  NCPHGRPTMRHLADLISIH  915



>ref|XP_010914434.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010914435.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010914436.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010914437.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Elaeis 
guineensis]
Length=944

 Score =   320 bits (820),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFIVDQHAADEK N+E+LS+ST LN QPLL+P++++LSPE
Sbjct  717  RMEVVGQFNLGFIIGKLDDDLFIVDQHAADEKCNFEQLSQSTTLNLQPLLQPMRLELSPE  776

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+M+ IR NGF L ED HAPPG RF LKAVPFSKNITFG  DVK+LI  LA SQ
Sbjct  777  EEVVASMHMEVIRGNGFVLMEDAHAPPGHRFLLKAVPFSKNITFGAEDVKDLICTLADSQ  836

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            EDC I  SY+ DTSDSICP RVRAMLASRACR+SVMIGDPL R EMQ+IL +LA LKSPW
Sbjct  837  EDCSIIGSYKMDTSDSICPSRVRAMLASRACRTSVMIGDPLTRKEMQRILHNLADLKSPW  896

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL DL ++H
Sbjct  897  NCPHGRPTMRHLADLISIH  915



>ref|XP_011033556.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Populus 
euphratica]
Length=826

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERL +STILNQQPLLRPL+++LSPE
Sbjct  618  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLCQSTILNQQPLLRPLRLELSPE  677

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SMN+D IRKNGF+LEED HA PG  F LKAVPFSKNITFGV DVK+LIS LA S+
Sbjct  678  EEVVASMNLDIIRKNGFALEEDPHALPGHHFKLKAVPFSKNITFGVEDVKDLISTLADSE  737

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I   Y+ DT+DS+CP RV AM ASRACRSSVMIGD LGRNEMQKILEHL  LKSPW
Sbjct  738  GECSIISRYKMDTADSVCPSRVHAMFASRACRSSVMIGDALGRNEMQKILEHLVDLKSPW  797

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHLID++++++R
Sbjct  798  NCPHGRPTMRHLIDMSSIYER  818



>ref|XP_002321013.1| DNA mismatch repair family protein [Populus trichocarpa]
 gb|EEE99328.1| DNA mismatch repair family protein [Populus trichocarpa]
Length=915

 Score =   319 bits (817),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERL +STILNQQPLLRPL+++LSPE
Sbjct  707  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLCQSTILNQQPLLRPLRLELSPE  766

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SMN+D IRKNGF+LEED HA PG  F LKAVPFSKNITFGV DVK+LIS LA SQ
Sbjct  767  EEVVASMNLDIIRKNGFALEEDPHALPGHHFKLKAVPFSKNITFGVEDVKDLISTLADSQ  826

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I   Y+ DT+DS+CP RV AM ASRACRSSVMIGD LGRNEMQKILEHL  LKSPW
Sbjct  827  GECSIISRYKMDTADSVCPSRVHAMFASRACRSSVMIGDALGRNEMQKILEHLVDLKSPW  886

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHLID++++++R
Sbjct  887  NCPHGRPTMRHLIDMSSIYER  907



>ref|XP_010429737.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
Length=424

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  208  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  267

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  APPG  F L+ VP+SKNITFGV D+K+LIS L  + 
Sbjct  268  EEVTVLMHMDIIRENGFLLEENPGAPPGKHFRLRVVPYSKNITFGVEDLKDLISTLGDNH  327

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SY+ + +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  328  GECSVVSSYKTNKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  387

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  388  NCPHGRPTMRHLVDLTTLLK  407



>ref|XP_007050885.1| DNA mismatch repair protein pms2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX95042.1| DNA mismatch repair protein pms2, putative isoform 1 [Theobroma 
cacao]
Length=1017

 Score =   320 bits (821),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/246 (65%), Positives = 180/246 (73%), Gaps = 46/246 (19%)
 Frame = +3

Query  3     QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLR---------  155
             +MKVIGQF+LGFIIGKLD+DLF+VDQHAADEKYN+ERL++STILNQQPLLR         
Sbjct  763   RMKVIGQFNLGFIIGKLDQDLFMVDQHAADEKYNFERLAQSTILNQQPLLRRGKVMSKKR  822

Query  156   ----------------------PLKMDLSPEEEIVVSMNMDTIR---------------K  224
                                   PL+++LSPEEE+V SM+MD IR               K
Sbjct  823   KVYYALVMSISFYIFSKTSGTWPLRLELSPEEEVVASMHMDIIRFNLLLFVVSLVIYHLK  882

Query  225   NGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQEDCHITLSYRKDTS  404
             NGF LEED HA PG RF L+AVPFSKNITFGV DVK+LIS LA SQ +C I  SY+ DTS
Sbjct  883   NGFLLEEDPHASPGHRFKLRAVPFSKNITFGVEDVKDLISTLADSQGECSIISSYKMDTS  942

Query  405   DSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNCPHGRPTMRHLID  584
             DS+CP RVRAMLASRACRSSVMIGDPLGRNEMQKI+E LA LKSPWNCPHGRPTMRHL+D
Sbjct  943   DSVCPTRVRAMLASRACRSSVMIGDPLGRNEMQKIIERLADLKSPWNCPHGRPTMRHLVD  1002

Query  585   LTTVHK  602
             LT + K
Sbjct  1003  LTALSK  1008



>ref|XP_011458719.1| PREDICTED: DNA mismatch repair protein PMS1 [Fragaria vesca subsp. 
vesca]
Length=953

 Score =   319 bits (817),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLRPL+++LSPE
Sbjct  745  KMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRPLRLELSPE  804

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM++D IRKNGFSLEED HAPP   F LKAVPFSKNITFGV DVK+LIS LA S 
Sbjct  805  EEVVASMHIDIIRKNGFSLEEDPHAPPCHHFKLKAVPFSKNITFGVEDVKDLISTLADSH  864

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ DT DS+CP RVRAMLASRACRSSVMIGD LGRNEM+KILEHLA LKSPW
Sbjct  865  GECAIIGSYKMDTVDSVCPSRVRAMLASRACRSSVMIGDALGRNEMRKILEHLAGLKSPW  924

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHLIDL T+ +
Sbjct  925  NCPHGRPTMRHLIDLKTIRR  944



>ref|XP_011033555.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Populus 
euphratica]
Length=915

 Score =   317 bits (813),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MKVIGQF+LGFIIGKLD+DLFIVDQHAADEKYN+ERL +STILNQQPLLRPL+++LSPE
Sbjct  707  RMKVIGQFNLGFIIGKLDQDLFIVDQHAADEKYNFERLCQSTILNQQPLLRPLRLELSPE  766

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SMN+D IRKNGF+LEED HA PG  F LKAVPFSKNITFGV DVK+LIS LA S+
Sbjct  767  EEVVASMNLDIIRKNGFALEEDPHALPGHHFKLKAVPFSKNITFGVEDVKDLISTLADSE  826

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I   Y+ DT+DS+CP RV AM ASRACRSSVMIGD LGRNEMQKILEHL  LKSPW
Sbjct  827  GECSIISRYKMDTADSVCPSRVHAMFASRACRSSVMIGDALGRNEMQKILEHLVDLKSPW  886

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHLID++++++R
Sbjct  887  NCPHGRPTMRHLIDMSSIYER  907



>gb|KHN46574.1| Mismatch repair endonuclease PMS2 [Glycine soja]
Length=970

 Score =   318 bits (816),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 178/226 (79%), Gaps = 26/226 (12%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLR---------  155
            +MKVIGQF+LGFII KLD+DLFIVDQHAADEKYN+ERLS+STILNQQPLLR         
Sbjct  737  RMKVIGQFNLGFIICKLDQDLFIVDQHAADEKYNFERLSQSTILNQQPLLRGVSITRYKE  796

Query  156  -----------PLKMDLSPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSK  302
                       P+K++LSPEEEIV SM+MD IRKNGF+LEED +APPG RF LK+VPFSK
Sbjct  797  IAYSDANFQRRPIKLELSPEEEIVASMHMDIIRKNGFTLEEDPNAPPGCRFKLKSVPFSK  856

Query  303  NITFGVAD----VKELISILASSQE--DCHITLSYRKDTSDSICPPRVRAMLASRACRSS  464
            N  FG+      VKELISIL+      +C I  SY+ DTSDS+CP RVRAMLASRACRSS
Sbjct  857  NTMFGIEGRWFYVKELISILSDGDGHVECSIVGSYKLDTSDSVCPSRVRAMLASRACRSS  916

Query  465  VMIGDPLGRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  602
            +M+GD LGRNEMQKILEH+A LKSPWNCPHGRPTMRHL+DLT +HK
Sbjct  917  IMVGDALGRNEMQKILEHMAELKSPWNCPHGRPTMRHLVDLTKIHK  962



>ref|XP_008678747.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Zea mays]
Length=983

 Score =   318 bits (815),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKL +DLFIVDQHA+DEKYN+E LS+STILN QPLL PL++DLSPE
Sbjct  777  EMEVVGQFNLGFIIGKLGQDLFIVDQHASDEKYNFECLSQSTILNVQPLLEPLRLDLSPE  836

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++VSMNM TIRKNGF L EDLHA PG  + LKAVPFSKNITFGV DVKELIS+LA SQ
Sbjct  837  EEVIVSMNMSTIRKNGFVLAEDLHASPGNHYLLKAVPFSKNITFGVQDVKELISMLADSQ  896

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC I  SY+ DT+DS+CP RVRAMLASRACR S MIGDPL + EM+KIL+++A L+SPW
Sbjct  897  GDCSIISSYKLDTADSVCPSRVRAMLASRACRMSTMIGDPLTKAEMKKILKNMAGLRSPW  956

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPTMRHL DL T+  +
Sbjct  957  NCPHGRPTMRHLADLRTMKAK  977



>ref|XP_008805742.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein PMS1 
[Phoenix dactylifera]
Length=919

 Score =   317 bits (811),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFIVDQHAADEK N+E+LS+ST LN QPLL+P++++LSPE
Sbjct  714  RMEVVGQFNLGFIIGKLDDDLFIVDQHAADEKCNFEQLSQSTTLNLQPLLQPMRLELSPE  773

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SM+M+ IR+NGF L ED HAPPG RF +KAVPFSKNITFG  DVK+LI  LA +Q
Sbjct  774  EEVVASMHMEVIRRNGFVLMEDAHAPPGHRFLVKAVPFSKNITFGAEDVKDLICTLADNQ  833

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            EDC I  SY+ DTSDS+CP RVRAMLASRACR+SVMIGDPL R EMQ+IL  LA LKSPW
Sbjct  834  EDCSIIGSYKMDTSDSLCPSRVRAMLASRACRTSVMIGDPLTRKEMQRILHDLADLKSPW  893

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL DL ++H
Sbjct  894  NCPHGRPTMRHLADLISIH  912



>ref|XP_009405473.1| PREDICTED: DNA mismatch repair protein PMS1 [Musa acuminata subsp. 
malaccensis]
Length=916

 Score =   316 bits (810),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM+VIGQF+LGFIIGK+++DLFI+DQHAADEKYN+ERLS+STILN QPLL+P++++LSPE
Sbjct  708  QMQVIGQFNLGFIIGKIEQDLFIIDQHAADEKYNFERLSQSTILNLQPLLKPMRLELSPE  767

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V SMNM  IRKNGF+L ED+HA PG RF LKAVPFS+NI FG  DVKELISIL+ +Q
Sbjct  768  EEVVASMNMQIIRKNGFTLIEDMHASPGHRFLLKAVPFSRNIIFGAEDVKELISILSDNQ  827

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +   Y+ DTSDS+CP RVRAMLASRACR+SVMIGDPL ++EMQKIL +LA L SPW
Sbjct  828  GECGVMGCYKMDTSDSVCPSRVRAMLASRACRTSVMIGDPLTKSEMQKILRNLADLNSPW  887

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL D+  +
Sbjct  888  NCPHGRPTMRHLADMAAI  905



>ref|XP_010522786.1| PREDICTED: DNA mismatch repair protein PMS1 [Tarenaya hassleriana]
Length=924

 Score =   316 bits (809),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KLD+DLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL+++L+PE
Sbjct  715  RMQVIGQFNLGFIIAKLDKDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLRLELAPE  774

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ VSM+MD IR+NGF LEE+ +  PG  F L+AVPFSKNITFGV D+K+LIS L  +Q
Sbjct  775  EEVTVSMHMDVIRQNGFILEENPNGRPGCHFRLRAVPFSKNITFGVEDLKDLISTLGDNQ  834

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC +   Y+ + +DS+CP RVRAMLASRACRSSV +GDPLG+NEMQKI+EHLA L+SPW
Sbjct  835  GDCSVISRYKTNKTDSVCPSRVRAMLASRACRSSVTVGDPLGKNEMQKIVEHLAGLESPW  894

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL+DLTT+H
Sbjct  895  NCPHGRPTMRHLVDLTTLH  913



>ref|NP_001047292.1| Os02g0592300 [Oryza sativa Japonica Group]
 dbj|BAD34084.1| putative PMS2 postmeiotic segregation increased 2 [Oryza sativa 
Japonica Group]
 dbj|BAF09206.1| Os02g0592300 [Oryza sativa Japonica Group]
 gb|EEC73509.1| hypothetical protein OsI_07875 [Oryza sativa Indica Group]
 gb|EEE57283.1| hypothetical protein OsJ_07338 [Oryza sativa Japonica Group]
Length=923

 Score =   314 bits (804),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD+DLFIVDQHAADEKYN+E LS+ST LN QPLL+PL++DLSPE
Sbjct  716  EMEVVGQFNLGFIIGKLDQDLFIVDQHAADEKYNFENLSQSTTLNIQPLLQPLRLDLSPE  775

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++VSMNM TIRKNGF L EDLHA P  R+ +KAVPFSKNITFG  DVKELIS+LA SQ
Sbjct  776  EEVIVSMNMSTIRKNGFVLAEDLHASPCNRYFIKAVPFSKNITFGAQDVKELISMLADSQ  835

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC I  SY+ D +DSICP RVRAMLASRACR S MIGDPL + EM+KIL++L  L+SPW
Sbjct  836  GDCSIISSYKLDRTDSICPSRVRAMLASRACRMSTMIGDPLTKTEMKKILKNLTGLRSPW  895

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRHL DL
Sbjct  896  NCPHGRPTMRHLADL  910



>gb|KFK30838.1| hypothetical protein AALP_AA6G032200 [Arabis alpina]
Length=671

 Score =   307 bits (787),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KLDRDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL M+LS E
Sbjct  455  KMQVLGQFNLGFIIAKLDRDLFIVDQHAADEKFNFENLARSTVLNQQPLLQPLTMELSAE  514

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  APPG  F L+AVP+SKNITFGV D+K+LIS L  + 
Sbjct  515  EEVTVLMHMDVIRENGFLLEENPSAPPGRHFRLRAVPYSKNITFGVEDLKDLISTLGDNH  574

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SY+   +DS+CP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L SPW
Sbjct  575  GECSVISSYKSSKTDSVCPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLDSPW  634

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL+DL ++
Sbjct  635  NCPHGRPTMRHLVDLASL  652



>ref|XP_006647441.1| PREDICTED: DNA mismatch repair protein PMS1-like [Oryza brachyantha]
Length=921

 Score =   313 bits (801),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFIVDQHAADEKYN+E LS+ST LN QPLL+PL+++LSPE
Sbjct  714  EMEVVGQFNLGFIIGKLDHDLFIVDQHAADEKYNFENLSQSTTLNIQPLLQPLRLELSPE  773

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++VSMNM TIRKNGF L ED+HA P  RF +KAVPFSKNITFG  DVKELIS+LA SQ
Sbjct  774  EEVIVSMNMSTIRKNGFVLAEDVHASPCNRFFIKAVPFSKNITFGAQDVKELISMLADSQ  833

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC I  SY+ D +DSICP RVRAMLASRACR S MIGDPL + EM+KIL++L  L+SPW
Sbjct  834  GDCSIISSYKLDRTDSICPSRVRAMLASRACRMSTMIGDPLTKAEMKKILKNLTGLRSPW  893

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL DL T+
Sbjct  894  NCPHGRPTMRHLADLRTI  911



>ref|XP_003575262.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Brachypodium 
distachyon]
Length=921

 Score =   312 bits (800),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD+DLFIVDQHAADEKYN+E LS+ST LN QPLL PL+++LSPE
Sbjct  709  EMEVVGQFNLGFIIGKLDQDLFIVDQHAADEKYNFESLSQSTTLNIQPLLHPLRLELSPE  768

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++VSMNM TIRKNGF L EDLHA PG  + LKAVPFSKNITFGV D+KELIS+L  SQ
Sbjct  769  EEVIVSMNMTTIRKNGFVLAEDLHASPGNHYLLKAVPFSKNITFGVQDMKELISMLTDSQ  828

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC I  SY+ D +DS+CP RVRAMLASRACR S MIGDPL + EM+KIL++L  L+SPW
Sbjct  829  GDCSIISSYKMDKTDSVCPSRVRAMLASRACRMSTMIGDPLTKAEMKKILKNLTGLRSPW  888

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL DL T+
Sbjct  889  NCPHGRPTMRHLADLHTI  906



>ref|XP_010422584.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
Length=922

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  706  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  765

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  APPG  F L+AVP+SKNI FGV D+K+LIS L  + 
Sbjct  766  EEVTVLMHMDIIRENGFLLEENPSAPPGKHFRLRAVPYSKNIIFGVEDLKDLISTLGDNH  825

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C I  SY+ + +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  826  GECSIVSSYKTNKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  885

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  886  NCPHGRPTMRHLVDLTTLLK  905



>ref|XP_006287017.1| hypothetical protein CARUB_v10000165mg [Capsella rubella]
 gb|EOA19915.1| hypothetical protein CARUB_v10000165mg [Capsella rubella]
Length=923

 Score =   307 bits (787),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  706  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  765

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+++ IR+NGF LEE+  APPG  F L+AVP+SKNITFGV D+K+LIS L  + 
Sbjct  766  EEVTVLMHINIIRENGFLLEENPSAPPGKHFRLRAVPYSKNITFGVEDLKDLISTLGDNH  825

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SY+ + +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  826  GECSVVSSYKTNKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  885

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  886  NCPHGRPTMRHLVDLTTLLK  905



>ref|XP_010456026.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
 ref|XP_010456027.1| PREDICTED: DNA mismatch repair protein PMS1-like [Camelina sativa]
Length=921

 Score =   307 bits (786),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 171/200 (86%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  706  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  765

