BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8578

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP20930.1|  unnamed protein product                              96.3    3e-19   Coffea canephora [robusta coffee]
ref|XP_009799697.1|  PREDICTED: uncharacterized protein LOC104245737  90.1    9e-18   Nicotiana sylvestris
emb|CDP14239.1|  unnamed protein product                              92.0    1e-17   Coffea canephora [robusta coffee]
ref|XP_009764067.1|  PREDICTED: uncharacterized protein LOC104215844  87.8    9e-17   Nicotiana sylvestris
ref|XP_009766744.1|  PREDICTED: uncharacterized protein LOC104218041  83.2    1e-15   Nicotiana sylvestris
ref|XP_009621358.1|  PREDICTED: uncharacterized protein LOC104112999  83.6    1e-15   Nicotiana tomentosiformis
ref|XP_010326232.1|  PREDICTED: uncharacterized protein LOC104649186  84.3    6e-15   
ref|XP_010319987.1|  PREDICTED: uncharacterized protein LOC104647107  84.7    8e-15   
ref|XP_009760564.1|  PREDICTED: uncharacterized protein LOC104212897  80.5    1e-14   Nicotiana sylvestris
ref|XP_009768438.1|  PREDICTED: myb-like protein D                    80.9    2e-14   Nicotiana sylvestris
ref|XP_009765415.1|  PREDICTED: uncharacterized protein LOC104216966  81.3    3e-14   Nicotiana sylvestris
gb|KDP31715.1|  hypothetical protein JCGZ_14928                       78.2    4e-14   Jatropha curcas
ref|XP_010324834.1|  PREDICTED: uncharacterized protein LOC104648709  79.3    8e-14   
ref|XP_009765570.1|  PREDICTED: uncharacterized protein LOC104217118  77.8    2e-13   Nicotiana sylvestris
ref|XP_012068458.1|  PREDICTED: uncharacterized protein LOC105631070  76.6    4e-13   Jatropha curcas
ref|XP_012081344.1|  PREDICTED: uncharacterized protein LOC105641421  75.1    6e-13   Jatropha curcas
ref|XP_009766116.1|  PREDICTED: uncharacterized protein LOC104217535  76.3    6e-13   Nicotiana sylvestris
ref|XP_009794929.1|  PREDICTED: uncharacterized protein LOC104241685  75.1    7e-13   Nicotiana sylvestris
ref|XP_007010391.1|  Uncharacterized protein TCM_044158               77.8    1e-12   
ref|XP_007031319.1|  Uncharacterized protein TCM_016772               77.4    1e-12   
ref|XP_007032187.1|  Uncharacterized protein TCM_017591               76.3    2e-12   
ref|XP_012065816.1|  PREDICTED: uncharacterized protein LOC105628933  75.5    2e-12   Jatropha curcas
ref|XP_009613478.1|  PREDICTED: uncharacterized protein LOC104106604  72.4    3e-12   Nicotiana tomentosiformis
ref|XP_009801081.1|  PREDICTED: uncharacterized protein LOC104246885  72.8    3e-12   Nicotiana sylvestris
ref|XP_007023857.1|  Uncharacterized protein TCM_028230               75.9    4e-12   
ref|XP_010275342.1|  PREDICTED: uncharacterized protein LOC104610424  73.2    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009788948.1|  PREDICTED: uncharacterized protein LOC104236667  73.9    1e-11   Nicotiana sylvestris
ref|XP_009758915.1|  PREDICTED: uncharacterized protein LOC104211...  73.6    1e-11   Nicotiana sylvestris
ref|XP_007022011.1|  Uncharacterized protein TCM_032141               72.8    1e-11   
ref|XP_007017130.1|  Uncharacterized protein TCM_042329               74.3    2e-11   
ref|XP_007026454.1|  Uncharacterized protein TCM_030494               73.6    2e-11   
ref|XP_007013807.1|  Uncharacterized protein TCM_038365               73.2    2e-11   
ref|XP_009600554.1|  PREDICTED: uncharacterized protein LOC104095990  70.1    2e-11   Nicotiana tomentosiformis
ref|XP_007010246.1|  Uncharacterized protein TCM_043721               72.4    3e-11   
ref|XP_007040951.1|  Uncharacterized protein TCM_016760               72.8    4e-11   
ref|XP_007026457.1|  Uncharacterized protein TCM_021521               71.6    9e-11   
ref|XP_007031317.1|  Uncharacterized protein TCM_016768               69.7    2e-10   
gb|KHN25996.1|  hypothetical protein glysoja_046925                   66.2    3e-10   Glycine soja [wild soybean]
ref|XP_007040952.1|  Uncharacterized protein TCM_005954               70.1    3e-10   
ref|XP_007044276.1|  Uncharacterized protein TCM_009619               67.0    5e-10   
ref|XP_009610625.1|  PREDICTED: uncharacterized protein LOC104104285  67.8    6e-10   Nicotiana tomentosiformis
ref|XP_006361065.1|  PREDICTED: putative NPIP-like protein LOC613...  68.6    7e-10   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737               68.9    7e-10   
ref|XP_009777335.1|  PREDICTED: stress response protein NST1-like     66.6    8e-10   Nicotiana sylvestris
ref|XP_007046404.1|  Uncharacterized protein TCM_011923               68.9    8e-10   
ref|XP_007026455.1|  Uncharacterized protein TCM_021519               67.8    1e-09   
ref|XP_007040947.1|  Uncharacterized protein TCM_016754               67.8    2e-09   
ref|XP_007031313.1|  Uncharacterized protein TCM_016763               67.8    2e-09   
ref|XP_007026458.1|  Uncharacterized protein TCM_021522               67.8    2e-09   
ref|XP_008780422.1|  PREDICTED: uncharacterized protein LOC103700244  66.6    2e-09   Phoenix dactylifera
ref|XP_009799814.1|  PREDICTED: uncharacterized protein LOC104245...  67.0    2e-09   Nicotiana sylvestris
ref|XP_009768291.1|  PREDICTED: uncharacterized protein LOC104219326  65.5    2e-09   Nicotiana sylvestris
ref|XP_010326471.1|  PREDICTED: uncharacterized protein LOC104649283  67.0    3e-09   
ref|XP_007045383.1|  Uncharacterized protein TCM_011161               63.5    3e-09   
ref|XP_009799813.1|  PREDICTED: uncharacterized protein LOC104245...  66.6    3e-09   Nicotiana sylvestris
ref|XP_007022832.1|  Uncharacterized protein TCM_026877               66.6    4e-09   
ref|XP_010687516.1|  PREDICTED: uncharacterized protein LOC104901625  64.3    4e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010272338.1|  PREDICTED: uncharacterized protein LOC104608143  65.5    5e-09   Nelumbo nucifera [Indian lotus]
ref|XP_007031312.1|  Uncharacterized protein TCM_016762               66.2    5e-09   
gb|KHN17248.1|  hypothetical protein glysoja_010707                   65.9    6e-09   Glycine soja [wild soybean]
ref|XP_007017131.1|  Uncharacterized protein TCM_033752               65.9    7e-09   
gb|KHN21001.1|  hypothetical protein glysoja_009309                   65.5    7e-09   Glycine soja [wild soybean]
ref|XP_010695085.1|  PREDICTED: uncharacterized protein LOC104907793  65.1    7e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670298.1|  PREDICTED: uncharacterized protein LOC104887379  65.5    7e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690660.1|  PREDICTED: uncharacterized protein LOC104904165  65.1    9e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007046403.1|  Uncharacterized protein TCM_011922               65.5    9e-09   
ref|XP_009765551.1|  PREDICTED: uncharacterized protein LOC104217093  65.1    1e-08   Nicotiana sylvestris
ref|XP_010263702.1|  PREDICTED: uncharacterized protein LOC104601894  64.7    1e-08   