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  APPG  F L+AVP+SKNITFGV D+K+LIS L  + 
Sbjct  766  EEVTVLMHMDIIRENGFLLEENPSAPPGKHFRLRAVPYSKNITFGVEDLKDLISTLGDNH  825

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +  +  SY+ + +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  826  GEYSVVSSYKTNKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  885

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DLTT+ K
Sbjct  886  NCPHGRPTMRHLVDLTTLLK  905



>gb|EMT21505.1| Mismatch repair endonuclease PMS2 [Aegilops tauschii]
Length=1379

 Score =   310 bits (794),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = +3

Query  3     QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
             +MKV+GQF+LGFIIGKL++DLFIVDQHAADEKYN+E LS+ST LN QPLL+PL+++LSPE
Sbjct  899   EMKVVGQFNLGFIIGKLEQDLFIVDQHAADEKYNFESLSQSTTLNIQPLLQPLRLELSPE  958

Query  183   EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             EE++VSM+M+TIRKNGF L EDLHA PG  + LKAVPFSKNITFGV DVKELI +L+ SQ
Sbjct  959   EEVIVSMHMNTIRKNGFVLAEDLHASPGSHYLLKAVPFSKNITFGVQDVKELICMLSDSQ  1018

Query  363   EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
              DC I  SY+ D +DS+CP RVRAM ASRACR S MIGDPL + EM+KIL++L  L+SPW
Sbjct  1019  GDCSIISSYKMDKTDSVCPSRVRAMFASRACRMSTMIGDPLTKTEMKKILKNLTGLRSPW  1078

Query  543   NCPHGRPTMRHLIDLTTV  596
             NCPHGRPTMRHL DLT++
Sbjct  1079  NCPHGRPTMRHLADLTSI  1096



>ref|XP_009144562.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Brassica 
rapa]
Length=915

 Score =   302 bits (774),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KLDRDLFIVDQHAADEK+N+E L+ ST++NQQPLL+PL ++LS E
Sbjct  696  KMQVLGQFNLGFIIAKLDRDLFIVDQHAADEKFNFEHLARSTVMNQQPLLQPLTLELSAE  755

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ + M+MD IR+NGF L+E+  APPG  F L+AVP+SK ITFGV D+K+LIS L  + 
Sbjct  756  EEVTILMHMDVIRENGFLLDENPSAPPGRHFRLRAVPYSKKITFGVEDLKDLISTLGDNH  815

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR   +DS+CP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  816  GECSVISSYRTSKTDSVCPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  875

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL+DLT++
Sbjct  876  NCPHGRPTMRHLVDLTSL  893



>ref|XP_009144561.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X1 [Brassica 
rapa]
Length=917

 Score =   302 bits (774),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KLDRDLFIVDQHAADEK+N+E L+ ST++NQQPLL+PL ++LS E
Sbjct  698  KMQVLGQFNLGFIIAKLDRDLFIVDQHAADEKFNFEHLARSTVMNQQPLLQPLTLELSAE  757

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ + M+MD IR+NGF L+E+  APPG  F L+AVP+SK ITFGV D+K+LIS L  + 
Sbjct  758  EEVTILMHMDVIRENGFLLDENPSAPPGRHFRLRAVPYSKKITFGVEDLKDLISTLGDNH  817

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR   +DS+CP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  818  GECSVISSYRTSKTDSVCPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  877

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL+DLT++
Sbjct  878  NCPHGRPTMRHLVDLTSL  895



>emb|CDX91318.1| BnaC02g27290D [Brassica napus]
Length=886

 Score =   301 bits (771),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KLDRDLFIVDQHAADEK+N+E L+ ST++NQQPLL+PL ++LS E
Sbjct  439  RMQVLGQFNLGFIIAKLDRDLFIVDQHAADEKFNFEHLARSTVMNQQPLLQPLTLELSAE  498

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ + M+MD IR+NGF L+E+  APPG  F L+AVP+SK ITFGV D+K+LIS L  + 
Sbjct  499  EEVTILMHMDVIRENGFLLDENPSAPPGRHFRLRAVPYSKKITFGVEDLKDLISTLGDNH  558

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR   +DS+CP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  559  GECSVISSYRTSKTDSVCPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  618

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL+DLT++
Sbjct  619  NCPHGRPTMRHLVDLTSL  636



>gb|AAC19275.1| T14P8.6 [Arabidopsis thaliana]
 emb|CAB80739.1| AT4g02460 [Arabidopsis thaliana]
Length=779

 Score =   299 bits (765),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = +3

Query  9    KVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEE  188
            +V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPEEE
Sbjct  562  RVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPEEE  621

Query  189  IVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQED  368
            + V M+MD IR+NGF LEE+  APPG  F L+A+P+SKNITFGV D+K+LIS L  +  +
Sbjct  622  VTVLMHMDIIRENGFLLEENPSAPPGKHFRLRAIPYSKNITFGVEDLKDLISTLGDNHGE  681

Query  369  CHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNC  548
            C +  SY+   +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPWNC
Sbjct  682  CSVASSYKTSKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPWNC  741

Query  549  PHGRPTMRHLI  581
            PHGRPTMRHL+
Sbjct  742  PHGRPTMRHLV  752



>ref|NP_567236.1| DNA mismatch repair protein PMS1 [Arabidopsis thaliana]
 sp|Q941I6.1|PMS1_ARATH RecName: Full=DNA mismatch repair protein PMS1; AltName: Full=Postmeiotic 
segregation protein 1; AltName: Full=Protein POSTMEIOTIC 
SEGREGATION 1 [Arabidopsis thaliana]
 gb|AAL01156.1| DNA mismatch repair protein [Arabidopsis thaliana]
 gb|AEE82175.1| DNA mismatch repair protein PMS1 [Arabidopsis thaliana]
Length=923

 Score =   301 bits (770),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  704  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  763

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  APPG  F L+A+P+SKNITFGV D+K+LIS L  + 
Sbjct  764  EEVTVLMHMDIIRENGFLLEENPSAPPGKHFRLRAIPYSKNITFGVEDLKDLISTLGDNH  823

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SY+   +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  824  GECSVASSYKTSKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  883

Query  543  NCPHGRPTMRHLI  581
            NCPHGRPTMRHL+
Sbjct  884  NCPHGRPTMRHLV  896



>emb|CDX97265.1| BnaA02g20560D [Brassica napus]
Length=1121

 Score =   301 bits (772),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KLDRDLFIVDQHAADEK+N+E L+ ST++NQQPLL+PL ++LS E
Sbjct  700  KMQVLGQFNLGFIIAKLDRDLFIVDQHAADEKFNFEHLARSTVMNQQPLLQPLTLELSAE  759

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ + M+MD IR+NGF L+E+  APPG  F L+AVP+SK ITFGV D+K+LIS L  + 
Sbjct  760  EEVTILMHMDVIRENGFLLDENPSAPPGRHFRLRAVPYSKKITFGVEDLKDLISTLGDNH  819

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SYR   +DS+CP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  820  GECSVISSYRTSKTDSVCPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  879

Query  543  NCPHGRPTMRHLIDLTT  593
            NCPHGRPTMRHL+DLT+
Sbjct  880  NCPHGRPTMRHLVDLTS  896



>ref|XP_006396455.1| hypothetical protein EUTSA_v10028404mg [Eutrema salsugineum]
 gb|ESQ37908.1| hypothetical protein EUTSA_v10028404mg [Eutrema salsugineum]
Length=916

 Score =   296 bits (758),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KLDRDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LS E
Sbjct  701  RMQVLGQFNLGFIIAKLDRDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLTLELSAE  760

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ + M+MD IR+NGF LEE+  APPG  F L+AVP+SK ITFGV D+K+LIS L  + 
Sbjct  761  EEVTILMHMDVIRENGFLLEENPSAPPGRHFRLRAVPYSKKITFGVEDLKDLISSLGDNH  820

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C +  SY+   +DS+CP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  821  GECSVISSYKSSKTDSVCPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  880

Query  543  NCPHGRPTMRHLI  581
            NCPHGRPTMRHL+
Sbjct  881  NCPHGRPTMRHLV  893



>ref|XP_002872835.1| hypothetical protein ARALYDRAFT_490319 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49094.1| hypothetical protein ARALYDRAFT_490319 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score =   296 bits (758),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  708  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  767

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  AP G  F L+AVP+SKNITFGV D+K+LIS L  + 
Sbjct  768  EEVTVLMHMDIIRENGFLLEENPSAPAGKHFRLRAVPYSKNITFGVEDLKDLISTLGDNH  827

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +C    SY+   +DSICP RVRAMLASRACRSSVMIGDPL +NEMQKI+EHLA L+SPW
Sbjct  828  GECSGVSSYKTSKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQKIVEHLADLESPW  887

Query  543  NCPHGRPTMRHLI  581
            NCPHGRPTMRHL+
Sbjct  888  NCPHGRPTMRHLV  900



>gb|KCW50018.1| hypothetical protein EUGRSUZ_K03466 [Eucalyptus grandis]
Length=899

 Score =   275 bits (704),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +3

Query  78   QHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEEIVVSMNMDTIRKNGFSLEEDLHA  257
            QHAADEK+N+ERL  STIL QQPLLRPL+++LSPEEE+V SM+MDTIRKNGF LEED HA
Sbjct  718  QHAADEKFNFERLCHSTILKQQPLLRPLRLELSPEEEVVASMHMDTIRKNGFVLEEDPHA  777

Query  258  PPGLRFNLKAVPFSKNITFGVADVKELISILASSQEDCHITLSYRKDTSDSICPPRVRAM  437
            PPG  F L A+PFSKNITFGV DVK+LIS LA SQ +C I  SYR DT  S+CP RVRAM
Sbjct  778  PPGCHFRLTAIPFSKNITFGVEDVKDLISTLADSQGECSILGSYRSDTISSVCPSRVRAM  837

Query  438  LASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  605
            LASRACRSSVMIGDPLG++EMQKILEHLA LKSPWNCPHGRPTMRHL+DL TV KR
Sbjct  838  LASRACRSSVMIGDPLGKSEMQKILEHLADLKSPWNCPHGRPTMRHLVDLATVGKR  893



>ref|XP_008678748.1| PREDICTED: DNA mismatch repair protein PMS1 isoform X2 [Zea mays]
Length=945

 Score =   265 bits (678),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKL +DLFIVDQHA+DEKYN+E LS+STILN QPLL PL++DLSPE
Sbjct  777  EMEVVGQFNLGFIIGKLGQDLFIVDQHASDEKYNFECLSQSTILNVQPLLEPLRLDLSPE  836

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE++VSMNM TIRKNGF L EDLHA PG  + LKAVPFSKNITFGV DVKELIS+LA SQ
Sbjct  837  EEVIVSMNMSTIRKNGFVLAEDLHASPGNHYLLKAVPFSKNITFGVQDVKELISMLADSQ  896

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQK  506
             DC I  SY+ DT+DS+CP RVRAMLASRACR S MIGDPL + EM+K
Sbjct  897  GDCSIISSYKLDTADSVCPSRVRAMLASRACRMSTMIGDPLTKAEMKK  944



>ref|XP_009791019.1| PREDICTED: DNA mismatch repair protein PMS1 [Nicotiana sylvestris]
Length=907

 Score =   263 bits (671),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  153  RPLKMDLSPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVK  332
            RPLKM+LSPEEEIV+S++ DT R+NGF LEEDLHAPPG RF LKAVPFSKNITFGVADVK
Sbjct  747  RPLKMELSPEEEIVISIHNDTFRRNGFLLEEDLHAPPGHRFKLKAVPFSKNITFGVADVK  806

Query  333  ELISILASSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKIL  512
            ELI+ILA SQE+C +  +Y+ DT++S+CPPRVRAMLASRAC+SS++IGDPLGRNEMQKIL
Sbjct  807  ELIAILADSQEECSMMGTYKDDTANSLCPPRVRAMLASRACKSSIVIGDPLGRNEMQKIL  866

Query  513  EHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  605
            ++L+ LKSPWNCPHGRPTMRHL+DL TVH+R
Sbjct  867  DNLSRLKSPWNCPHGRPTMRHLVDLRTVHRR  897



>ref|XP_002985153.1| hypothetical protein SELMODRAFT_121896 [Selaginella moellendorffii]
 gb|EFJ13647.1| hypothetical protein SELMODRAFT_121896 [Selaginella moellendorffii]
Length=722

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 152/198 (77%), Gaps = 9/198 (5%)
 Frame = +3

Query  9    KVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEE  188
            K+IGQF+LGFII +LD DLFI+DQHA+DEKYN+ERLS+ST+LN+QPLLRP+ + LS  EE
Sbjct  529  KIIGQFNLGFIIARLDSDLFIIDQHASDEKYNFERLSKSTVLNRQPLLRPMPLHLSSAEE  588

Query  189  IVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQED  368
            I++S +M+  R+NGF   E   APPG R  L AVPFSKN+TFGV+DV+EL+S+L+   ED
Sbjct  589  IIISTHMEVFRQNGFDFTEQEDAPPGQRILLSAVPFSKNVTFGVSDVQELVSLLS---ED  645

Query  369  CHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNC  548
                  Y   +S  + P RVR+MLASRACRSS+MIGD L + EM+K++ HLA L +PWNC
Sbjct  646  ------YGSSSSHLVQPSRVRSMLASRACRSSIMIGDALSKKEMEKVVRHLADLDAPWNC  699

Query  549  PHGRPTMRHLIDLTTVHK  602
            PHGRPTMRHL DL    K
Sbjct  700  PHGRPTMRHLYDLNAKKK  717



>ref|XP_002969817.1| hypothetical protein SELMODRAFT_171139 [Selaginella moellendorffii]
 gb|EFJ28941.1| hypothetical protein SELMODRAFT_171139 [Selaginella moellendorffii]
Length=705

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 151/198 (76%), Gaps = 9/198 (5%)
 Frame = +3

Query  9    KVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEE  188
            K++GQF+LGFII +LD DLFI+DQHA+DEKYN+ERLS+ST+LN+QPLLRP+ + LS  EE
Sbjct  512  KILGQFNLGFIIARLDSDLFIIDQHASDEKYNFERLSKSTVLNRQPLLRPMPLHLSSAEE  571

Query  189  IVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQED  368
            I +S +M+  R+NGF   E   APPG R  L AVPFSKN+TFGV+DV+EL+S+L+   ED
Sbjct  572  ITISTHMEVFRQNGFDFTEQEDAPPGQRILLSAVPFSKNVTFGVSDVQELVSLLS---ED  628

Query  369  CHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNC  548
                  Y   +S  + P RVR+MLASRACRSS+MIGD L + EM+K++ HLA L +PWNC
Sbjct  629  ------YGSSSSHLVQPSRVRSMLASRACRSSIMIGDALSKKEMEKVVRHLADLDAPWNC  682

Query  549  PHGRPTMRHLIDLTTVHK  602
            PHGRPTMRHL DL    K
Sbjct  683  PHGRPTMRHLYDLNAKKK  700



>ref|XP_001785478.1| predicted protein [Physcomitrella patens]
 gb|EDQ49719.1| predicted protein [Physcomitrella patens]
Length=742

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 154/208 (74%), Gaps = 10/208 (5%)
 Frame = +3

Query  12   VIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEEI  191
            V+GQF+LGF++ KLD+DLFIVDQHA+DEKYN+ERL++STILN+QPLLRPL ++LS  EE+
Sbjct  535  VVGQFNLGFVLAKLDQDLFIVDQHASDEKYNFERLTKSTILNKQPLLRPLSLELSAAEEV  594

Query  192  VVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA------  353
            +V+ +++T R+NGF   E+  AP G R +L AVPFS+NITFG+ DV+EL+ ILA      
Sbjct  595  IVTTHIETFRQNGFDFVENEDAPLGSRLSLSAVPFSQNITFGIGDVQELVGILANGTAPV  654

Query  354  ----SSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHL  521
                ++        S +     +I P RVR MLASRACRSS+MIGD L + EM+KIL HL
Sbjct  655  AKPSTTNGTGSQNGSQKGGLLSAIRPSRVRGMLASRACRSSIMIGDALCKKEMEKILCHL  714

Query  522  AHLKSPWNCPHGRPTMRHLIDLTTVHKR  605
            A L +PWNCPHGRPTMRHL DL  + ++
Sbjct  715  ADLDAPWNCPHGRPTMRHLADLEVLRQK  742



>ref|XP_010467035.1| PREDICTED: DNA mismatch repair protein PMS1, partial [Camelina 
sativa]
Length=877

 Score =   247 bits (631),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL+RDLFIVDQHAADEK+N+E L+ ST+LNQQPLL+PL ++LSPE
Sbjct  710  RMQVLGQFNLGFIIAKLERDLFIVDQHAADEKFNFEHLARSTVLNQQPLLQPLNLELSPE  769

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ V M+MD IR+NGF LEE+  APPG  F L+ VP+SKNITFGV D+K+LIS L  + 
Sbjct  770  EEVTVLMHMDIIRENGFLLEENPGAPPGKHFRLRVVPYSKNITFGVEDLKDLISTLGDNH  829

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQK  506
             +C +  SY+ + +DSICP RVRAMLASRACRSSVMIGDPL +NEMQK
Sbjct  830  GECSVVSSYKTNKTDSICPSRVRAMLASRACRSSVMIGDPLRKNEMQK  877



>ref|XP_004955044.1| PREDICTED: DNA mismatch repair protein PMS1-like [Setaria italica]
Length=840

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +3

Query  153  RPLKMDLSPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVK  332
            RPL++DLSPEEE++VSMNM+TIR NGF LEEDLHA PG  + LKAVPFSKNITFGV DVK
Sbjct  681  RPLRLDLSPEEEVIVSMNMNTIRTNGFVLEEDLHASPGNHYLLKAVPFSKNITFGVQDVK  740

Query  333  ELISILASSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKIL  512
            ELIS+LA SQ DC I  SY+ D +DS+CP RVRAMLASRACR S+MIGDPL + EM+KIL
Sbjct  741  ELISMLADSQGDCSIISSYKLDKTDSVCPSRVRAMLASRACRMSIMIGDPLTKAEMRKIL  800

Query  513  EHLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  605
            ++L  L+SPWNCPHGRPTMRHL+DL  +  +
Sbjct  801  KNLTGLRSPWNCPHGRPTMRHLVDLRAIKNK  831



>ref|XP_004347900.2| hypothetical protein CAOG_04075 [Capsaspora owczarzaki ATCC 30864]
Length=1093

 Score =   217 bits (552),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 134/200 (67%), Gaps = 17/200 (9%)
 Frame = +3