ref|XP_009758922.1|  PREDICTED: uncharacterized protein LOC104211...  64.3    1e-08   Nicotiana sylvestris
ref|XP_008799663.1|  PREDICTED: uncharacterized protein LOC103714254  64.7    1e-08   Phoenix dactylifera
ref|XP_011092915.1|  PREDICTED: uncharacterized protein LOC105172985  64.7    1e-08   
ref|XP_007037791.1|  Uncharacterized protein TCM_014510               64.7    1e-08   
ref|XP_008806373.1|  PREDICTED: uncharacterized protein LOC103719081  64.7    2e-08   Phoenix dactylifera
gb|KJB67209.1|  hypothetical protein B456_010G180600                  62.8    2e-08   Gossypium raimondii
gb|KHN07236.1|  hypothetical protein glysoja_045025                   62.4    2e-08   Glycine soja [wild soybean]
ref|XP_008795223.1|  PREDICTED: uncharacterized protein LOC103711032  63.5    2e-08   Phoenix dactylifera
ref|XP_006596845.1|  PREDICTED: uncharacterized protein At4g02000...  64.3    2e-08   Glycine max [soybeans]
ref|XP_008777413.1|  PREDICTED: uncharacterized protein LOC103697350  63.9    2e-08   Phoenix dactylifera
emb|CCA65996.1|  hypothetical protein                                 63.9    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007010894.1|  Uncharacterized protein TCM_044962               63.5    3e-08   
gb|KHN33899.1|  hypothetical protein glysoja_031761                   61.6    3e-08   Glycine soja [wild soybean]
ref|XP_010682918.1|  PREDICTED: uncharacterized protein LOC104897680  63.5    3e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003604996.1|  hypothetical protein MTR_4g022640                63.5    4e-08   
ref|XP_006374361.1|  hypothetical protein POPTR_0015s06420g           63.2    4e-08   
ref|XP_006387777.1|  hypothetical protein POPTR_0590s00210g           63.2    4e-08   
ref|XP_003592213.1|  hypothetical protein MTR_1g100160                63.2    5e-08   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085  63.2    6e-08   
ref|XP_007050032.1|  Uncharacterized protein TCM_003626               60.1    6e-08   
gb|KDO47636.1|  hypothetical protein CISIN_1g041417mg                 62.4    6e-08   Citrus sinensis [apfelsine]
ref|XP_003630108.1|  hypothetical protein MTR_8g091870                62.4    7e-08   
ref|XP_008780119.1|  PREDICTED: uncharacterized protein LOC103699903  62.0    8e-08   Phoenix dactylifera
ref|XP_003592894.1|  hypothetical protein MTR_2g005460                62.4    8e-08   
ref|XP_009601640.1|  PREDICTED: uncharacterized protein LOC104096893  59.7    8e-08   Nicotiana tomentosiformis
ref|XP_007013771.1|  Uncharacterized protein TCM_038318               60.5    9e-08   
ref|XP_007022378.1|  Uncharacterized protein TCM_032655               60.5    9e-08   
ref|XP_003593078.1|  hypothetical protein MTR_2g007560                62.0    1e-07   
ref|XP_009785329.1|  PREDICTED: uncharacterized protein LOC104233603  62.0    1e-07   Nicotiana sylvestris
ref|XP_010687419.1|  PREDICTED: uncharacterized protein LOC104901529  61.6    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011083357.1|  PREDICTED: uncharacterized protein At4g02000...  58.9    1e-07   Sesamum indicum [beniseed]
ref|XP_007037027.1|  Uncharacterized protein TCM_013236               59.3    1e-07   
ref|XP_007008705.1|  Uncharacterized protein TCM_042331               62.0    1e-07   
ref|XP_009777941.1|  PREDICTED: uncharacterized protein LOC104227398  59.3    2e-07   Nicotiana sylvestris