Query  3     QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
             +MKV+GQF+ GFII KLD+DLF+VDQHA DEKYNYE+L ES  L  QPL+RP+ + L+  
Sbjct  838   KMKVLGQFNRGFIIAKLDKDLFLVDQHATDEKYNYEKLQESVRLQSQPLIRPMPLQLTAA  897

Query  183   EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
              E+V+  N+D  R NGF    D  AP   R  L A+PFSK  TFG +DV EL+       
Sbjct  898   NEVVLMDNIDIFRMNGFDFVVDESAPATERVRLSAMPFSKKTTFGPSDVDELL-------  950

Query  363   EDCHITLSYR-KDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
                     YR  D+   +C P RV +MLASRACR SVMIGDPL  ++M ++L H+  ++ 
Sbjct  951   --------YRLSDSPGVMCRPSRVASMLASRACRKSVMIGDPLSTSQMYRLLRHMGQIEQ  1002

Query  537   PWNCPHGRPTMRHLIDLTTV  596
             PWNCPHGRPTMRHL+DL+ +
Sbjct  1003  PWNCPHGRPTMRHLLDLSMI  1022



>ref|XP_005650783.1| hypothetical protein COCSUDRAFT_83614, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26239.1| hypothetical protein COCSUDRAFT_83614, partial [Coccomyxa subellipsoidea 
C-169]
Length=181

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 130/196 (66%), Gaps = 19/196 (10%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M V+GQF+LGFI+ KL +DLFIVDQHAADEKYN+ERL + T+LN+QPLLRP  + L+P 
Sbjct  3    RMDVVGQFNLGFILAKLGKDLFIVDQHAADEKYNFERLQQITLLNRQPLLRPQPLHLTPA  62

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            E I++   +D    NGF  +ED       + +L AVPFSK+  FG+ DV+EL+ ++ S  
Sbjct  63   EAILLKDKIDIFHTNGFDFKEDDQG----QLHLTAVPFSKDTVFGIQDVQELLHLMIS--  116

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                          +S     VRAMLA RACRSSVMIG  L  ++MQ IL  L+ L+SPW
Sbjct  117  -------------GNSAAFQMVRAMLAMRACRSSVMIGKALTASQMQTILSRLSALESPW  163

Query  543  NCPHGRPTMRHLIDLT  590
            NCPHGRPT+RHL  L 
Sbjct  164  NCPHGRPTLRHLSTLA  179



>gb|KJE93263.1| hypothetical protein CAOG_004075 [Capsaspora owczarzaki ATCC 
30864]
Length=1154

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 134/200 (67%), Gaps = 17/200 (9%)
 Frame = +3

Query  3     QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
             +MKV+GQF+ GFII KLD+DLF+VDQHA DEKYNYE+L ES  L  QPL+RP+ + L+  
Sbjct  899   KMKVLGQFNRGFIIAKLDKDLFLVDQHATDEKYNYEKLQESVRLQSQPLIRPMPLQLTAA  958

Query  183   EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
              E+V+  N+D  R NGF    D  AP   R  L A+PFSK  TFG +DV EL+       
Sbjct  959   NEVVLMDNIDIFRMNGFDFVVDESAPATERVRLSAMPFSKKTTFGPSDVDELL-------  1011

Query  363   EDCHITLSYR-KDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKS  536
                     YR  D+   +C P RV +MLASRACR SVMIGDPL  ++M ++L H+  ++ 
Sbjct  1012  --------YRLSDSPGVMCRPSRVASMLASRACRKSVMIGDPLSTSQMYRLLRHMGQIEQ  1063

Query  537   PWNCPHGRPTMRHLIDLTTV  596
             PWNCPHGRPTMRHL+DL+ +
Sbjct  1064  PWNCPHGRPTMRHLLDLSMI  1083



>gb|ETO59393.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
Length=583

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  390  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  449

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  450  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  506

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  507  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  558

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  559  NCPHGRPTLRHLVDL  573



>gb|ETI30640.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETI30641.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
Length=674

 Score =   211 bits (537),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  481  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  540

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  541  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  597

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  598  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  649

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  650  NCPHGRPTLRHLVDL  664



>gb|ETL77708.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL77709.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=674

 Score =   211 bits (537),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  481  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  540

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  541  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  597

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  598  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  649

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  650  NCPHGRPTLRHLVDL  664



>gb|ETM30973.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=674

 Score =   211 bits (536),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  481  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  540

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  541  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  597

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  598  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  649

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  650  NCPHGRPTLRHLVDL  664



>gb|ETK71043.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=683

 Score =   211 bits (537),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  481  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  540

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  541  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  597

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  598  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  649

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  650  NCPHGRPTLRHLVDL  664



>gb|AFW62792.1| hypothetical protein ZEAMMB73_370746 [Zea mays]
Length=316

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 140/243 (58%), Gaps = 63/243 (26%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQ--------------  140
            +M+V+GQF+LGFIIGKL +DLFIVDQHA+DEKYN+E LS+STILN               
Sbjct  56   EMEVVGQFNLGFIIGKLGQDLFIVDQHASDEKYNFECLSQSTILNVQPLLEPLRLDLSPE  115

Query  141  ----------------------------QPLL------RPLKMDLSPEEEIVVSMNMD--  212
                                        QP L      R  K  ++  E+ VV    +  
Sbjct  116  EEVIVSMNMSTIRHYPMQTICHAKKNILQPFLTIEMTKRTFKHLIANTEKCVVYFTNNRS  175

Query  213  -----------TIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASS  359
                         RKNGF L EDLHA PG  + LKAVPFSKNITFGV DVKELIS+LA S
Sbjct  176  CCLTSILPFSQLFRKNGFVLAEDLHASPGNHYLLKAVPFSKNITFGVQDVKELISMLADS  235

Query  360  QEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKIL--EHLAHLK  533
            Q DC I  SY+ DT+DS+CP RVRAMLASRACR S MIGDPL + EM+K+L  + +  L 
Sbjct  236  QGDCSIISSYKLDTADSVCPSRVRAMLASRACRMSTMIGDPLTKAEMKKMLVKDSVHRLP  295

Query  534  SPW  542
             PW
Sbjct  296  LPW  298



>ref|XP_005838471.1| Pms1 mismatch repair mutL [Guillardia theta CCMP2712]
 gb|EKX51491.1| Pms1 mismatch repair mutL [Guillardia theta CCMP2712]
Length=629

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 136/200 (68%), Gaps = 13/200 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MK++GQF+LGFII +LD DLFI+DQHA DEKY +E L ++T L  QPL+ P +++L   
Sbjct  429  RMKILGQFNLGFIIARLDSDLFILDQHACDEKYRFELLEQTTSLKSQPLVVPKELELEAA  488

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            +E++V  N+D  R NGF L+ D  APP  R  L ++PFSK+  FG ADV E++ ++    
Sbjct  489  DEMLVQENLDVFRANGFELKIDEEAPPTKRVKLTSIPFSKSTVFGPADVHEMLCLM----  544

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     R+D+  +  P RVRAMLASRAC S+V IG  L R +M+ I++H++ ++ PW
Sbjct  545  ---------REDSGSAQRPSRVRAMLASRACHSAVTIGKHLTRQQMRVIVDHMSSMEQPW  595

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL DL  V +
Sbjct  596  NCPHGRPTMRHLFDLAEVEE  615



>gb|ETI30638.1| hypothetical protein F443_22254 [Phytophthora parasitica P1569]
 gb|ETI30639.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
Length=799

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>ref|XP_002998214.1| mismatch repair endonuclease pms1, putative [Phytophthora infestans 
T30-4]
 gb|EEY70560.1| mismatch repair endonuclease pms1, putative [Phytophthora infestans 
T30-4]
Length=686

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 139/195 (71%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKL  DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL+++L+  
Sbjct  493  RMQVLGQFNLGFIIGKLGNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLRLELTAG  552

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+V+  ++    KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L  + 
Sbjct  553  EEMVILDHLGVFTKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLMDAP  612

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             +           + +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  613  MN-----------TSTIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  661

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  662  NCPHGRPTLRHLVDL  676



>gb|ETP28587.1| hypothetical protein F442_22125 [Phytophthora parasitica P10297]
Length=799

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>gb|ETM30970.1| hypothetical protein L914_21370 [Phytophthora parasitica]
 gb|ETM30971.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=799

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>gb|ETL77706.1| hypothetical protein L917_21365 [Phytophthora parasitica]
 gb|ETL77707.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=799

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>gb|ETK71041.1| hypothetical protein L915_21644 [Phytophthora parasitica]
 gb|ETK71042.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL24485.1| hypothetical protein L916_21515 [Phytophthora parasitica]
 gb|ETL24486.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETP00431.1| hypothetical protein F441_22156 [Phytophthora parasitica CJ01A1]
 gb|ETP00432.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=808

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>gb|ETO59390.1| hypothetical protein F444_22247 [Phytophthora parasitica P1976]
 gb|ETO59391.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=799

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>gb|ETP28589.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
 gb|ETP28590.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=767

 Score =   211 bits (537),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  574  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  633

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  634  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  690

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  691  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  742

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  743  NCPHGRPTLRHLVDL  757



>gb|ETL24487.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETP00433.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=775

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  573  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  632

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++D   KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  633  EEMIILDHLDVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  689

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  690  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  741

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  742  NCPHGRPTLRHLVDL  756



>ref|XP_008861480.1| hypothetical protein H310_00455 [Aphanomyces invadans]
 gb|ETW10069.1| hypothetical protein H310_00455 [Aphanomyces invadans]
Length=829

 Score =   210 bits (534),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 138/196 (70%), Gaps = 11/196 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII +LDRDLFI+DQHA+DEK+ YE L ++T+++QQPL+RP+ +DL+  
Sbjct  634  RMEVVGQFNLGFIIARLDRDLFIIDQHASDEKFRYEMLQQTTVIHQQPLVRPMPLDLTAV  693

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ +  ++   +K GF  + D  A    +  L +VPFSK+  +GV DV+EL+S++  S 
Sbjct  694  EEMTILDHLPLFKKQGFHFQVDPSAAATQKLKLISVPFSKHTQWGVDDVRELVSLVLESP  753

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                         + +I  P+  AM ASRACRS+VMIG  L R+EMQKIL  LA L+ PW
Sbjct  754  H-----------AASTIRLPKTLAMFASRACRSAVMIGTALKRDEMQKILLQLAELEQPW  802

Query  543  NCPHGRPTMRHLIDLT  590
            NCPHGRPTMRHL+DL+
Sbjct  803  NCPHGRPTMRHLVDLS  818



>ref|XP_002595431.1| hypothetical protein BRAFLDRAFT_69263 [Branchiostoma floridae]
 gb|EEN51443.1| hypothetical protein BRAFLDRAFT_69263 [Branchiostoma floridae]
Length=219

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 126/199 (63%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM+++GQF+LGFII +L  DLFI+DQHA DEKYN+E L  +T+L  Q L++P  + L+  
Sbjct  33   QMEILGQFNLGFIIARLGGDLFIIDQHATDEKYNFEMLQRNTVLQGQRLIQPQSLHLTAA  92

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  NMD  RKNGF       AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  93   NESILMDNMDIFRKNGFEFTIQEDAPCTERVKLVSMPVSKNWTFGKEDIEELIFMLS---  149

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L R EMQ++L H+  ++ P
Sbjct  150  -----------DAPGVMCRPSRVRQMFASRACRKSVMIGTALNRGEMQQLLTHMGEIEQP  198

Query  540  WNCPHGRPTMRHLIDLTTV  596
            WNCPHGRPTMRHL +L  +
Sbjct  199  WNCPHGRPTMRHLFNLNML  217



>ref|XP_008915524.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 ref|XP_008915525.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETM99210.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETM99211.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=674

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 139/195 (71%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  481  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  540

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++    KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  541  EEMIILDHLAVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  597

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  598  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  649

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  650  NCPHGRPTLRHLVDL  664



>ref|XP_008915522.1| hypothetical protein PPTG_18950 [Phytophthora parasitica INRA-310]
 ref|XP_008915523.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETM99208.1| hypothetical protein PPTG_18950 [Phytophthora parasitica INRA-310]
 gb|ETM99209.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=799

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 139/195 (71%), Gaps = 11/195 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFIIGKLD DLFI+DQHA+DEK+NYE L ++T+++QQPL+RPL ++L+  
Sbjct  606  RMEVLGQFNLGFIIGKLDNDLFIIDQHASDEKFNYETLQQTTVMHQQPLVRPLMLELTAG  665

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+++  ++    KNGF+   D  AP   +  L ++PF+K+  FG  D++EL S+L    
Sbjct  666  EEMIILDHLAVFAKNGFTFLVDKDAPATKKLKLLSLPFTKHTQFGTEDIRELASLLM---  722

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             D  +  +       +I  P+V AM ASRACRSS+MIG  L + EMQKI+ +L+ L  PW
Sbjct  723  -DAPLNPA-------TIRLPKVMAMFASRACRSSIMIGTALHKEEMQKIVRNLSGLDQPW  774

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPT+RHL+DL
Sbjct  775  NCPHGRPTLRHLVDL  789



>ref|XP_004342239.1| DNA mismatch repair protein, C-terminal domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR20129.1| DNA mismatch repair protein, C-terminal domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=1076

 Score =   209 bits (533),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 135/196 (69%), Gaps = 13/196 (7%)
 Frame = +3

Query  9     KVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEEE  188
             ++IGQF+LGFII KLD+D+FI+DQHA+DEKYNYE L ++T++N QPLL PL M+L+  EE
Sbjct  852   QIIGQFNLGFIIAKLDQDVFIIDQHASDEKYNYETLQQTTVINTQPLLSPLSMELTAVEE  911

Query  189   IVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQED  368
              +V  N +  RKNGF    D  APP  +  L +VPFSKN  FGV DV ELI  L     +
Sbjct  912   SIVMDNREMFRKNGFHFVIDEQAPPRQQVKLASVPFSKNKQFGVEDVHELICQL-----E  966

Query  369   CHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPWNC  548
              H  +  R          RV AM ASRACRS++MIG  L + EM+++L ++  L++PW+C
Sbjct  967   EHPGMMCRLS--------RVSAMFASRACRSAIMIGTALSKKEMKRVLHNMTLLENPWSC  1018

Query  549   PHGRPTMRHLIDLTTV  596
             PHGRPTMRHL DL+T+
Sbjct  1019  PHGRPTMRHLFDLSTI  1034



>ref|XP_009822432.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV87569.1| hypothetical protein, variant [Aphanomyces astaci]
Length=596

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 136/198 (69%), Gaps = 9/198 (5%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M VIGQF+LGFII  LD DLFI+DQHA+DEK+ YE L ++T+L+QQPL+RP+ ++L+  
Sbjct  403  RMHVIGQFNLGFIIAHLDADLFIIDQHASDEKFRYEMLQQTTVLHQQPLVRPMALELTAV  462

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ +  ++   +K GF  + D  AP   +  L +VPFSK+  +GV DV+EL+S++  S 
Sbjct  463  EEMTILDHLPLFKKQGFHFQVDPAAPVTQKLRLISVPFSKHTQWGVDDVRELVSLVLESP  522

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                         + +I  P+  AM ASRACRS+VMIG  L R +MQKI+  LA L+ PW
Sbjct  523  HAA---------AAATIRLPKTLAMFASRACRSAVMIGTALKREDMQKIVVQLAELEQPW  573

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL+DL++ 
Sbjct  574  NCPHGRPTMRHLVDLSST  591



>dbj|GAM22137.1| hypothetical protein SAMD00019534_053120 [Acytostelium subglobosum 
LB1]
Length=987

 Score =   206 bits (525),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 140/205 (68%), Gaps = 15/205 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M VIGQF+LGFII +L  DLFI+DQHAADEKYNYE L ++ ++N QP ++P  + L+ E
Sbjct  764  KMHVIGQFNLGFIIARLGGDLFIIDQHAADEKYNYETLQKNEVINSQPTIKPTSLGLTAE  823

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            +E++V  ++   +KNGF  + D  APP  +  L A PFSKN  F   DV EL+S++    
Sbjct  824  DEMIVLEHLQIFKKNGFEFQIDNDAPPKYKVKLAAFPFSKNTVFNANDVYELVSLI----  879

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            +D  I +       ++I  PR+ +M ASRACR S+M+G  L  +EM+K+L++L+ L++PW
Sbjct  880  KDTVIGV-------ETIRLPRISSMFASRACRKSIMVGTALSHSEMKKVLDNLSLLENPW  932

Query  543  NCPHGRPTMRHLIDL----TTVHKR  605
             CPHGRPTMRHL+DL    T ++KR
Sbjct  933  CCPHGRPTMRHLVDLSALSTLINKR  957



>gb|EKC38171.1| Mismatch repair endonuclease PMS2 [Crassostrea gigas]
Length=794

 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 135/201 (67%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL  DLFIVDQHA DEKYN+E L + T++  Q L++P  ++L+  
Sbjct  608  EMEILGQFNLGFIIAKLKDDLFIVDQHATDEKYNFEMLQQHTVIQCQKLIQPQSLELTAS  667

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             EI +  N++  RKNGF    D +APP  R  L ++P S+N TFG  D++ELI +L+   
Sbjct  668  NEITLIDNLEVFRKNGFDFVIDENAPPMQRVKLTSIPVSRNWTFGKEDIEELIFMLS---  724

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+ + +C P RVR M ASRACR S+MIG  L ++EM+K++ H+  ++ P
Sbjct  725  -----------DSPNVMCRPSRVRQMFASRACRKSIMIGTALKKSEMKKLVCHMGEIEQP  773

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHLI+L  V K
Sbjct  774  WNCPHGRPTMRHLINLNMVPK  794



>ref|XP_011417733.1| PREDICTED: mismatch repair endonuclease PMS2-like [Crassostrea 
gigas]
Length=882

 Score =   205 bits (521),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 135/201 (67%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL  DLFIVDQHA DEKYN+E L + T++  Q L++P  ++L+  
Sbjct  696  EMEILGQFNLGFIIAKLKDDLFIVDQHATDEKYNFEMLQQHTVIQCQKLIQPQSLELTAS  755

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             EI +  N++  RKNGF    D +APP  R  L ++P S+N TFG  D++ELI +L+   
Sbjct  756  NEITLIDNLEVFRKNGFDFVIDENAPPMQRVKLTSIPVSRNWTFGKEDIEELIFMLS---  812

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+ + +C P RVR M ASRACR S+MIG  L ++EM+K++ H+  ++ P
Sbjct  813  -----------DSPNVMCRPSRVRQMFASRACRKSIMIGTALKKSEMKKLVCHMGEIEQP  861

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHLI+L  V K
Sbjct  862  WNCPHGRPTMRHLINLNMVPK  882



>ref|XP_009822431.1| hypothetical protein H257_01095 [Aphanomyces astaci]
 gb|ETV87568.1| hypothetical protein H257_01095 [Aphanomyces astaci]
Length=789

 Score =   204 bits (520),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 136/197 (69%), Gaps = 9/197 (5%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M VIGQF+LGFII  LD DLFI+DQHA+DEK+ YE L ++T+L+QQPL+RP+ ++L+  
Sbjct  596  RMHVIGQFNLGFIIAHLDADLFIIDQHASDEKFRYEMLQQTTVLHQQPLVRPMALELTAV  655

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ +  ++   +K GF  + D  AP   +  L +VPFSK+  +GV DV+EL+S++  S 
Sbjct  656  EEMTILDHLPLFKKQGFHFQVDPAAPVTQKLRLISVPFSKHTQWGVDDVRELVSLVLESP  715

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                         + +I  P+  AM ASRACRS+VMIG  L R +MQKI+  LA L+ PW
Sbjct  716  HAA---------AAATIRLPKTLAMFASRACRSAVMIGTALKREDMQKIVVQLAELEQPW  766

Query  543  NCPHGRPTMRHLIDLTT  593
            NCPHGRPTMRHL+DL++
Sbjct  767  NCPHGRPTMRHLVDLSS  783



>ref|XP_001660584.1| AAEL010033-PA [Aedes aegypti]
 gb|EAT38049.1| AAEL010033-PA [Aedes aegypti]
Length=874

 Score =   204 bits (520),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 134/201 (67%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM++IGQF+LGFII +L++DLFI+DQHA DEKYN+E L  +T+L  Q L+ P +++L+  
Sbjct  678  QMEIIGQFNLGFIIARLEQDLFIIDQHATDEKYNFEDLQRTTVLQNQKLVVPQQLELTAV  737

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E+++  N++    NGF  E D  A P  +  L A PFSKN  FG  D+ ELI +L    
Sbjct  738  NEMILMDNLEIFEMNGFKFEIDGSAEPTRKVKLVAKPFSKNWEFGKEDIDELIFML----  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                      +D  +S+C P RVRAM ASRACR SVMIG  L + EM++++ H+  ++ P
Sbjct  794  ----------QDAPNSVCRPSRVRAMFASRACRKSVMIGKALSKAEMRRLVSHMGEIEQP  843

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL++L+ + +
Sbjct  844  WNCPHGRPTMRHLVNLSMLQQ  864



>ref|XP_008618743.1| hypothetical protein SDRG_14397 [Saprolegnia diclina VS20]
 gb|EQC27813.1| hypothetical protein SDRG_14397 [Saprolegnia diclina VS20]
Length=672

 Score =   203 bits (516),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 11/200 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M ++GQF+LGFII +  RDL+I+DQHA+DEK+ +E L +ST+L+QQPL+RPL+++++  
Sbjct  484  RMDIVGQFNLGFIIARCGRDLYIIDQHASDEKFRFETLQKSTVLHQQPLVRPLRLEVTAV  543

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ +  +M    K GF    +  AP   + +L A+PFSK+ TFG+ADV+EL S+L    
Sbjct  544  EEMTILEHMPIFEKQGFHFSVNHAAPVTQKLHLTALPFSKHTTFGLADVRELASLL---M  600

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            E  H   + R         P+V +M ASRACRS+VMIG  L + EM KI+  LA L  PW
Sbjct  601  EAPHQAQTLRL--------PKVTSMFASRACRSAVMIGTALHKEEMLKIVTQLAVLDQPW  652

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL+DL ++ K
Sbjct  653  NCPHGRPTMRHLVDLNSLEK  672



>ref|XP_001663861.1| AAEL013690-PA [Aedes aegypti]
 gb|EAT34048.1| AAEL013690-PA [Aedes aegypti]
Length=926

 Score =   204 bits (519),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 134/201 (67%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM++IGQF+LGFII +L++DLFI+DQHA DEKYN+E L  +T+L  Q L+ P +++L+  
Sbjct  730  QMEIIGQFNLGFIIARLEQDLFIIDQHATDEKYNFEDLQRTTVLQNQKLVVPQQLELTAV  789

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E+++  N++    NGF  E D  A P  +  L A PFSKN  FG  D+ ELI +L    
Sbjct  790  NEMILMDNLEIFEMNGFKFEIDGSAEPTRKVKLVAKPFSKNWEFGKEDIDELIFML----  845

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                      +D  +S+C P RVRAM ASRACR SVMIG  L + EM++++ H+  ++ P
Sbjct  846  ----------QDAPNSVCRPSRVRAMFASRACRKSVMIGKALSKAEMRRLVSHMGEIEQP  895

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL++L+ + +
Sbjct  896  WNCPHGRPTMRHLVNLSMLQQ  916



>ref|XP_010201153.1| PREDICTED: mismatch repair endonuclease PMS2-like [Colius striatus]
Length=191

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 128/199 (64%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  4    KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQHLNLTAV  63

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN +FG  D+ ELI +L+   
Sbjct  64   NESVLIENLEIFRKNGFDFVINENAPVTQRVKLVSLPTSKNWSFGPQDIDELIFMLS---  120

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       DT   +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  121  -----------DTPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  169

Query  540  WNCPHGRPTMRHLIDLTTV  596
            WNCPHGRPTMRH++ L  +
Sbjct  170  WNCPHGRPTMRHIVSLDLI  188



>ref|XP_009450861.1| PREDICTED: mismatch repair endonuclease PMS2-like isoform X2 
[Pan troglodytes]
Length=191

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  4    EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  63

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  64   NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  120

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  121  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  169

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  170  WNCPHGRPTMRHIANLGVISQ  190



>gb|AAI39775.1| Pms2 protein [Mus musculus]
Length=191

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  4    EMEILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLITPQTLNLTAV  63

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  64   NEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  120

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  121  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMKKLITHMGEMDHP  169

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  170  WNCPHGRPTMRHVANLDVISQ  190



>gb|ELT88556.1| hypothetical protein CAPTEDRAFT_218769 [Capitella teleta]
Length=469

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 134/198 (68%), Gaps = 15/198 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M+++GQF+LGF+I +L++DLFI+DQHA+DEKYN+E L + T+L+ Q L+ P  + L+   
Sbjct  282  MEILGQFNLGFVIARLNQDLFIIDQHASDEKYNFEMLQKHTVLSSQRLVCPQILPLTAAN  341

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E+++  N+D  ++NGF+ E D   PP  R  L + P SKN  FG  D++EL+ +L+    
Sbjct  342  EVILMDNLDIFKRNGFAFEVDEEGPPTQRVKLVSKPISKNWEFGRDDIEELVFMLS----  397

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                      D+S  +C P RVR MLASRACR S+MIG  L + EM K+L H++ ++ PW
Sbjct  398  ----------DSSGIMCRPTRVRQMLASRACRKSIMIGTALNQPEMNKLLRHMSEIEHPW  447

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHLI+L  +
Sbjct  448  NCPHGRPTMRHLINLDRI  465



>gb|KDO31448.1| hypothetical protein SPRG_04063 [Saprolegnia parasitica CBS 223.65]
Length=785

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 135/198 (68%), Gaps = 11/198 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M V+GQF+LGFII +  RDL+I+DQHA+DEK+ +E L +ST+L+QQPL+RPL+++++  
Sbjct  597  RMDVVGQFNLGFIIARCGRDLYIIDQHASDEKFRFETLQKSTVLHQQPLVRPLRLEVTAV  656

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ +  +M    K GF       AP   + +L A+PFSK+ TFG+ADV+EL S+L    
Sbjct  657  EEMTILEHMAIFEKQGFHFSVHHEAPVTQKLHLTALPFSKHTTFGLADVRELASLL---M  713

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
            E  H   + R         P+V +M ASRACRS+VMIG  L + EM KI+  LA L  PW
Sbjct  714  EAPHQAQTLRL--------PKVTSMFASRACRSAVMIGTALHKEEMLKIVTQLAVLDQPW  765

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHL+DL ++
Sbjct  766  NCPHGRPTMRHLVDLNSL  783



>ref|XP_002508138.1| DNA mismatch repair protein-MLH2/PMS1/Pms2 family, partial [Micromonas 
sp. RCC299]
 gb|ACO69396.1| DNA mismatch repair protein-MLH2/PMS1/Pms2 family, partial [Micromonas 
sp. RCC299]
Length=771

 Score =   201 bits (511),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 134/209 (64%), Gaps = 15/209 (7%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M+V+GQF+LGFI+  L  DLFIVDQHA+DE YN+ERL  +T LN+QPLL P K++L+  E
Sbjct  560  MRVVGQFNLGFILCTLGDDLFIVDQHASDEIYNFERLQRTTTLNRQPLLVPKKLELTAAE  619

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLR-FNLKAVPFSKNITFGVADVKELISILASSQ  362
               V  NM T   NGF   E    PP +R   L +VPFSK ITFG  DV ELI +L   +
Sbjct  620  TQTVHRNMPTFLANGFGFCEVDQPPPTVRSLALNSVPFSKGITFGADDVHELIGMLDQGE  679

Query  363  ----EDCHITLSYRKDT----------SDSICPPRVRAMLASRACRSSVMIGDPLGRNEM  500
                    +T+   + +          S+ + P RVRAMLA RACRSS+MIG  L    M
Sbjct  680  YALPARSQLTVGLSRQSTGTPGSGLSVSEIVRPSRVRAMLAMRACRSSIMIGKALDAKTM  739

Query  501  QKILEHLAHLKSPWNCPHGRPTMRHLIDL  587
            +++L++L+ L++PWNCPHGRPTMRHL DL
Sbjct  740  RRVLDNLSDLQAPWNCPHGRPTMRHLADL  768



>dbj|BAC81643.1| PMS2-C terminal -like [Homo sapiens]
 gb|AIC62923.1| PMS2CL, partial [synthetic construct]
Length=191

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  4    EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  63

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SK+ TFG  DV ELI +L+   
Sbjct  64   NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKSWTFGPQDVDELIFMLS---  120

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  121  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  169

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  170  WNCPHGRPTMRHIANLGVISQ  190



>gb|EHJ64985.1| putative DNA mismatch repair protein pms2 [Danaus plexippus]
Length=820

 Score =   201 bits (511),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 132/199 (66%), Gaps = 13/199 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MK+IGQF+LGFII +LD DLFI+DQHA DE YN+E L ++T L  Q L+ P +++L+  
Sbjct  632  KMKIIGQFNLGFIITRLDDDLFIIDQHATDEIYNFETLQKTTELTSQKLVIPQQLELTGV  691

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N+D  +KNGF+   D  A P  R  L  +P SKN  FG  D++EL+ IL    
Sbjct  692  NEQILMDNLDIFKKNGFTFAIDETAAPTKRVKLLTLPMSKNWIFGKEDIEELLFIL----  747

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     +++ S+   P RVRAM ASRACR SVMIG  L + +M+K+++H+A +  PW
Sbjct  748  ---------KENHSEYCRPSRVRAMFASRACRKSVMIGTALSKGDMRKLVDHMAEIDKPW  798

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPT+RHLI+L  VH
Sbjct  799  NCPHGRPTIRHLINLAMVH  817



>ref|XP_011561970.1| PREDICTED: mismatch repair endonuclease PMS2 [Plutella xylostella]
Length=888

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 131/201 (65%), Gaps = 12/201 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KLD DLFI+DQHA DE YN+E L ++T L  Q L+ P +++L+  
Sbjct  698  EMQIIGQFNLGFIITKLDDDLFIIDQHATDEIYNFETLQKTTELTSQKLVIPQQLELTGV  757

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N+   +KNGF+ + D +A P  R  L  +P SKN  FG  D++EL+ +L  S 
Sbjct  758  NEQILMDNLPVFKKNGFTFDIDENALPTKRVKLLTLPMSKNWIFGKEDIEELLFMLRESP  817

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
               H              P RVRAM ASRACR SVMIG  L R +M++++EH+A +  PW
Sbjct  818  SSQHAR------------PSRVRAMFASRACRKSVMIGTALARADMRRLVEHMAEIDKPW  865

Query  543  NCPHGRPTMRHLIDLTTVHKR  605
            NCPHGRPT+RHL++L  VH +
Sbjct  866  NCPHGRPTIRHLVNLAMVHTK  886



>gb|EFA00116.1| hypothetical protein TcasGA2_TC002932 [Tribolium castaneum]
Length=807

 Score =   198 bits (503),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 134/200 (67%), Gaps = 15/200 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M VIGQF+LGFII KL  DLFI+DQHA DEKYN+E+L  ST++  Q L+ P  + L+   
Sbjct  620  MDVIGQFNLGFIITKLKNDLFIIDQHATDEKYNFEQLQASTVMENQVLVNPKPLQLTAGN  679

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E ++  N D   KNGF+ + D  AP   + +L ++P SK++ FG  D++E++ +L     
Sbjct  680  ESLLIENEDIFNKNGFTFKIDESAPCTQKVSLTSIPLSKSMVFGKQDIEEMLFML-----  734

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     +D++ ++C P R+RAM A+RACR SVMIG PL +++M++++ H+  ++ PW
Sbjct  735  ---------QDSNHTMCRPSRIRAMFATRACRKSVMIGKPLSKSDMRRLVNHMGEIEQPW  785

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHLI+L  + +
Sbjct  786  NCPHGRPTMRHLINLDLIQE  805



>ref|XP_003961536.1| PREDICTED: mismatch repair endonuclease PMS2 [Takifugu rubripes]
Length=837

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 129/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M++IGQF+LGFII KL+ D+FI+DQHA DEKYN+E L + T+L  Q L+ P K+ L+   
Sbjct  653  MEIIGQFNLGFIIAKLESDIFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQKLHLTAVS  712

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E  +  N+D  RKNGF  + D  A    R  L ++P SKN TFG AD++ELI +L+    
Sbjct  713  ENTLIDNIDIFRKNGFEFQVDEDAQAMERVKLLSLPTSKNWTFGPADIEELIFMLS----  768

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                      D+   +C P RVR M ASRACR SVMIG  L  NEM+K+L H+  ++ PW
Sbjct  769  ----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALSVNEMKKLLVHMGEIEHPW  818

Query  543  NCPHGRPTMRHLIDLTTV  596
            NCPHGRPTMRHLI+L  +
Sbjct  819  NCPHGRPTMRHLINLDII  836



>ref|XP_008190970.1| PREDICTED: mismatch repair endonuclease PMS2 [Tribolium castaneum]
Length=853

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 134/200 (67%), Gaps = 15/200 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M VIGQF+LGFII KL  DLFI+DQHA DEKYN+E+L  ST++  Q L+ P  + L+   
Sbjct  666  MDVIGQFNLGFIITKLKNDLFIIDQHATDEKYNFEQLQASTVMENQVLVNPKPLQLTAGN  725

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E ++  N D   KNGF+ + D  AP   + +L ++P SK++ FG  D++E++ +L     
Sbjct  726  ESLLIENEDIFNKNGFTFKIDESAPCTQKVSLTSIPLSKSMVFGKQDIEEMLFML-----  780

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     +D++ ++C P R+RAM A+RACR SVMIG PL +++M++++ H+  ++ PW
Sbjct  781  ---------QDSNHTMCRPSRIRAMFATRACRKSVMIGKPLSKSDMRRLVNHMGEIEQPW  831

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHLI+L  + +
Sbjct  832  NCPHGRPTMRHLINLDLIQE  851



>emb|CAG04443.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=866

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 130/200 (65%), Gaps = 15/200 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M++IGQF+LGFII KL+ D+FI+DQHA DEKYN+E L + T+L  Q L+ P K+ L+   
Sbjct  680  MEIIGQFNLGFIIAKLNSDVFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQKLHLTAVS  739

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E ++  N+D  RKNGF  + D  A    R  L ++P SKN TFG AD++ELI +L+    
Sbjct  740  ENILMENIDIFRKNGFEFQVDEDAQAMERVKLTSLPTSKNWTFGPADIEELIFMLS----  795

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                      D+   +C P RVR M ASRACR SVMIG  L   EM+K+L H+  ++ PW
Sbjct  796  ----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALSLTEMKKLLVHMGEMEHPW  845

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHLI+L  V +
Sbjct  846  NCPHGRPTMRHLINLDIVSQ  865



>ref|XP_001626114.1| predicted protein [Nematostella vectensis]
 gb|EDO34014.1| predicted protein [Nematostella vectensis]
Length=775

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 129/196 (66%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KLD DLFI+DQHA+DEKYN+E    +T+L  Q L+ P K++L+  
Sbjct  586  RMEIVGQFNLGFILAKLDNDLFIIDQHASDEKYNFEMQQRNTVLRNQRLIIPRKLELTAV  645

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF  + D  AP   +  L +VP SKN TFGV DV+ELI +L+   
Sbjct  646  NESILLDNLEIFRKNGFEFQIDDDAPATQKVKLVSVPTSKNWTFGVEDVEELIFMLS---  702

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR S+M+G  L   +MQ I+ H+  +K P
Sbjct  703  -----------DAPGILCRPTRVRKMFASRACRMSIMVGTALSHAQMQGIVRHMGEMKHP  751

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH+++L
Sbjct  752  WNCPHGRPTMRHVVNL  767



>ref|XP_003243755.1| PREDICTED: mismatch repair endonuclease PMS2 [Acyrthosiphon pisum]
Length=591

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 130/200 (65%), Gaps = 15/200 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M +IGQF+LGFII KLD DLFIVDQHA DEKYN+E L  +T +  Q L+ P +++L+  
Sbjct  402  RMSIIGQFNLGFIITKLDADLFIVDQHATDEKYNFETLQNTTKITSQKLVVPQQLELTAV  461

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             EIV+  N++  + NGF  +    A P  +  L  +P S N +FG  DV EL+ +L    
Sbjct  462  NEIVLMENINVFQMNGFDFQFQQDAEPTKKVKLTMIPMSNNWSFGKEDVDELLFML----  517

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                      +D  +++C P RVR+M ASRACR SVMIG  L   +M+K+++H+  ++ P
Sbjct  518  ----------QDAPNTLCRPSRVRSMFASRACRKSVMIGKVLNFGDMRKLIDHMGDIEQP  567

Query  540  WNCPHGRPTMRHLIDLTTVH  599
            WNCPHGRPTMRHL++LT ++
Sbjct  568  WNCPHGRPTMRHLVNLTLLN  587



>ref|XP_006265348.1| PREDICTED: mismatch repair endonuclease PMS2 [Alligator mississippiensis]
Length=875