ref|XP_006580860.1|  PREDICTED: uncharacterized protein LOC102664004  60.8    2e-07   Glycine max [soybeans]
ref|XP_009770480.1|  PREDICTED: uncharacterized protein LOC104221176  58.2    2e-07   Nicotiana sylvestris
ref|XP_006599769.1|  PREDICTED: uncharacterized protein LOC102668549  60.8    2e-07   Glycine max [soybeans]
ref|XP_010520311.1|  PREDICTED: uncharacterized protein LOC104799464  60.8    3e-07   Tarenaya hassleriana [spider flower]
gb|KDO58401.1|  hypothetical protein CISIN_1g046952mg                 60.5    3e-07   Citrus sinensis [apfelsine]
gb|KDO37843.1|  hypothetical protein CISIN_1g047084mg                 60.5    3e-07   Citrus sinensis [apfelsine]
gb|KDO60122.1|  hypothetical protein CISIN_1g045711mg                 60.5    3e-07   Citrus sinensis [apfelsine]
ref|XP_006605232.1|  PREDICTED: uncharacterized protein LOC102667279  60.1    3e-07   Glycine max [soybeans]
gb|KDO35980.1|  hypothetical protein CISIN_1g037800mg                 60.1    4e-07   Citrus sinensis [apfelsine]
ref|XP_006490301.1|  PREDICTED: uncharacterized protein LOC102612828  60.5    4e-07   
gb|KHN15915.1|  hypothetical protein glysoja_013131                   60.1    4e-07   Glycine soja [wild soybean]
ref|XP_007039835.1|  Uncharacterized protein TCM_015964               58.2    4e-07   
ref|XP_008795215.1|  PREDICTED: uncharacterized protein LOC103711023  59.3    5e-07   Phoenix dactylifera
gb|KDO54331.1|  hypothetical protein CISIN_1g037263mg                 57.4    5e-07   Citrus sinensis [apfelsine]
ref|XP_008782044.1|  PREDICTED: uncharacterized protein LOC103701669  58.5    6e-07   Phoenix dactylifera
ref|XP_009800930.1|  PREDICTED: probable basic-leucine zipper tra...  59.7    7e-07   Nicotiana sylvestris
ref|XP_009779392.1|  PREDICTED: uncharacterized protein LOC104228608  58.5    7e-07   Nicotiana sylvestris
gb|KDO38897.1|  hypothetical protein CISIN_1g046520mg                 59.3    7e-07   Citrus sinensis [apfelsine]
ref|XP_006577696.1|  PREDICTED: uncharacterized protein LOC102664242  59.3    8e-07   Glycine max [soybeans]
ref|XP_006375693.1|  hypothetical protein POPTR_0014s19700g           58.9    9e-07   
ref|XP_006595286.1|  PREDICTED: uncharacterized protein LOC102660169  57.8    9e-07   
gb|AAT38805.1|  hypothetical protein SDM1_47t00008                    59.3    1e-06   Solanum demissum
ref|XP_010689623.1|  PREDICTED: uncharacterized protein LOC104903305  58.5    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009793772.1|  PREDICTED: uncharacterized protein LOC104240602  58.5    1e-06   Nicotiana sylvestris
ref|XP_010689805.1|  PREDICTED: uncharacterized protein LOC104903466  58.5    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011101715.1|  PREDICTED: uncharacterized protein LOC105179777  57.4    1e-06   Sesamum indicum [beniseed]
ref|XP_008778888.1|  PREDICTED: uncharacterized protein LOC103698628  57.0    1e-06   Phoenix dactylifera
ref|XP_006376764.1|  hypothetical protein POPTR_0012s06220g           58.2    1e-06   
ref|XP_010677868.1|  PREDICTED: uncharacterized protein LOC104893461  58.5    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009783588.1|  PREDICTED: uncharacterized protein LOC104232162  58.2    2e-06   Nicotiana sylvestris
ref|XP_009600598.1|  PREDICTED: uncharacterized protein LOC104096022  57.0    2e-06   Nicotiana tomentosiformis
ref|XP_009610911.1|  PREDICTED: uncharacterized protein LOC104104509  56.2    2e-06   
ref|XP_003604531.1|  hypothetical protein MTR_4g014190                58.2    2e-06   