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 127/196 (65%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL  DLFI+DQHA DEKYN+E L + TIL  Q L+ P  ++L+  
Sbjct  688  KMEIIGQFNLGFIIAKLKSDLFIIDQHATDEKYNFEMLQQHTILQGQKLIAPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D +AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  748  NETILIENLEIFRKNGFDFVIDENAPVTQRVKLISLPTSKNWTFGPQDIEELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVNEMKKLITHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHIVSL  869



>ref|XP_003388127.1| PREDICTED: mismatch repair endonuclease PMS2-like [Amphimedon 
queenslandica]
Length=759

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 125/196 (64%), Gaps = 13/196 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KLD DLFI+DQHA DEKYN+ERL   T+L  Q L+ PL ++++  
Sbjct  572  EMEILGQFNLGFIIAKLDNDLFIIDQHATDEKYNFERLKRDTVLEHQSLIHPLPVEVTAV  631

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++   KNGF    D  APP  R  L   P SKN + G ++++ELI +L    
Sbjct  632  GESVIKDNLEVFEKNGFRFSFDEEAPPTKRVKLIEQPVSKNWSMGTSEIEELIFLLTDY-  690

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                          + + P  V  MLASRACR S+MIG  LG+ EM KI+ H+A +  PW
Sbjct  691  ------------PGEMVRPHCVTKMLASRACRGSIMIGTALGKKEMSKIVAHMAEMDQPW  738

Query  543  NCPHGRPTMRHLIDLT  590
            NCPHGRPT+RHLID++
Sbjct  739  NCPHGRPTIRHLIDIS  754



>ref|XP_004691992.1| PREDICTED: mismatch repair endonuclease PMS2 [Condylura cristata]
Length=461

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 127/201 (63%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  274  EMEIIGQFNLGFIITKLNADLFIVDQHATDEKYNFEMLQQHTVLQGQKLIVPQTLNLTAV  333

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  334  NEAVLIENLEIFRKNGFDFVIDESAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  390

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L   EM+K++ H+  +  P
Sbjct  391  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNMGEMKKLVSHMGEMDHP  439

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  V +
Sbjct  440  WNCPHGRPTMRHIANLDAVSQ  460



>dbj|BAD89426.1| postmeiotic segregation increased 2 nirs variant 2 [Homo sapiens]
Length=461

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  274  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  333

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  334  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  390

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  391  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  439

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  440  WNCPHGRPTMRHIANLGVISQ  460



>ref|XP_002617364.1| hypothetical protein CLUG_02808 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ38682.1| hypothetical protein CLUG_02808 [Clavispora lusitaniae ATCC 42720]
Length=878

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 134/199 (67%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M V+GQF+LGF++   D  LFIVDQHA+DE +NYERL +S +L  QPL+ P  ++LSP 
Sbjct  675  RMSVVGQFNLGFVVVVHDNRLFIVDQHASDEIFNYERLMQSLVLRAQPLVIPRLLELSPV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            +E+V+  N++ +R+NGF ++ED  A PG R  L AVP SKN+ F   D+ EL+  L   +
Sbjct  735  DEMVLLENVENLRRNGFVVQEDADAVPGRRVKLMAVPVSKNVVFDDGDLHELMHRL--HE  792

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                 ++S ++     +   +V  M+ASRACR S+MIG  L +N M K++ HL+ L+ PW
Sbjct  793  NGFASSMSTQERPRLVVRCSKVDKMIASRACRRSIMIGQSLSKNTMAKVVRHLSRLEKPW  852

Query  543  NCPHGRPTMRHLIDLTTVH  599
            NCPHGRPTMRHL DL  VH
Sbjct  853  NCPHGRPTMRHLADLGGVH  871



>ref|XP_007339460.1| hypothetical protein AURDEDRAFT_55752, partial [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD52732.1| hypothetical protein AURDEDRAFT_55752, partial [Auricularia delicata 
TFB-10046 SS5]
Length=225

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 127/200 (64%), Gaps = 19/200 (10%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKL---DRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDL  173
            +M+++GQF+LGFII +L   D DLFI+DQHA+DEKYN+E L ++T +  Q LLRP  ++L
Sbjct  18   RMEIVGQFNLGFIIARLRDRDDDLFIIDQHASDEKYNFETLQQTTKMETQRLLRPRPLEL  77

Query  174  SPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA  353
            +  +E++    +D +RKNGF L  D  AP   R  L AVP SKN  F V D++ELI  L 
Sbjct  78   TAADELLAMERIDILRKNGFDLTVDEDAPAHQRVRLTAVPVSKNTAFDVQDLEELIHTL-  136

Query  354  SSQEDCHITLSYRKDTS--DSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAH  527
                         +DT+   +    +VRAM A RACR SVMIGD L   +M++I+ H+  
Sbjct  137  -------------RDTAPGQTARCSKVRAMFAMRACRKSVMIGDALNMRQMKEIVLHMGT  183

Query  528  LKSPWNCPHGRPTMRHLIDL  587
            +  PWNCPHGRPTMRHL  L
Sbjct  184  MDQPWNCPHGRPTMRHLTSL  203



>ref|XP_004997038.1| Pms2 protein [Salpingoeca rosetta]
 gb|EGD81834.1| Pms2 protein [Salpingoeca rosetta]
Length=934

 Score =   196 bits (499),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 15/197 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M+VIGQF+LGFII +L   LFIVDQHA+DEKYN+ERL + T + +Q L+RP  +DL   +
Sbjct  735  MQVIGQFNLGFIIARLHHHLFIVDQHASDEKYNFERLQQVTKIKRQVLIRPRPLDLPAVD  794

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E ++  N+   ++NGF    D HA PG R  L  +P SK   FG+ D+ EL+ +L     
Sbjct  795  ENLLLDNLHIFQQNGFEFAVDEHAAPGKRVRLSQIPHSKGTEFGIDDIHELLFML-----  849

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     +D     C P R+R M ASRACRSS+MIG  L R EM+ IL+H+  ++ PW
Sbjct  850  ---------RDQPGVFCRPSRIRGMFASRACRSSIMIGKALTRPEMRAILQHMGTMEQPW  900

Query  543  NCPHGRPTMRHLIDLTT  593
            NCPHGRPTMRHL D+++
Sbjct  901  NCPHGRPTMRHLCDISS  917



>ref|XP_009450859.1| PREDICTED: mismatch repair endonuclease PMS2-like isoform X1 
[Pan troglodytes]
 ref|XP_009450860.1| PREDICTED: mismatch repair endonuclease PMS2-like isoform X1 
[Pan troglodytes]
Length=202

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 129/212 (61%), Gaps = 26/212 (12%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  4    EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  63

Query  183  EEIVVSMNMDTIRKNGFSLEED-----------LHAPPGLRFNLKAVPFSKNITFGVADV  329
             E V+  N++  RKNGF    D           L AP   R  L ++P SKN TFG  DV
Sbjct  64   NEAVLIENLEIFRKNGFDFVIDENVMDFSQNCILLAPVTERAKLISLPTSKNWTFGPQDV  123

Query  330  KELISILASSQEDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQK  506
             ELI +L+              D+   +C P RV+ M ASRACR SVMIG  L  +EM+K
Sbjct  124  DELIFMLS--------------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKK  169

Query  507  ILEHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  602
            ++ H+  +  PWNCPHGRPTMRH+ +L  + +
Sbjct  170  LITHMGEMDHPWNCPHGRPTMRHIANLGVISQ  201



>ref|XP_008162801.1| PREDICTED: mismatch repair endonuclease PMS2 [Chrysemys picta 
bellii]
 ref|XP_008162802.1| PREDICTED: mismatch repair endonuclease PMS2 [Chrysemys picta 
bellii]
 ref|XP_008162803.1| PREDICTED: mismatch repair endonuclease PMS2 [Chrysemys picta 
bellii]
Length=619

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFI+ KL+ DLFI+DQHA DEKYN+E L +  +L  Q L+ P  ++L+  
Sbjct  432  KMEIIGQFNLGFIVAKLNSDLFIIDQHATDEKYNFEMLQQHNVLQGQKLIAPQNLNLTAV  491

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  492  NETILIENLEIFRKNGFDFVIDEDAPVTERVKLISLPTSKNWTFGPQDIEELIFMLS---  548

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  ++ P
Sbjct  549  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALTVNEMKKLITHMGEIEHP  597

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+++L  + +
Sbjct  598  WNCPHGRPTMRHIVNLDLISQ  618



>ref|XP_005697949.1| PREDICTED: mismatch repair endonuclease PMS2 [Capra hircus]
Length=887

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  700  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  759

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  760  NEAILIENLEIFRKNGFDFAIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  816

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  817  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  865

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  866  WNCPHGRPTMRHIANLDVISQ  886



>ref|XP_006031530.1| PREDICTED: LOW QUALITY PROTEIN: mismatch repair endonuclease 
PMS2 [Alligator sinensis]
Length=876

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL  DLFI+DQHA DEKYN+E L + TIL  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIIAKLKSDLFIIDQHATDEKYNFEMLQQHTILQGQKLIAPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D +AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  749  NETILIENLEIFRKNGFDFVIDENAPVTQRVKLISLPTSKNWTFGPQDIEELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVNEMKKLITHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH+  L
Sbjct  855  WNCPHGRPTMRHIASL  870



>ref|XP_001623519.1| predicted protein [Nematostella vectensis]
 gb|EDO31419.1| predicted protein [Nematostella vectensis]
Length=786

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 128/196 (65%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KLD DLFI+DQHA+DEKYN+E    +T+L  Q L+ P K++L+  
Sbjct  597  RMEIVGQFNLGFILAKLDNDLFIIDQHASDEKYNFEMQQRNTVLRNQRLIIPRKLELTAV  656

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF  + D  AP   +  L +VP SKN TFGV DV+ELI +L+   
Sbjct  657  NESILLDNLEIFRKNGFEFQIDDDAPATQKVKLVSVPTSKNWTFGVEDVEELIFMLS---  713

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR S+M+G  L    MQ I+ H+  ++ P
Sbjct  714  -----------DAPGILCRPTRVRKMFASRACRMSIMVGTALSHAHMQGIVGHMGQMEHP  762

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH+++L
Sbjct  763  WNCPHGRPTMRHVVNL  778



>ref|XP_007498329.1| PREDICTED: mismatch repair endonuclease PMS2 [Monodelphis domestica]
Length=863

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L   T+L  Q L+ P  ++L+  
Sbjct  676  EMEIIGQFNLGFIITKLNEDLFIIDQHATDEKYNFEMLQLHTVLQGQRLIMPQTLNLTAV  735

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ E+I +L+   
Sbjct  736  NEAILIENLEIFRKNGFDFIIDEHAPVTERVKLISLPTSKNWTFGPQDIDEMIFMLS---  792

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L +NEM+K++ H+  ++ P
Sbjct  793  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNKNEMKKLITHMGEIEHP  841

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+  L  + +
Sbjct  842  WNCPHGRPTMRHIASLNIISQ  862



>ref|XP_005902992.1| PREDICTED: mismatch repair endonuclease PMS2 [Bos mutus]
 gb|ELR51153.1| Mismatch repair endonuclease PMS2 [Bos mutus]
Length=864

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  677  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  737  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  794  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  842

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  843  WNCPHGRPTMRHIANLDVISQ  863



>ref|NP_001192867.1| mismatch repair endonuclease PMS2 [Bos taurus]
 tpg|DAA15209.1| TPA: PMS2 postmeiotic segregation increased 2 [Bos taurus]
Length=864

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  677  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  737  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  794  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  842

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  843  WNCPHGRPTMRHIANLDVISQ  863



>ref|XP_007425217.1| PREDICTED: mismatch repair endonuclease PMS2 [Python bivittatus]
Length=870

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 131/196 (67%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M ++GQF+LGFII KL  DLFIVDQHA+DEKYN+E L E T+L  Q L+RP  ++L+  
Sbjct  683  KMDIVGQFNLGFIITKLKSDLFIVDQHASDEKYNFEMLQEHTVLQGQKLIRPQNLNLTAV  742

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             + V+  N++  +KNGF    D +AP   R  L ++P S+N TFG  D++ELI +L+   
Sbjct  743  SKSVLMDNLEIFQKNGFDFVVDENAPVTQRVKLISLPTSRNWTFGPQDIEELIFMLS---  799

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  ++ P
Sbjct  800  -----------DSPGIMCRPSRVRQMFASRACRKSVMIGTPLTASEMKKLIVHMGEIEHP  848

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPT+RHL++L
Sbjct  849  WNCPHGRPTIRHLVNL  864



>ref|XP_006097753.1| PREDICTED: mismatch repair endonuclease PMS2 [Myotis lucifugus]
Length=855

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KLD DLFIVDQHA DEKYN+E L + T L  Q L+RP  ++L+  
Sbjct  668  EMEVIGQFNLGFIITKLDADLFIVDQHATDEKYNFEMLQQHTALQGQRLIRPQTLNLTAV  727

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  728  NEAVLIENLEIFRKNGFDFVIDESAPITERAKLISLPTSKNWTFGPQDIDELIFMLS---  784

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  785  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLIAHMGEMDHP  833

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  834  WNCPHGRPTMRHIANLDVISQ  854



>ref|XP_010844057.1| PREDICTED: mismatch repair endonuclease PMS2 [Bison bison bison]
 ref|XP_010844058.1| PREDICTED: mismatch repair endonuclease PMS2 [Bison bison bison]
 ref|XP_010844059.1| PREDICTED: mismatch repair endonuclease PMS2 [Bison bison bison]
Length=888

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  701  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  760

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  761  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  817

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  818  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  866

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  867  WNCPHGRPTMRHIANLDVISQ  887



>gb|KGL83152.1| Mismatch repair endonuclease PMS2, partial [Tinamus guttatus]
Length=862

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  677  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  737  NETVLIENLEIFRKNGFDFVIDENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  794  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNIQEMKKLVTHMGEIEHP  842

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  843  WNCPHGRPTMRHIVSL  858



>ref|XP_006765487.1| PREDICTED: mismatch repair endonuclease PMS2 [Myotis davidii]
Length=855

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KLD DLFIVDQHA DEKYN+E L + T L  Q L+RP  ++L+  
Sbjct  668  EMEVIGQFNLGFIITKLDADLFIVDQHATDEKYNFEMLQQHTALQGQRLIRPQTLNLTAV  727

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  728  NEAVLIENLEIFRKNGFDFVIDESAPITERAKLISLPTSKNWTFGPQDIDELIFMLS---  784

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  785  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLIAHMGEMDHP  833

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  834  WNCPHGRPTMRHIANLDVISQ  854



>ref|XP_004021103.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Ovis 
aries]
Length=864

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  677  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  737  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  794  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  842

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  843  WNCPHGRPTMRHIANLDVISQ  863



>ref|XP_006044367.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Bubalus 
bubalis]
 ref|XP_006044368.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Bubalus 
bubalis]
 ref|XP_006044369.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Bubalus 
bubalis]
Length=887

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  700  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  759

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  760  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  816

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  817  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  865

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  866  WNCPHGRPTMRHIANLDVISQ  886



>ref|XP_011996895.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Ovis 
aries musimon]
Length=865

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  678  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  737

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  738  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  794

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  795  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  843

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  844  WNCPHGRPTMRHIANLDVISQ  864



>ref|XP_011996896.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Ovis 
aries musimon]
Length=864

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  677  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  737  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  794  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  842

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  843  WNCPHGRPTMRHIANLDVISQ  863



>ref|XP_011960028.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Ovis 
aries]
Length=865

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  678  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  737

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  738  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  794

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  795  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  843

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  844  WNCPHGRPTMRHIANLDVISQ  864



>ref|XP_005982161.1| PREDICTED: mismatch repair endonuclease PMS2 [Pantholops hodgsonii]
Length=864

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  677  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  737  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  793

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  794  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  842

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  843  WNCPHGRPTMRHIANLDVISQ  863



>emb|CDK28467.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=861

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 128/200 (64%), Gaps = 18/200 (9%)
 Frame = +3

Query  6    MKVIGQFHLGFII------GKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKM  167
            MK++GQF+LGFII       +   DLFIVDQHA+DEKYN+E+L   T    QPL+ P+ +
Sbjct  662  MKIVGQFNLGFIIVTRKSSEQGTTDLFIVDQHASDEKYNFEKLQRETTFESQPLVVPVDL  721

Query  168  DLSPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISI  347
            DL+P +E++V  + +   +NGF LE D   PPG R  L+++P SK   F  +D+ ELI +
Sbjct  722  DLNPIDELLVIDHREVFARNGFRLEIDEQQPPGRRIRLRSLPVSKKTVFDTSDMNELIHM  781

Query  348  LASSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAH  527
            L                ++ SI P ++R+M A RACR S+M+G PL R  MQ +++HLA 
Sbjct  782  LKDG------------GSAKSIRPSKIRSMFAMRACRMSIMVGRPLNRRTMQTVVQHLAG  829

Query  528  LKSPWNCPHGRPTMRHLIDL  587
            L  PWNCPHGRPTMRHL++L
Sbjct  830  LDKPWNCPHGRPTMRHLMEL  849



>ref|XP_005879477.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Myotis 
brandtii]
Length=855

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KLD DLFIVDQHA DEKYN+E L + T L  Q L+RP  ++L+  
Sbjct  668  EMEVIGQFNLGFIITKLDADLFIVDQHATDEKYNFEMLQQHTTLQGQRLIRPQTLNLTAV  727

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  728  NEAVLIENLEIFRKNGFDFVIDESAPITERAKLISLPTSKNWTFGPQDIDELIFMLS---  784

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  785  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLIAHMGEMDHP  833

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  834  WNCPHGRPTMRHIANLDVISQ  854



>ref|XP_005225190.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Bos 
taurus]
Length=922

 Score =   194 bits (494),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  735  EMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLSLTAV  794

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D HAP   R  L ++P SKN TFG  D+ EL+ +L+   
Sbjct  795  NEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTFGPQDIDELLFMLS---  851

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG PL  +EM+K++ H+  +  P
Sbjct  852  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMDHP  900

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  901  WNCPHGRPTMRHIANLDVISQ  921



>ref|XP_008154252.1| PREDICTED: mismatch repair endonuclease PMS2 [Eptesicus fuscus]
Length=857

 Score =   194 bits (492),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KLD DLFIVDQHA DEKYN+E L + T L  Q L+RP  ++L+  
Sbjct  670  EMEVIGQFNLGFIITKLDADLFIVDQHATDEKYNFEMLQQHTALQGQRLIRPQTLNLTAV  729