ref|XP_010686465.1|  PREDICTED: uncharacterized protein LOC104900672  58.2    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010686029.1|  PREDICTED: uncharacterized protein LOC104900325  57.8    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006598642.1|  PREDICTED: uncharacterized protein LOC102666350  58.2    2e-06   Glycine max [soybeans]
ref|XP_008805281.1|  PREDICTED: uncharacterized protein LOC103718305  58.2    2e-06   Phoenix dactylifera
gb|KDO59838.1|  hypothetical protein CISIN_1g037799mg                 55.5    2e-06   Citrus sinensis [apfelsine]
ref|XP_010681834.1|  PREDICTED: uncharacterized protein LOC104896742  57.8    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011071645.1|  PREDICTED: uncharacterized protein LOC105157045  58.2    2e-06   Sesamum indicum [beniseed]
gb|KHN26207.1|  hypothetical protein glysoja_035500                   58.2    2e-06   Glycine soja [wild soybean]
ref|XP_003625646.1|  hypothetical protein MTR_7g101400                58.2    2e-06   
gb|KDO39120.1|  hypothetical protein CISIN_1g048696mg                 57.0    2e-06   Citrus sinensis [apfelsine]
ref|XP_009784900.1|  PREDICTED: uncharacterized protein LOC104233234  57.8    2e-06   Nicotiana sylvestris
ref|XP_006589932.1|  PREDICTED: uncharacterized protein LOC102669251  57.0    2e-06   Glycine max [soybeans]
ref|XP_010694057.1|  PREDICTED: uncharacterized protein LOC104906925  57.8    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007019767.1|  Uncharacterized protein TCM_036083               55.5    3e-06   
gb|KHN42237.1|  hypothetical protein glysoja_044118                   56.6    3e-06   Glycine soja [wild soybean]
ref|XP_003609254.1|  hypothetical protein MTR_4g113700                57.8    3e-06   
ref|XP_009759323.1|  PREDICTED: uncharacterized protein LOC104211883  56.2    3e-06   Nicotiana sylvestris
gb|KDO39032.1|  hypothetical protein CISIN_1g043150mg                 57.8    3e-06   Citrus sinensis [apfelsine]
ref|XP_008800940.1|  PREDICTED: uncharacterized protein LOC103715176  57.0    3e-06   Phoenix dactylifera
ref|XP_007052625.1|  Uncharacterized protein TCM_005953               57.8    4e-06   
ref|XP_008800194.1|  PREDICTED: uncharacterized protein LOC103714647  57.8    4e-06   
ref|XP_003599472.1|  Defensin-like protein                            56.6    4e-06   
ref|XP_006378895.1|  hypothetical protein POPTR_0009s00290g           56.2    4e-06   
ref|XP_003606538.1|  hypothetical protein MTR_4g061520                57.0    4e-06   
gb|KDO36602.1|  hypothetical protein CISIN_1g037725mg                 56.6    4e-06   Citrus sinensis [apfelsine]
ref|XP_009604860.1|  PREDICTED: uncharacterized protein LOC104099538  57.0    4e-06   Nicotiana tomentosiformis
ref|XP_011094921.1|  PREDICTED: uncharacterized protein LOC105174492  55.1    4e-06   Sesamum indicum [beniseed]
ref|XP_006382571.1|  hypothetical protein POPTR_0005s034102g          57.0    4e-06   
ref|XP_010695579.1|  PREDICTED: uncharacterized protein LOC104908189  57.0    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009801511.1|  PREDICTED: uncharacterized protein LOC104247246  56.6    5e-06   Nicotiana sylvestris
gb|KDO70278.1|  hypothetical protein CISIN_1g046866mg                 57.0    5e-06   Citrus sinensis [apfelsine]
ref|XP_008780476.1|  PREDICTED: uncharacterized protein LOC103700307  56.6    5e-06   Phoenix dactylifera
ref|XP_009783436.1|  PREDICTED: uncharacterized protein LOC104232043  56.6    5e-06   Nicotiana sylvestris
ref|XP_008782095.1|  PREDICTED: uncharacterized protein At4g02000...  56.2    5e-06   Phoenix dactylifera
ref|XP_011016272.1|  PREDICTED: uncharacterized protein LOC105119785  57.4    5e-06   Populus euphratica
ref|XP_011004665.1|  PREDICTED: uncharacterized protein LOC105111104  57.4    5e-06   Populus euphratica
ref|XP_010693202.1|  PREDICTED: uncharacterized protein LOC104906181  55.8    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008782110.1|  PREDICTED: uncharacterized protein LOC103701725  56.6    6e-06   Phoenix dactylifera
ref|XP_010666802.1|  PREDICTED: uncharacterized protein LOC104883924  55.1    6e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009802092.1|  PREDICTED: uncharacterized protein At4g02000...  55.5    6e-06   Nicotiana sylvestris
ref|XP_007014777.1|  Uncharacterized protein TCM_040289               56.2    7e-06   
ref|XP_010667274.1|  PREDICTED: uncharacterized protein LOC104884335  55.5    7e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010463327.1|  PREDICTED: uncharacterized protein LOC104743994  56.6    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006369230.1|  hypothetical protein POPTR_0001s19740g           56.6    8e-06   
emb|CDY62005.1|  BnaCnng38950D                                        56.2    8e-06   Brassica napus [oilseed rape]
ref|XP_006374505.1|  hypothetical protein POPTR_0015s08050g           56.2    8e-06   
ref|XP_006591625.1|  PREDICTED: uncharacterized protein LOC102667520  56.2    9e-06   Glycine max [soybeans]
emb|CCA65978.1|  hypothetical protein                                 56.2    9e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006380103.1|  hypothetical protein POPTR_0008s21940g           56.2    9e-06   
ref|XP_007208970.1|  hypothetical protein PRUPE_ppb020897mg           56.2    1e-05   
ref|XP_006376160.1|  hypothetical protein POPTR_0013s10355g           56.2    1e-05   
ref|XP_008779956.1|  PREDICTED: uncharacterized protein LOC103699731  56.2    1e-05   
ref|XP_008780080.1|  PREDICTED: uncharacterized protein LOC103699861  55.5    1e-05   Phoenix dactylifera
ref|XP_006576082.1|  PREDICTED: uncharacterized protein LOC102659506  56.2    1e-05   Glycine max [soybeans]
ref|XP_010667206.1|  PREDICTED: uncharacterized protein LOC104884282  54.7    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009139876.1|  PREDICTED: uncharacterized protein LOC103863864  55.8    1e-05   Brassica rapa
ref|XP_009621007.1|  PREDICTED: uncharacterized protein LOC104112...  55.8    1e-05   
ref|XP_010674912.1|  PREDICTED: uncharacterized protein LOC104890982  55.8    1e-05   
ref|XP_006375670.1|  hypothetical protein POPTR_0014s19150g           55.1    1e-05   
ref|XP_006279197.1|  hypothetical protein CARUB_v10016517mg           55.8    1e-05   
gb|KDO50386.1|  hypothetical protein CISIN_1g046148mg                 55.1    1e-05   Citrus sinensis [apfelsine]
ref|XP_009586783.1|  PREDICTED: uncharacterized protein LOC104084588  55.1    1e-05   
ref|XP_009762889.1|  PREDICTED: uncharacterized protein LOC104214865  55.5    1e-05   Nicotiana sylvestris
ref|XP_007019346.1|  Uncharacterized protein TCM_035367               55.5    1e-05   
ref|XP_006428819.1|  hypothetical protein CICLE_v10013460mg           55.5    2e-05   
ref|XP_006375696.1|  hypothetical protein POPTR_0014s19730g           55.5    2e-05   