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  730  NEAVLIENLEIFRKNGFDFVIDESAPITERAKLISLPTSKNWTFGPQDIDELIFMLS---  786

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  787  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMKKLITHMGEMDHP  835

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  836  WNCPHGRPTMRHIANLDVISQ  856



>gb|KFP11708.1| Mismatch repair endonuclease PMS2, partial [Egretta garzetta]
Length=874

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETVLIENLEIFRKNGFDFVIDENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  855  WNCPHGRPTMRHIVSL  870



>gb|KFV60132.1| Mismatch repair endonuclease PMS2, partial [Tyto alba]
Length=606

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (65%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  421  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  480

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  481  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  537

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC   +           P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ PW
Sbjct  538  -DCPGVMCR---------PSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHPW  587

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRH++ L
Sbjct  588  NCPHGRPTMRHIVSL  602



>gb|ETN61231.1| DNA mismatch repair protein pms2 [Anopheles darlingi]
Length=896

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 127/200 (64%), Gaps = 15/200 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            MK++GQF+LGFI+ +L  DLFIVDQHA DEKYN+E L  +T+L  Q L+ P  ++L+   
Sbjct  704  MKIVGQFNLGFIVCRLGDDLFIVDQHATDEKYNFEDLQRTTVLQNQRLVVPQPLELTAVN  763

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E+V+  N+D    NGF  E D  A    +  L A PFS+N  FG  D+ ELI +L     
Sbjct  764  EMVLIDNLDVFEMNGFKFEIDGAAATTRKVRLIAKPFSRNWEFGKEDIDELIFML-----  818

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     +D   ++C P RVRAM ASRACR SVMIG  L   EM++++ H+  ++ PW
Sbjct  819  ---------QDAPGTVCRPSRVRAMFASRACRKSVMIGTALSVREMERLVRHMGEIEQPW  869

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL++L  +++
Sbjct  870  NCPHGRPTMRHLVNLAMINR  889



>ref|XP_308635.4| AGAP007126-PA [Anopheles gambiae str. PEST]
 gb|EAA04111.4| AGAP007126-PA [Anopheles gambiae str. PEST]
Length=882

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 127/201 (63%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII +L  DLFIVDQHA DEKYN+E L  +T+L  Q L+ P  ++L+  
Sbjct  677  KMEIVGQFNLGFIIVRLGDDLFIVDQHATDEKYNFEDLQRTTVLQNQRLVVPQPLELTAV  736

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E+V+  N+D    NGF  E D  AP   +  L A P+S+N  FG  D+ ELI ++    
Sbjct  737  NEMVLIDNLDVFEMNGFKFEVDGAAPTTKKVRLMAKPYSRNWEFGKEDIDELIFMM----  792

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                      +D   ++C P RVRAM ASRACR SVMIG  L   EM++++ H+  +  P
Sbjct  793  ----------QDAPSTVCRPSRVRAMFASRACRKSVMIGRALSVREMERLIRHMGEIDQP  842

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL++L  + +
Sbjct  843  WNCPHGRPTMRHLVNLAMIRQ  863



>gb|KFB50618.1| AGAP007126-PA-like protein [Anopheles sinensis]
Length=913

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 127/200 (64%), Gaps = 15/200 (8%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
            M +IGQF+LGFI+ +L  DLFIVDQHA DEKYN+E L  +T+L  Q L+ P  ++L+   
Sbjct  720  MSIIGQFNLGFIVARLGDDLFIVDQHATDEKYNFEDLQRTTVLQNQRLVVPQPLELTAVN  779

Query  186  EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
            E+V+  N+D    NGF  E D  AP   +  L A P+S+N  FG  D+ ELI +L     
Sbjct  780  EMVLIDNLDIFEMNGFKFEIDGAAPTTRKVKLIAKPYSRNWEFGKEDIDELIFML-----  834

Query  366  DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                     ++  +++C P RVRAM ASRACR SVMIG  L   EM+++L H+  +  PW
Sbjct  835  ---------QEAPNTVCRPSRVRAMFASRACRKSVMIGTALSVREMERLLRHMGEIDQPW  885

Query  543  NCPHGRPTMRHLIDLTTVHK  602
            NCPHGRPTMRHL++L  +++
Sbjct  886  NCPHGRPTMRHLVNLAMINQ  905



>ref|XP_005879476.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Myotis 
brandtii]
Length=877

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KLD DLFIVDQHA DEKYN+E L + T L  Q L+RP  ++L+  
Sbjct  690  EMEVIGQFNLGFIITKLDADLFIVDQHATDEKYNFEMLQQHTTLQGQRLIRPQTLNLTAV  749

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  750  NEAVLIENLEIFRKNGFDFVIDESAPITERAKLISLPTSKNWTFGPQDIDELIFMLS---  806

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  807  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLIAHMGEMDHP  855

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  856  WNCPHGRPTMRHIANLDVISQ  876



>ref|XP_006715807.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X5 [Homo 
sapiens]
Length=551

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  364  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  423

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  424  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  480

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  481  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  529

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  530  WNCPHGRPTMRHIANLGVISQ  550



>ref|XP_002932025.1| PREDICTED: mismatch repair endonuclease PMS2 [Xenopus (Silurana) 
tropicalis]
Length=848

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 130/201 (65%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KLD DLF++DQHA DEKYN+E L + T+L  Q L+ P K+ L+  
Sbjct  661  KMEIIGQFNLGFIITKLDSDLFMIDQHATDEKYNFEMLQQETVLQGQRLIAPQKLHLTAV  720

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N+D  +KNGF    D  AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  721  NETVLIDNLDIFKKNGFDFIFDEEAPITERVKLISLPTSKNWTFGQQDIEELIFMLS---  777

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  ++ P
Sbjct  778  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNVHEMKKLVTHMGEIEHP  826

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  827  WNCPHGRPTMRHIANLDMISQ  847



>gb|EMC89990.1| Mismatch repair endonuclease PMS2, partial [Columba livia]
Length=893

 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 127/196 (65%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  706  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  765

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   +  L ++P SKN TFG  D+ ELI +L+   
Sbjct  766  NETVLIENLEIFRKNGFDFVINENAPATQKVKLVSLPTSKNWTFGAQDIDELIFMLS---  822

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D   ++C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  823  -----------DCPGAMCRPSRVRQMFASRACRKSVMIGTALSVQEMRKLVTHMGEIEHP  871

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  872  WNCPHGRPTMRHVVSL  887



>ref|XP_009065197.1| hypothetical protein LOTGIDRAFT_108533, partial [Lottia gigantea]
 gb|ESO84069.1| hypothetical protein LOTGIDRAFT_108533, partial [Lottia gigantea]
Length=831

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 125/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QMK++GQF+LGFII KL  DLFIVDQHA DEKYN+E L ++T+L  Q L+ P  ++L+  
Sbjct  644  QMKILGQFNLGFIITKLQDDLFIVDQHATDEKYNFEMLQKNTVLQSQKLIHPQCLELTAS  703

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N+    +NGF    +  APP  R  L + P SKN  FG  D++EL+ +L    
Sbjct  704  NETILVDNLSIFNQNGFEFVINEEAPPTQRIKLTSTPVSKNWNFGKEDIEELLFMLT---  760

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+  ++C P RVR M ASR+CR +VMIG  L + +M+K++ H+  ++ P
Sbjct  761  -----------DSPGTMCRPSRVRMMFASRSCRKAVMIGTALNKTQMKKLVCHMGEIEMP  809

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRHL +L
Sbjct  810  WNCPHGRPTMRHLFNL  825



>ref|NP_001099378.1| mismatch repair endonuclease PMS2 [Rattus norvegicus]
 gb|EDL89648.1| postmeiotic segregation increased 2 (S. cerevisiae) (predicted), 
isoform CRA_a [Rattus norvegicus]
 gb|EDL89649.1| postmeiotic segregation increased 2 (S. cerevisiae) (predicted), 
isoform CRA_a [Rattus norvegicus]
Length=542

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  355  EMEILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLITPQTLNLTAV  414

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  415  NEAVLIENLEIFRKNGFDFIIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  471

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  472  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALSASEMKKLISHMGEMDHP  520

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  521  WNCPHGRPTMRHIANLDVISQ  541



>emb|CBJ31872.1| postmeiotic segregation increased 2 [Ectocarpus siliculosus]
Length=907

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 127/196 (65%), Gaps = 11/196 (6%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM+V+GQF+LGF+I  L  DLFI+DQHA DEKYN+E L ++T ++QQPL+RPL ++ S  
Sbjct  708  QMRVVGQFNLGFMICLLGSDLFILDQHACDEKYNFEVLQQTTTIHQQPLVRPLPLETSAS  767

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
            EE+ +  N+    +NGF    D   P   +  + A+PFSK   FGV DV EL SI+A + 
Sbjct  768  EEMTIIDNIALFERNGFRFTIDDDQPTTKKLKITAIPFSKGTQFGVDDVHELASIVADNT  827

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                       +  + +  P+ RAM ASRACRSS MIG  L + +M +++  +A ++ PW
Sbjct  828  -----------NPGEMVRLPKARAMFASRACRSSFMIGKALDKGQMARVVAKMATIEQPW  876

Query  543  NCPHGRPTMRHLIDLT  590
            NCPHGRPTMRHL D++
Sbjct  877  NCPHGRPTMRHLADVS  892



>ref|XP_007320377.1| hypothetical protein SERLADRAFT_471892 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN97539.1| hypothetical protein SERLA73DRAFT_56795 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO23137.1| hypothetical protein SERLADRAFT_471892 [Serpula lacrymans var. 
lacrymans S7.9]
Length=313

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 24/210 (11%)
 Frame = +3

Query  6    MKVIGQFHLGFII----------GKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLR  155
            MKV+GQF+LGFII          G LD DLFI+DQHAADEKYN+E L ++T++  Q L R
Sbjct  102  MKVLGQFNLGFIIARRQKSMEAEGDLD-DLFIIDQHAADEKYNFETLQQTTVIESQKLFR  160

Query  156  PLKMDLSPEEEIVVSMNMDTIRKNGFSLE-EDLHAPPGLRFNLKAVPFSKNITFGVADVK  332
            P  ++LS  +E+V   N++ +++NGF ++ +D  + PG R  L A P SKN  F + D++
Sbjct  161  PRVLELSAADELVAVENLEILQRNGFDVQADDATSGPGSRLQLLAQPVSKNTQFDIKDLE  220

Query  333  ELISILASSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKIL  512
            ELI +L        +  S            + RAM A RACR S+M+G PL  N+M  ++
Sbjct  221  ELIHLLQDRPAGTMVRCS------------KARAMFAMRACRKSIMVGMPLTHNQMTSVV  268

Query  513  EHLAHLKSPWNCPHGRPTMRHLIDLTTVHK  602
             H+  +  PWNCPHGRPTMRHL DL  + +
Sbjct  269  RHMGTMDQPWNCPHGRPTMRHLSDLRNIRE  298



>gb|KFO79942.1| Mismatch repair endonuclease PMS2, partial [Cuculus canorus]
Length=881

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 127/195 (65%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  696  KMEIIGQFNLGFIITKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  755

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF  E + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  756  NETVLIENLEIFRKNGFDFEINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  812

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC   +           P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ PW
Sbjct  813  -DCPGVMCR---------PSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHPW  862

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRH++ L
Sbjct  863  NCPHGRPTMRHVVCL  877



>gb|ETE59428.1| Mismatch repair endonuclease PMS2, partial [Ophiophagus hannah]
Length=767

 Score =   192 bits (489),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 128/196 (65%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M ++GQF+LGFII KL  DLFI+DQHA DEKYN+E L E T+L  Q L++P  ++L+  
Sbjct  580  KMDIVGQFNLGFIIAKLKSDLFIIDQHATDEKYNFEMLQEHTVLQGQKLIQPQNLNLTAV  639

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  +KNGF    D +AP   R  L ++P SKN TFG  DV+ELI +L+   
Sbjct  640  SESILMDNLEIFQKNGFDFVVDENAPVTQRVKLISLPTSKNWTFGPQDVEELIFMLS---  696

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  697  -----------DSPGIMCRPSRVRQMFASRACRKSVMIGTALTAGEMKKLISHMGEIEHP  745

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPT+RHL++L
Sbjct  746  WNCPHGRPTIRHLVNL  761



>gb|KFP92882.1| Mismatch repair endonuclease PMS2, partial [Haliaeetus albicilla]
Length=874

 Score =   193 bits (490),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIITKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETVLIENVEIFRKNGFDFVIDENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  855  WNCPHGRPTMRHIVSL  870



>ref|XP_007525140.1| PREDICTED: mismatch repair endonuclease PMS2 [Erinaceus europaeus]
Length=860

 Score =   193 bits (490),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 126/201 (63%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KL  DLFIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  670  EMEVIGQFNLGFIITKLHADLFIVDQHATDEKYNFEMLQQHTVLQGQRLITPQTLHLTAV  729

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N+D  RKNGF    +  AP   R  L ++P SKN TFGV D+ ELI +L+   
Sbjct  730  NEAVLIENLDIFRKNGFDFVINDSAPVTKRAKLVSLPTSKNWTFGVQDIDELIFMLS---  786

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L   EM+K++ H+  +  P
Sbjct  787  -----------DSPGIMCRPSRVRQMFASRACRKSVMIGTALNTGEMKKLISHMGQMDHP  835

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL +L  + +
Sbjct  836  WNCPHGRPTMRHLANLDVLSR  856



>gb|KFQ67704.1| Mismatch repair endonuclease PMS2, partial [Phaethon lepturus]
Length=873

 Score =   193 bits (490),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  688  KMEVIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  748  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLVSLPTSKNWTFGPQDIDELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHIVSL  869



>emb|CCI43565.1| unnamed protein product [Albugo candida]
Length=664

 Score =   192 bits (487),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 132/200 (66%), Gaps = 13/200 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLD-RDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSP  179
            +M++IGQF+LGFII K D +DLFI+DQHA+DEK+ YE L  ST+L+ QPL+RPL + L+ 
Sbjct  477  RMEIIGQFNLGFIIAKYDEKDLFIIDQHASDEKFRYESLQRSTVLHHQPLVRPLSLQLTT  536

Query  180  EEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASS  359
             EE+++  ++   +KNGF+ E D  A    +  L ++P SK   FG+ D++ELIS+L   
Sbjct  537  TEEMIILDHLQVFQKNGFTFEMDAQAQSN-KLRLLSLPLSKETQFGIEDLRELISLLQDY  595

Query  360  QEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
              +            +S+   +V ++LASRACRSSVMIG  L + EM +I+  L  L+ P
Sbjct  596  PSNI-----------ESLRLSKVASILASRACRSSVMIGTALSKAEMTRIVHKLTGLEQP  644

Query  540  WNCPHGRPTMRHLIDLTTVH  599
            WNCPHGRPTMRHL D+  + 
Sbjct  645  WNCPHGRPTMRHLFDIAALE  664



>ref|XP_006637418.1| PREDICTED: mismatch repair endonuclease PMS2-like [Lepisosteus 
oculatus]
Length=904

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 131/201 (65%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KLD D+F++DQHA DEKYN+E L + T+L  Q L+ P K+ L+  
Sbjct  717  KMEIIGQFNLGFIITKLDSDIFMIDQHATDEKYNFEMLQQHTVLQGQRLIVPQKLHLTAV  776

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  AP   R  L ++P SKN TFG AD++EL+ +L+   
Sbjct  777  NETILMENLEIFRKNGFEFLIDEDAPAMDRVKLVSLPTSKNWTFGPADIEELVFMLS---  833

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  ++ P
Sbjct  834  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMRKLVTHMGEIEHP  882

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL +L  + +
Sbjct  883  WNCPHGRPTMRHLANLDMISQ  903



>ref|XP_007060701.1| PREDICTED: LOW QUALITY PROTEIN: mismatch repair endonuclease 
PMS2 [Chelonia mydas]
Length=879

 Score =   193 bits (490),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFI+ KL+ DLFI+DQHA DEKYN+E L +  IL  Q L+ P  ++L+  
Sbjct  693  KMEIIGQFNLGFIVAKLNSDLFIIDQHATDEKYNFEMLQQHNILQGQKLIAPQNLNLTAV  752

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  753  NETILIENLEIFRKNGFDFVIDEDAPVTERVKLISLPTSKNWTFGPQDIEELIFMLS---  809

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  ++ P
Sbjct  810  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALTVNEMKKLITHMGEIEHP  858

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  859  WNCPHGRPTMRHIANLDMISQ  879



>gb|EXX79123.1| Pms1p [Rhizophagus irregularis DAOM 197198w]
Length=865

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 17/199 (9%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDR----DLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDL  173
            M++IGQF+LGFII KLD     DLFI+DQHA+DEKYN+E L   T +  Q L+ P K+DL
Sbjct  651  MEIIGQFNLGFIIVKLDNSNCNDLFIIDQHASDEKYNFENLQHHTKIQSQRLISPRKLDL  710

Query  174  SPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA  353
            +  EE++   N+  ++ NGF L+ D +A P  +  L A P SK+I FGV D++ELI +L+
Sbjct  711  TAAEELIAIENLKILQANGFELDVDYNASPTNKLKLLAQPMSKDIIFGVKDLEELIFLLS  770

Query  354  SSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLK  533
                             + +    +R M ASRACR S+MIGD L R +M KI++H+  + 
Sbjct  771  ER-------------PGEMVRCSHIRNMFASRACRKSIMIGDALSRQQMGKIVKHMGDID  817

Query  534  SPWNCPHGRPTMRHLIDLT  590
             PWNCPHGRPTMRHL DL+
Sbjct  818  QPWNCPHGRPTMRHLFDLS  836



>ref|XP_007891996.1| PREDICTED: mismatch repair endonuclease PMS2 [Callorhinchus milii]
Length=1033

 Score =   194 bits (493),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 128/198 (65%), Gaps = 15/198 (8%)
 Frame = +3

Query  6     MKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPEE  185
             M++IGQF+LGFII KLD DLFI+DQHA DEKYN+E L + T+L  Q L+ P K+ L+   
Sbjct  847   MEIIGQFNLGFIITKLDSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQKLHLTAVS  906

Query  186   EIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQE  365
             E V+  N++  RKNGF    D  A P  R  L ++P SKN TFG  D++ELI +L+    
Sbjct  907   ETVLMDNLEIFRKNGFDFIIDEEASPTERVKLVSLPTSKNWTFGPQDIEELIFMLS----  962