ref|XP_006380152.1|  hypothetical protein POPTR_0008s22400g           55.1    2e-05   
ref|XP_010034731.1|  PREDICTED: uncharacterized protein LOC104424031  55.1    2e-05   
ref|XP_008778450.1|  PREDICTED: uncharacterized protein LOC103698238  55.1    2e-05   Phoenix dactylifera
ref|XP_006380098.1|  hypothetical protein POPTR_0008s218701g          54.3    2e-05   
ref|XP_007042412.1|  Uncharacterized protein TCM_007050               55.1    2e-05   
gb|ABN08700.1|  Endonuclease/exonuclease/phosphatase                  55.5    2e-05   Medicago truncatula
ref|XP_009622058.1|  PREDICTED: uncharacterized protein LOC104113559  55.1    2e-05   Nicotiana tomentosiformis
ref|XP_009796298.1|  PREDICTED: uncharacterized protein LOC104242883  55.5    2e-05   Nicotiana sylvestris
ref|XP_010668455.1|  PREDICTED: uncharacterized protein LOC104885464  55.1    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012084349.1|  PREDICTED: uncharacterized protein LOC105643761  53.9    2e-05   Jatropha curcas
ref|XP_011075643.1|  PREDICTED: uncharacterized protein LOC105160077  55.1    2e-05   Sesamum indicum [beniseed]
ref|XP_006603418.1|  PREDICTED: uncharacterized protein LOC102664224  54.3    2e-05   Glycine max [soybeans]
ref|XP_011069433.1|  PREDICTED: uncharacterized protein LOC105155259  54.7    2e-05   Sesamum indicum [beniseed]
ref|XP_006377607.1|  hypothetical protein POPTR_0011s08300g           53.5    2e-05   
ref|XP_003589692.1|  hypothetical protein MTR_1g035150                55.1    2e-05   
ref|XP_002298564.2|  hypothetical protein POPTR_0001s35780g           54.7    2e-05   
gb|KDO40369.1|  hypothetical protein CISIN_1g048241mg                 54.7    2e-05   Citrus sinensis [apfelsine]
ref|XP_008779623.1|  PREDICTED: uncharacterized protein LOC103699378  54.7    3e-05   Phoenix dactylifera
ref|XP_006595367.1|  PREDICTED: uncharacterized protein LOC102665188  53.5    3e-05   Glycine max [soybeans]
ref|XP_011075252.1|  PREDICTED: uncharacterized protein LOC105159763  54.7    3e-05   
ref|XP_003627837.1|  NBS resistance protein                           55.1    3e-05   
ref|XP_008779654.1|  PREDICTED: uncharacterized protein LOC103699413  54.3    3e-05   Phoenix dactylifera
ref|XP_006285413.1|  hypothetical protein CARUB_v10006824mg           54.7    3e-05   
ref|XP_007044224.1|  Uncharacterized protein TCM_009467               54.7    3e-05   
ref|XP_009765697.1|  PREDICTED: uncharacterized protein LOC104217212  54.7    3e-05   Nicotiana sylvestris
ref|XP_006378905.1|  hypothetical protein POPTR_0009s00440g           54.3    3e-05   
ref|XP_010684435.1|  PREDICTED: uncharacterized protein LOC104898994  53.9    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006378911.1|  hypothetical protein POPTR_0009s005102g          53.5    3e-05   
ref|XP_009590293.1|  PREDICTED: uncharacterized protein LOC104087503  54.3    4e-05   Nicotiana tomentosiformis
ref|XP_008796020.1|  PREDICTED: uncharacterized protein LOC103711587  54.3    4e-05   Phoenix dactylifera
ref|XP_010313013.1|  PREDICTED: uncharacterized protein LOC104644633  53.5    4e-05   
gb|KHN04954.1|  hypothetical protein glysoja_013861                   53.5    4e-05   Glycine soja [wild soybean]
ref|XP_010687396.1|  PREDICTED: uncharacterized protein LOC104901505  53.9    4e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009785180.1|  PREDICTED: uncharacterized protein LOC104233...  53.9    4e-05   Nicotiana sylvestris