Query  366   DCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  ++ PW
Sbjct  963   ----------DSPGLMCRPSRVRQMFASRACRKSVMIGTALQMSEMKKLITHMGEIEHPW  1012

Query  543   NCPHGRPTMRHLIDLTTV  596
             NCPHGRPTMRHL +L  +
Sbjct  1013  NCPHGRPTMRHLANLDMI  1030



>gb|KFZ53439.1| Mismatch repair endonuclease PMS2, partial [Podiceps cristatus]
Length=872

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  687  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  746

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  747  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  803

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  804  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNMQEMRKLITHMGEIEHP  852

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  853  WNCPHGRPTMRHIVSL  868



>gb|ESA07485.1| hypothetical protein GLOINDRAFT_98750 [Rhizophagus irregularis 
DAOM 181602]
Length=863

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 17/199 (9%)
 Frame = +3

Query  6    MKVIGQFHLGFIIGKLDR----DLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDL  173
            M++IGQF+LGFII KLD     DLFI+DQHA+DEKYN+E L   T +  Q L+ P K+DL
Sbjct  649  MEIIGQFNLGFIIVKLDNSNCNDLFIIDQHASDEKYNFENLQHHTKIQSQRLISPRKLDL  708

Query  174  SPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA  353
            +  EE++   N+  ++ NGF L+ D +A P  +  L A P SK+I FGV D++ELI +L+
Sbjct  709  TAAEELIAIENLKILQANGFELDVDYNASPTNKLKLLAQPMSKDIIFGVKDLEELIFLLS  768

Query  354  SSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLK  533
                             + +    +R M ASRACR S+MIGD L R +M KI++H+  + 
Sbjct  769  ER-------------PGEMVRCSHIRNMFASRACRKSIMIGDALSRQQMGKIVKHMGDID  815

Query  534  SPWNCPHGRPTMRHLIDLT  590
             PWNCPHGRPTMRHL DL+
Sbjct  816  QPWNCPHGRPTMRHLFDLS  834



>gb|KFQ88947.1| Mismatch repair endonuclease PMS2, partial [Phoenicopterus ruber 
ruber]
Length=870

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  685  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  744

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  745  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  801

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  802  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNAQEMRKLITHMGEIEHP  850

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  851  WNCPHGRPTMRHIVSL  866



>gb|ADE76812.1| unknown [Picea sitchensis]
Length=150

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 109/150 (73%), Gaps = 15/150 (10%)
 Frame = +3

Query  201  MNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILA---------  353
            M++DT RKNGF   ED +APPG RF L AVP+S+NITFG+ DV+EL+SILA         
Sbjct  1    MHLDTFRKNGFDFVEDTNAPPGRRFLLSAVPYSQNITFGLEDVQELLSILADAPAPPTSE  60

Query  354  -SSQEDCH--ITLSYRKDTSDSI---CPPRVRAMLASRACRSSVMIGDPLGRNEMQKILE  515
             S   DC    + SY+K    SI   CP RVRAMLASRACRSSVMIGD L + +M+ IL+
Sbjct  61   VSDSLDCSDVCSNSYKKAIPQSISALCPSRVRAMLASRACRSSVMIGDALCKKDMETILQ  120

Query  516  HLAHLKSPWNCPHGRPTMRHLIDLTTVHKR  605
            HL+ L SPWNCPHGRPTMRHL+DLTTV++R
Sbjct  121  HLSTLNSPWNCPHGRPTMRHLVDLTTVYRR  150



>ref|XP_001494013.2| PREDICTED: mismatch repair endonuclease PMS2 [Equus caballus]
 ref|XP_008525762.1| PREDICTED: mismatch repair endonuclease PMS2 [Equus przewalskii]
Length=868

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 127/199 (64%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KLD D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  681  EMEIIGQFNLGFIITKLDADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  740

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  741  NEAVLIENLEIFRKNGFDFVIDEGAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  797

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  798  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMRKLITHMGEMDHP  846

Query  540  WNCPHGRPTMRHLIDLTTV  596
            WNCPHGRPTMRH+ +L  +
Sbjct  847  WNCPHGRPTMRHIANLDVI  865



>emb|CCI43563.1| unnamed protein product [Albugo candida]
Length=668

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 132/200 (66%), Gaps = 13/200 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLD-RDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSP  179
            +M++IGQF+LGFII K D +DLFI+DQHA+DEK+ YE L  ST+L+ QPL+RPL + L+ 
Sbjct  481  RMEIIGQFNLGFIIAKYDEKDLFIIDQHASDEKFRYESLQRSTVLHHQPLVRPLSLQLTT  540

Query  180  EEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASS  359
             EE+++  ++   +KNGF+ E D  A    +  L ++P SK   FG+ D++ELIS+L   
Sbjct  541  TEEMIILDHLQVFQKNGFTFEMDAQAQSN-KLRLLSLPLSKETQFGIEDLRELISLLQDY  599

Query  360  QEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
              +            +S+   +V ++LASRACRSSVMIG  L + EM +I+  L  L+ P
Sbjct  600  PSNI-----------ESLRLSKVASILASRACRSSVMIGTALSKAEMTRIVHKLTGLEQP  648

Query  540  WNCPHGRPTMRHLIDLTTVH  599
            WNCPHGRPTMRHL D+  + 
Sbjct  649  WNCPHGRPTMRHLFDIAALE  668



>ref|XP_006150253.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X4 [Tupaia 
chinensis]
Length=740

 Score =   192 bits (487),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  553  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEVLQQHTVLQGQRLIAPQTLNLTAV  612

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  613  NEAVLIENLEIFRKNGFDFIIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  669

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  +  P
Sbjct  670  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTNEMKKLITHMGEMDHP  718

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  719  WNCPHGRPTMRHIANLDIISQ  739



>gb|KFQ38873.1| Mismatch repair endonuclease PMS2, partial [Mesitornis unicolor]
Length=873

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + TIL  Q L+ P  ++L+  
Sbjct  688  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTILQGQKLIVPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  748  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLVSLPTSKNWTFGPQDIDELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHVVSL  869



>ref|XP_011124903.1| hypothetical protein AOL_s00109g120 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX46548.1| hypothetical protein AOL_s00109g120 [Arthrobotrys oligospora 
ATCC 24927]
Length=1066

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 131/202 (65%), Gaps = 19/202 (9%)
 Frame = +3

Query  3     QMKVIGQFHLGFII-------GKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPL  161
             +M++ GQF+LGFI+       G    DLFI+DQHA+DEKYN+ERL   T++  QPL+RP 
Sbjct  825   KMRIAGQFNLGFILATRLSEKGDGVNDLFIIDQHASDEKYNFERLQAETVVQNQPLVRPK  884

Query  162   KMDLSPEEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELI  341
              ++LS  +E+VV  NMD ++KNGF +E D   P G R  L ++P SK+  F + D +EL+
Sbjct  885   VLELSAMDELVVMDNMDVLKKNGFVVEIDDEGPVGKRCRLVSLPMSKDKVFDLKDFEELL  944

Query  342   SILASSQEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHL  521
              ++     D            D++ P +VRAM A RACRSS+MIG  LG  +M+K+++H+
Sbjct  945   HLIREHPND------------DTVRPSKVRAMFAMRACRSSIMIGRTLGLKDMKKVVKHM  992

Query  522   AHLKSPWNCPHGRPTMRHLIDL  587
               L  PWNCPHGRPTMRHL D+
Sbjct  993   GELDKPWNCPHGRPTMRHLCDV  1014



>emb|CCI43564.1| unnamed protein product [Albugo candida]
Length=670

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 132/200 (66%), Gaps = 13/200 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLD-RDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSP  179
            +M++IGQF+LGFII K D +DLFI+DQHA+DEK+ YE L  ST+L+ QPL+RPL + L+ 
Sbjct  483  RMEIIGQFNLGFIIAKYDEKDLFIIDQHASDEKFRYESLQRSTVLHHQPLVRPLSLQLTT  542

Query  180  EEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASS  359
             EE+++  ++   +KNGF+ E D  A    +  L ++P SK   FG+ D++ELIS+L   
Sbjct  543  TEEMIILDHLQVFQKNGFTFEMDAQAQSN-KLRLLSLPLSKETQFGIEDLRELISLLQDY  601

Query  360  QEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
              +            +S+   +V ++LASRACRSSVMIG  L + EM +I+  L  L+ P
Sbjct  602  PSNI-----------ESLRLSKVASILASRACRSSVMIGTALSKAEMTRIVHKLTGLEQP  650

Query  540  WNCPHGRPTMRHLIDLTTVH  599
            WNCPHGRPTMRHL D+  + 
Sbjct  651  WNCPHGRPTMRHLFDIAALE  670



>ref|XP_010221538.1| PREDICTED: LOW QUALITY PROTEIN: mismatch repair endonuclease 
PMS2 [Tinamus guttatus]
Length=943

 Score =   193 bits (491),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  756  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  815

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  816  NETVLIENLEIFRKNGFDFVIDENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  872

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  873  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNIQEMKKLVTHMGEIEHP  921

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  922  WNCPHGRPTMRHIVSL  937



>emb|CCI43566.1| unnamed protein product [Albugo candida]
Length=674

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 132/200 (66%), Gaps = 13/200 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLD-RDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSP  179
            +M++IGQF+LGFII K D +DLFI+DQHA+DEK+ YE L  ST+L+ QPL+RPL + L+ 
Sbjct  487  RMEIIGQFNLGFIIAKYDEKDLFIIDQHASDEKFRYESLQRSTVLHHQPLVRPLSLQLTT  546

Query  180  EEEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASS  359
             EE+++  ++   +KNGF+ E D  A    +  L ++P SK   FG+ D++ELIS+L   
Sbjct  547  TEEMIILDHLQVFQKNGFTFEMDAQAQSN-KLRLLSLPLSKETQFGIEDLRELISLLQDY  605

Query  360  QEDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
              +            +S+   +V ++LASRACRSSVMIG  L + EM +I+  L  L+ P
Sbjct  606  PSNI-----------ESLRLSKVASILASRACRSSVMIGTALSKAEMTRIVHKLTGLEQP  654

Query  540  WNCPHGRPTMRHLIDLTTVH  599
            WNCPHGRPTMRHL D+  + 
Sbjct  655  WNCPHGRPTMRHLFDIAALE  674



>ref|XP_004666302.1| PREDICTED: mismatch repair endonuclease PMS2 [Jaculus jaculus]
Length=627

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  440  EMEILGQFNLGFIITKLKEDLFLVDQHAADEKYNFEMLRQHTVLQAQRLITPQALNLTAV  499

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  500  NEAILIENLEIFRKNGFDFVIDEDAPVTKRAKLISLPTSKNWTFGPQDVDELIFMLS---  556

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  ++ P
Sbjct  557  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNISEMKKLVTHMGEMEHP  605

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  606  WNCPHGRPTMRHIANLDVISQ  626



>gb|KFQ18344.1| Mismatch repair endonuclease PMS2, partial [Merops nubicus]
Length=547

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 125/195 (64%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  362  KMEIIGQFNLGFIIVKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLHLTAV  421

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  422  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  478

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC   +           P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ PW
Sbjct  479  -DCPGVMCR---------PSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHPW  528

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRH++ L
Sbjct  529  NCPHGRPTMRHIVSL  543



>gb|KFP50069.1| Mismatch repair endonuclease PMS2, partial [Cathartes aura]
Length=873

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  688  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  748  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHIVSL  869



>gb|KFV61600.1| Mismatch repair endonuclease PMS2, partial [Picoides pubescens]
Length=865

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  680  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  739

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  740  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  796

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  797  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNMQEMRKLITHMGEIEHP  845

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  846  WNCPHGRPTMRHIVSL  861



>gb|KFQ53529.1| Mismatch repair endonuclease PMS2, partial [Pelecanus crispus]
Length=873

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  688  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  748  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLVSLPTSKNWTFGPQDIDELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHIVSL  869



>gb|KFO59077.1| Mismatch repair endonuclease PMS2, partial [Corvus brachyrhynchos]
Length=865

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (65%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  680  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  739

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  740  NETVLIENLEIFRKNGFDFFINENAPVTQRVKLVSLPTSKNWTFGPQDIDELIFMLS---  796

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC   +           P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ PW
Sbjct  797  -DCPGVMCR---------PSRVRQMFASRACRKSVMIGTALNAQEMRKLITHMGEIEHPW  846

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRH++ L
Sbjct  847  NCPHGRPTMRHIVSL  861



>ref|XP_006150251.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Tupaia 
chinensis]
Length=842

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  655  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEVLQQHTVLQGQRLIAPQTLNLTAV  714

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  715  NEAVLIENLEIFRKNGFDFIIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  771

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  +  P
Sbjct  772  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTNEMKKLITHMGEMDHP  820

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  821  WNCPHGRPTMRHIANLDIISQ  841



>gb|KFP59441.1| Mismatch repair endonuclease PMS2, partial [Cariama cristata]
Length=871

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  686  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  745

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  746  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  802

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  803  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  851

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  852  WNCPHGRPTMRHIVSL  867



>ref|XP_004622885.1| PREDICTED: LOW QUALITY PROTEIN: PMS2 postmeiotic segregation 
increased 2 (S. cerevisiae) [Sorex araneus]
Length=743

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 127/201 (63%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  + L+  
Sbjct  556  EMEVIGQFNLGFIITKLNADLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLGLTAV  615

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N+D  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  616  NEAVLIENLDIFRKNGFDFVIDEAAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  672

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  673  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  721

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  722  WNCPHGRPTMRHIANLDVISQ  742



>gb|KDR15822.1| Mismatch repair endonuclease PMS2 [Zootermopsis nevadensis]
Length=855

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 129/200 (65%), Gaps = 15/200 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ +L  DLFI+DQHA DEKYN+E L  +TIL  Q L+ P K+DL+  
Sbjct  668  KMEILGQFNLGFIVTRLGPDLFIIDQHATDEKYNFEMLQLNTILQNQRLVIPQKLDLTSV  727

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N +   KNGF    D  A P  R  L A+P SK   FG  D+ ELI +L    
Sbjct  728  NESILIENEEIFNKNGFDFIIDEKAEPTKRVQLTAIPVSKTWEFGKEDIDELIFML----  783

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                      +D+  ++C P R+R+M ASRACR SVMIG  L R +M++++E++  ++ P
Sbjct  784  ----------QDSPHTMCRPSRIRSMFASRACRKSVMIGTALSRADMRRLIENMGQIEQP  833

Query  540  WNCPHGRPTMRHLIDLTTVH  599
            WNCPHGRPTMRHLI+L  +H
Sbjct  834  WNCPHGRPTMRHLINLDLIH  853



>ref|XP_005339809.1| PREDICTED: mismatch repair endonuclease PMS2 [Ictidomys tridecemlineatus]
Length=629

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII KL  D+F+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  442  EMEVLGQFNLGFIITKLKEDIFLVDQHAADEKYNFEMLQQHTVLQAQRLIAPQTLNLTAV  501

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  502  NEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  558

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  559  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  607

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  608  WNCPHGRPTMRHIANLDVISQ  628



>ref|XP_006150252.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Tupaia 
chinensis]
Length=782

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  595  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEVLQQHTVLQGQRLIAPQTLNLTAV  654

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  655  NEAVLIENLEIFRKNGFDFIIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  711

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  +  P
Sbjct  712  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTNEMKKLITHMGEMDHP  760

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  761  WNCPHGRPTMRHIANLDIISQ  781



>gb|KFV08218.1| Mismatch repair endonuclease PMS2, partial [Pterocles gutturalis]
Length=869

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  684  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  743

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  744  NETVLIENLEIFRKNGFDFIINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  800

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  801  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHP  849

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  850  WNCPHGRPTMRHIVSL  865



>gb|KFV44088.1| Mismatch repair endonuclease PMS2, partial [Gavia stellata]
Length=874

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  855  WNCPHGRPTMRHIVSL  870



>gb|KGL86612.1| Mismatch repair endonuclease PMS2, partial [Charadrius vociferus]
Length=874

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  855  WNCPHGRPTMRHIVSL  870



>gb|KFP79673.1| Mismatch repair endonuclease PMS2, partial [Apaloderma vittatum]
Length=874

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  855  WNCPHGRPTMRHIVSL  870



>ref|XP_006150250.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Tupaia 
chinensis]
Length=892

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  705  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEVLQQHTVLQGQRLIAPQTLNLTAV  764

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  765  NEAVLIENLEIFRKNGFDFIIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  821

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  +  P
Sbjct  822  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTNEMKKLITHMGEMDHP  870

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  871  WNCPHGRPTMRHIANLDIISQ  891



>gb|KFO93754.1| Mismatch repair endonuclease PMS2, partial [Buceros rhinoceros 
silvestris]
Length=874

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 127/195 (65%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L ++T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQNTVLQGQKLIVPQNLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETILIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC   +           P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ PW
Sbjct  806  -DCPGVMCR---------PSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHPW  855

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRH++ L
Sbjct  856  NCPHGRPTMRHIVSL  870



>ref|XP_008016903.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X4 [Chlorocebus 
sabaeus]
Length=679

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  492  EMEIIGQFNLGFIITKLNEDLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  551

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  552  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  608

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  609  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  657

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  658  WNCPHGRPTMRHIANLGVISQ  678



>gb|KFQ99804.1| Mismatch repair endonuclease PMS2, partial [Nipponia nippon]
Length=887

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+VIGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  702  KMEVIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  761

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  762  NETILIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  818

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  819  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  867

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  868  WNCPHGRPTMRHIVSL  883



>gb|KFW64318.1| Mismatch repair endonuclease PMS2, partial [Pygoscelis adeliae]
Length=896

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  711  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  770

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  771  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  827

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  828  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  876

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  877  WNCPHGRPTMRHIVSL  892



>gb|KFP35113.1| Mismatch repair endonuclease PMS2, partial [Chlamydotis macqueenii]
Length=883

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  698  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  757

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  758  NETVLIENLEIFRKNGFDFIINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  814

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  815  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHP  863

Query  540  WNCPHGRPTMRHLIDLTTV  596
            WNCPHGRPTMRH++ L  +
Sbjct  864  WNCPHGRPTMRHIVSLDMI  882



>ref|XP_004440915.1| PREDICTED: mismatch repair endonuclease PMS2 [Ceratotherium simum 
simum]
Length=870

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KLD D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  683  EMEIIGQFNLGFIITKLDADIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  742

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  743  NEAVLIENLEIFRKNGFDFVIDEGAPITERAKLISLPTSKNWTFGPQDIDELIFMLS---  799

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  800  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  848

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  849  WNCPHGRPTMRHIANLDVISQ  869



>gb|KFV18589.1| Mismatch repair endonuclease PMS2, partial [Tauraco erythrolophus]
Length=882

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  697  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  756

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  757  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  813

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  814  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHP  862

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  863  WNCPHGRPTMRHIVSL  878



>gb|KFV85651.1| Mismatch repair endonuclease PMS2, partial [Struthio camelus 
australis]
Length=871

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  686  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  745

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  746  NETVLIENLEIFRKNGFDFFINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  802

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L + EM+K++ H+  ++ P
Sbjct  803  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNKQEMRKLVTHMGEIEHP  851

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH+  L
Sbjct  852  WNCPHGRPTMRHVASL  867



>ref|XP_008119094.1| PREDICTED: mismatch repair endonuclease PMS2 [Anolis carolinensis]
Length=845

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M +IGQF+LGFI+ KL+ DLFIVDQHA+DEKYN+E+L E T+L  Q L+ P  ++L+  
Sbjct  658  KMDIIGQFNLGFIVAKLNSDLFIVDQHASDEKYNFEQLQEHTVLQGQRLISPQNLNLTAI  717

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    +  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  718  NESVLIENLEIFRKNGFDFVINEDAPVTQRVQLISLPMSKNWTFGPQDIDELIFMLS---  774

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVM+G  L   EM+K++ H+  ++ P
Sbjct  775  -----------DSPGVMCRPSRVRQMFASRACRKSVMVGTALNAKEMKKLITHMGEIEHP  823

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPT+RHL +L  + +
Sbjct  824  WNCPHGRPTIRHLANLDLISQ  844



>ref|XP_008016901.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Chlorocebus 
sabaeus]
Length=837

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  650  EMEIIGQFNLGFIITKLNEDLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  709

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  710  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  766

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  767  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  815

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  816  WNCPHGRPTMRHIANLGVISQ  836



>gb|KFQ01553.1| Mismatch repair endonuclease PMS2, partial [Leptosomus discolor]
Length=886

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  701  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  760

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  761  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  817

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  818  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  866

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  867  WNCPHGRPTMRHIVSL  882



>ref|XP_011513730.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Homo 
sapiens]
Length=825

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  638  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  697

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  698  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  754

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  755  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  803

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  804  WNCPHGRPTMRHIANLGVISQ  824



>ref|XP_009450891.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Pan 
troglodytes]
Length=810

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  623  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  682

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  683  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  739

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  740  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  788

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  789  WNCPHGRPTMRHIANLGVISQ  809



>ref|XP_005549553.1| PREDICTED: mismatch repair endonuclease PMS2-like [Macaca fascicularis]
Length=838

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  651  EMEIVGQFNLGFIITKLNEDLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  710

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  711  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDIDELIFLLS---  767

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  768  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  816

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  817  WNCPHGRPTMRHIANLGVISQ  837



>gb|KDD73673.1| hypothetical protein H632_c1940p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=523

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 129/214 (60%), Gaps = 23/214 (11%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+V+GQF+LGFII K+ +DLFIVDQHA+DEKYN+ERL     L +QPLL   ++ LS  
Sbjct  309  RMEVLGQFNLGFIIAKIGQDLFIVDQHASDEKYNFERLQAELCLRRQPLLAKQRLTLSAA  368

Query  183  EEIVVSM----------NMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVK  332
            EE+ +            NM   + NGF  EED       R  L AVPFSKN+ F   DV 
Sbjct  369  EELTIRQDWETSSSWLDNMAMFQANGFDFEEDDEG----RLRLSAVPFSKNVVFSAEDVY  424

Query  333  ELISIL----ASSQEDCHITLSYRKDTSDSIC-----PPRVRAMLASRACRSSVMIGDPL  485
            EL+++L     + +    + L+        +      P R+RA+LASRACRSS+MIG  L
Sbjct  425  ELVNMLDGSGGAGKHGAELPLARTLGPGSQLRGPILRPSRLRAVLASRACRSSIMIGSAL  484

Query  486  GRNEMQKILEHLAHLKSPWNCPHGRPTMRHLIDL  587
                M++IL  LA L+SPWNCPHGRPTMRHL  L
Sbjct  485  SMPTMRRILARLAGLQSPWNCPHGRPTMRHLCTL  518



>gb|EHH17126.1| PMS2 like protein, partial [Macaca mulatta]
Length=820

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  633  EMEIVGQFNLGFIITKLNEDLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  692

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  693  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDIDELIFLLS---  749

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  750  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  798

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  799  WNCPHGRPTMRHIANLGVISQ  819



>ref|XP_008016900.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Chlorocebus 
sabaeus]
Length=889

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  702  EMEIIGQFNLGFIITKLNEDLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  761

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  762  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  818

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  819  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  867

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  868  WNCPHGRPTMRHIANLGVISQ  888



>gb|EOB00894.1| Mismatch repair endonuclease PMS2, partial [Anas platyrhynchos]
Length=873

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 125/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  688  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    +  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  748  NETVLIENLEIFRKNGFDFVINEDAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNIQEMRKLITHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHIVSL  869



>gb|AAH93921.1| PMS2 postmeiotic segregation increased 2 (S. cerevisiae) [Homo 
sapiens]
 gb|AIC62565.1| PMS2, partial [synthetic construct]
Length=862

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  675  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  735  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  791

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  792  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  840

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  841  WNCPHGRPTMRHIANLGVISQ  861



>ref|XP_001141671.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Pan 
troglodytes]
Length=862

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  675  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  735  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  791

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  792  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  840

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  841  WNCPHGRPTMRHIANLGVISQ  861



>ref|XP_008822235.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Nannospalax 
galili]
Length=859

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  672  EMEILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLITPQSLNLTAV  731

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  732  NEALLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  788

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  NEM+K++ H+  +  P
Sbjct  789  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTNEMKKLITHMGEMDHP  837

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH+ +L
Sbjct  838  WNCPHGRPTMRHIANL  853



>dbj|BAD89429.1| postmeiotic segregation increased 2 nirs variant 5 [Homo sapiens]
Length=756

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  569  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  628

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  629  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  685

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  686  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  734

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  735  WNCPHGRPTMRHIANLGVISQ  755



>ref|XP_011513731.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X4 [Homo 
sapiens]
 ref|XP_011513732.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X4 [Homo 
sapiens]
Length=756

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  569  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  628

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  629  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  685

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  686  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  734

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  735  WNCPHGRPTMRHIANLGVISQ  755



>gb|KFP70277.1| Mismatch repair endonuclease PMS2, partial [Acanthisitta chloris]
Length=877

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (65%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  692  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQNLNLTAV  751

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  752  NESVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  808

Query  363  EDCHITLSYRKDTSDSICPPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSPW  542
             DC   +           P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ PW
Sbjct  809  -DCPGVMCR---------PSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHPW  858

Query  543  NCPHGRPTMRHLIDL  587
            NCPHGRPTMRH++ L
Sbjct  859  NCPHGRPTMRHIVSL  873



>sp|P54278.2|PMS2_HUMAN RecName: Full=Mismatch repair endonuclease PMS2; AltName: Full=DNA 
mismatch repair protein PMS2; AltName: Full=PMS1 protein 
homolog 2 [Homo sapiens]
 gb|AAS00390.1| unknown [Homo sapiens]
Length=862

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  675  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  735  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  791

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  792  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  840

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  841  WNCPHGRPTMRHIANLGVISQ  861



>ref|XP_006504875.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Mus 
musculus]
 gb|EDL19029.1| postmeiotic segregation increased 2 (S. cerevisiae), isoform 
CRA_a [Mus musculus]
Length=676

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  489  EMEILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLITPQTLNLTAV  548

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  549  NEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  605

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  606  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMKKLITHMGEMDHP  654

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  655  WNCPHGRPTMRHVANLDVISQ  675



>ref|NP_000526.1| mismatch repair endonuclease PMS2 isoform a [Homo sapiens]
 gb|AAA63923.1| homolog of yeast mutL gene [Homo sapiens]
 prf||2017356B PMS2 gene
Length=862

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  675  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  735  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  791

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  792  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  840

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  841  WNCPHGRPTMRHIANLGVISQ  861



>ref|XP_009450892.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Pan 
troglodytes]
 ref|XP_009450893.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X3 [Pan 
troglodytes]
Length=727

 Score =   190 bits (483),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  540  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  599

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  600  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  656

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  657  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  705

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  706  WNCPHGRPTMRHIANLGVISQ  726



>gb|AAA50390.1| similar to S. cerevisiae PMS1 Swiss-Prot Accession Number P14242, 
S. cerevisiae MLH1 GenBank Accession Number U07187, E. 
coli MUTL Swiss-Prot Accession Number P23367, Salmonella typhimurium 
MUTL Swiss-Prot Accession Number P14161, Streptococcus 
pneumoniae Swiss-Prot Accession Number P14160 [Homo sapiens]
 dbj|BAG35307.1| unnamed protein product [Homo sapiens]
 dbj|BAJ17835.1| PMS2 postmeiotic segregation increased 2 [synthetic construct]
Length=862

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  675  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  735  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  791

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  792  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  840

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  841  WNCPHGRPTMRHIANLGVISQ  861



>ref|XP_010727980.1| PREDICTED: mismatch repair endonuclease PMS2 [Larimichthys crocea]
Length=851

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            QM++IGQF+LGFII KL+ D+F++DQHA DEKYN+E L + T+L  Q L+ P K+ L   
Sbjct  664  QMEIIGQFNLGFIITKLNSDIFMIDQHATDEKYNFEMLQQHTVLQGQKLIAPQKLHLPAV  723

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  A    R  L ++P SKN TFG AD++ELI +L+   
Sbjct  724  SENILIENIEIFRKNGFEFLVDEDAQVMERVKLVSLPTSKNWTFGPADIEELIFMLS---  780

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K+L H+  ++ P
Sbjct  781  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALSVSEMKKLLVHMGEIEHP  829

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL +L  + K
Sbjct  830  WNCPHGRPTMRHLANLDIISK  850



>ref|XP_006982718.1| PREDICTED: mismatch repair endonuclease PMS2 [Peromyscus maniculatus 
bairdii]
Length=862

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 128/202 (63%), Gaps = 15/202 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  675  EMEILGQFNLGFIITKLKEDLFLVDQHAADEKYNFEMLQQHTVLQVQRLITPQTLNLTAV  734

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  735  NEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  791

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L   EM+K++ H+  +  P
Sbjct  792  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTKEMKKLITHMGEMDHP  840

Query  540  WNCPHGRPTMRHLIDLTTVHKR  605
            WNCPHGRPTMRH+ +L  + ++
Sbjct  841  WNCPHGRPTMRHIANLDVISQK  862



>ref|XP_006112999.1| PREDICTED: mismatch repair endonuclease PMS2 [Pelodiscus sinensis]
Length=961

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFI+ KL+ DLFI+DQHA DEKYN+E L +  +L  Q L+ P  +DL+  
Sbjct  774  KMEIIGQFNLGFIVTKLNSDLFIIDQHATDEKYNFEILQQHNVLQGQKLITPQNLDLTAV  833

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E ++  N++  RKNGF    D  AP   R  L ++P SKN TFG  D++ELI +L+   
Sbjct  834  NETILIENLEIFRKNGFDFVIDEDAPVTQRVKLISLPTSKNWTFGPQDIEELIFMLS---  890

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  ++ P
Sbjct  891  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNLSEMKKLITHMGEIEHP  939

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  940  WNCPHGRPTMRHIANLDMISQ  960



>ref|XP_011513729.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X1 [Homo 
sapiens]
Length=877

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  690  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  749

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  750  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  806

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  807  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  855

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  856  WNCPHGRPTMRHIANLGVISQ  876



>gb|KFW73933.1| Mismatch repair endonuclease PMS2, partial [Phalacrocorax carbo]
Length=874

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  689  KMEIIGQFNLGFIITKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQRLIVPQTLNLTAV  748

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  749  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  805

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  806  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  854

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  855  WNCPHGRPTMRHIVSL  870



>ref|XP_006715805.1| PREDICTED: mismatch repair endonuclease PMS2 isoform X2 [Homo 
sapiens]
Length=860

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ D+FIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  673  EMEIIGQFNLGFIITKLNEDIFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  732

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  DV ELI +L+   
Sbjct  733  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDVDELIFMLS---  789

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  790  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  838

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  839  WNCPHGRPTMRHIANLGVISQ  859



>sp|P54279.1|PMS2_MOUSE RecName: Full=Mismatch repair endonuclease PMS2; AltName: Full=DNA 
mismatch repair protein PMS2; AltName: Full=PMS1 protein 
homolog 2 [Mus musculus]
 gb|AAA87031.1| PMS2 [Mus musculus]
Length=859

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFI+ KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  672  EMEILGQFNLGFIVTKLKEDLFLVDQHAADEKYNFEMLQQHTVLQAQRLITPQTLNLTAV  731

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  732  NEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  788

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  789  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNASEMKKLITHMGEMDHP  837

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  838  WNCPHGRPTMRHVANLDVISQ  858



>ref|XP_005182742.1| PREDICTED: mismatch repair endonuclease PMS2 [Musca domestica]
 ref|XP_011292178.1| PREDICTED: mismatch repair endonuclease PMS2 [Musca domestica]
Length=897

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 14/195 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KLD DLFI+DQHA DEKYN+E L E+T L+ QPL     ++L+  
Sbjct  696  RMEILGQFNLGFIITKLDTDLFIIDQHATDEKYNFETLQETTQLHHQPLAVAQTLELTAV  755

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E+V+  ++    KNGF  E +  APP  +  L   PFSKN  FG  D+ ELI +L  + 
Sbjct  756  NEMVLIDHLPMFEKNGFKFEINYDAPPTKKVRLLGKPFSKNWEFGKDDIDELIFMLQDAP  815

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
            E              ++C P R+RAM ASRACR SVMIG  L ++ M+ ++ H+  ++ P
Sbjct  816  E-------------GTMCRPSRIRAMFASRACRKSVMIGTSLKKSTMEMLVRHMGEIEQP  862

Query  540  WNCPHGRPTMRHLID  584
            WNCPHGRPTMRHLI+
Sbjct  863  WNCPHGRPTMRHLIN  877



>gb|KFO06164.1| Mismatch repair endonuclease PMS2, partial [Balearica regulorum 
gibbericeps]
Length=873

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  688  KMEIIGQFNLGFIIVKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIAPQNLNLTAV  747

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  748  NETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  804

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  805  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLVTHMGEIEHP  853

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  854  WNCPHGRPTMRHIVSL  869



>gb|KFZ46917.1| Mismatch repair endonuclease PMS2, partial [Caprimulgus carolinensis]
Length=876

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M++IGQF+LGFII KL+ DLFI+DQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  691  KMEIIGQFNLGFIIAKLNSDLFIIDQHATDEKYNFEMLQQHTVLQGQKLIVPQSLNLTAV  750

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    + +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  751  SETVLIENLEIFRKNGFDFVINENAPVTQRVKLISLPTSKNWTFGPQDIDELIFMLS---  807

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D    +C P RVR M ASRACR SVMIG  L   EM+K++ H+  ++ P
Sbjct  808  -----------DCPGVMCRPSRVRQMFASRACRKSVMIGTALNVQEMRKLITHMGEIEHP  856

Query  540  WNCPHGRPTMRHLIDL  587
            WNCPHGRPTMRH++ L
Sbjct  857  WNCPHGRPTMRHIVCL  872



>ref|XP_009197158.1| PREDICTED: mismatch repair endonuclease PMS2 [Papio anubis]
Length=894

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 129/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL+ DLFIVDQHA DEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  707  EMEIVGQFNLGFIITKLNEDLFIVDQHATDEKYNFEMLQQHTVLQGQRLIAPQTLNLTAV  766

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D +AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  767  NEAVLIENLEIFRKNGFDFVIDENAPVTERAKLISLPTSKNWTFGPQDIDELIFLLS---  823

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RV+ M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  824  -----------DSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  872

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  873  WNCPHGRPTMRHIANLGVISQ  893



>ref|XP_004080263.1| PREDICTED: mismatch repair endonuclease PMS2 [Oryzias latipes]
Length=828

 Score =   190 bits (483),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 130/201 (65%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +MK+IGQF+LGFII KL+ D+FI+DQHA DEKYN+E L + T+L  Q L+ P K+ L+  
Sbjct  641  EMKIIGQFNLGFIITKLNSDIFIIDQHATDEKYNFEMLQQHTLLQGQKLIAPQKLHLTAI  700

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  A    R  L ++P SKN TFG AD++ELI +L+   
Sbjct  701  SENVLMENIEVFRKNGFEFLIDEDAQVMERVRLVSLPTSKNWTFGPADIEELIFMLS---  757

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  ++ P
Sbjct  758  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALSVSEMKKLVVHMGEIEHP  806

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRHL +L  + +
Sbjct  807  WNCPHGRPTMRHLANLDIISQ  827



>ref|XP_005079993.1| PREDICTED: LOW QUALITY PROTEIN: mismatch repair endonuclease 
PMS2 [Mesocricetus auratus]
Length=849

 Score =   191 bits (484),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = +3

Query  3    QMKVIGQFHLGFIIGKLDRDLFIVDQHAADEKYNYERLSESTILNQQPLLRPLKMDLSPE  182
            +M+++GQF+LGFII KL  DLF+VDQHAADEKYN+E L + T+L  Q L+ P  ++L+  
Sbjct  662  EMEILGQFNLGFIITKLKEDLFLVDQHAADEKYNFEMLQQHTVLQVQRLITPQTLNLTAV  721

Query  183  EEIVVSMNMDTIRKNGFSLEEDLHAPPGLRFNLKAVPFSKNITFGVADVKELISILASSQ  362
             E V+  N++  RKNGF    D  AP   R  L ++P SKN TFG  D+ ELI +L+   
Sbjct  722  NEAVLIENLEIFRKNGFDFVIDEDAPVTERAKLISLPTSKNWTFGPQDIDELIFMLS---  778

Query  363  EDCHITLSYRKDTSDSIC-PPRVRAMLASRACRSSVMIGDPLGRNEMQKILEHLAHLKSP  539
                       D+   +C P RVR M ASRACR SVMIG  L  +EM+K++ H+  +  P
Sbjct  779  -----------DSPGVMCRPSRVRQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHP  827

Query  540  WNCPHGRPTMRHLIDLTTVHK  602
            WNCPHGRPTMRH+ +L  + +
Sbjct  828  WNCPHGRPTMRHIANLDVISQ  848



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2254929346230