ref|XP_009770244.1|  PREDICTED: uncharacterized protein LOC104220969  53.9    4e-05   Nicotiana sylvestris
ref|XP_008783980.1|  PREDICTED: uncharacterized protein LOC103703060  52.8    5e-05   Phoenix dactylifera
gb|KFK32715.1|  hypothetical protein AALP_AA6G279100                  54.3    5e-05   Arabis alpina [alpine rockcress]
ref|XP_009767582.1|  PREDICTED: uncharacterized protein LOC104218716  53.5    5e-05   Nicotiana sylvestris
ref|XP_010689853.1|  PREDICTED: uncharacterized protein LOC104903510  53.1    5e-05   
ref|XP_009790478.1|  PREDICTED: uncharacterized protein LOC104237...  53.9    5e-05   Nicotiana sylvestris
ref|XP_003613513.1|  hypothetical protein MTR_5g037520                53.9    5e-05   
ref|XP_006381942.1|  hypothetical protein POPTR_0006s21930g           53.5    5e-05   
ref|XP_006286623.1|  hypothetical protein CARUB_v10002432mg           53.9    6e-05   
ref|XP_010315567.1|  PREDICTED: uncharacterized protein LOC104645510  53.9    6e-05   
dbj|BAE79381.1|  unnamed protein product                              53.9    6e-05   Ipomoea batatas [batate]
ref|XP_003631099.1|  hypothetical protein MTR_8g107120                53.9    6e-05   
gb|KDO39313.1|  hypothetical protein CISIN_1g037277mg                 52.4    6e-05   Citrus sinensis [apfelsine]
ref|XP_010685587.1|  PREDICTED: uncharacterized protein LOC104899978  53.5    6e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011014909.1|  PREDICTED: uncharacterized protein LOC105118...  53.1    6e-05   Populus euphratica
ref|XP_006381206.1|  hypothetical protein POPTR_0006s08910g           53.1    6e-05   
gb|KDO38231.1|  hypothetical protein CISIN_1g041269mg                 53.9    6e-05   Citrus sinensis [apfelsine]
ref|XP_008811730.1|  PREDICTED: uncharacterized protein LOC103722817  53.1    7e-05   Phoenix dactylifera
ref|XP_006603354.1|  PREDICTED: uncharacterized protein LOC102667571  51.2    7e-05   Glycine max [soybeans]
dbj|BAE79383.1|  unnamed protein product                              53.5    7e-05   Ipomoea batatas [batate]
ref|XP_010678903.1|  PREDICTED: uncharacterized protein LOC104894379  53.1    7e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009600331.1|  PREDICTED: uncharacterized protein DDB_G0283...  53.1    7e-05   Nicotiana tomentosiformis
ref|XP_009786979.1|  PREDICTED: uncharacterized protein LOC104235009  53.5    7e-05   Nicotiana sylvestris
ref|XP_010682307.1|  PREDICTED: uncharacterized protein LOC104897180  53.1    8e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008804803.1|  PREDICTED: uncharacterized protein LOC103717984  53.1    8e-05   Phoenix dactylifera
ref|XP_008807968.1|  PREDICTED: uncharacterized protein LOC103720159  53.1    8e-05   Phoenix dactylifera
ref|XP_010693748.1|  PREDICTED: uncharacterized protein LOC104906660  53.1    8e-05   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY56060.1|  BnaCnng29790D                                        53.1    8e-05   Brassica napus [oilseed rape]
ref|XP_010677503.1|  PREDICTED: uncharacterized protein LOC104893120  53.1    8e-05   
gb|KFK40721.1|  hypothetical protein AALP_AA2G032300                  53.1    8e-05   Arabis alpina [alpine rockcress]
ref|XP_010693979.1|  PREDICTED: uncharacterized protein LOC104906849  53.1    8e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006378903.1|  hypothetical protein POPTR_0009s00420g           53.1    8e-05   
ref|XP_007208943.1|  hypothetical protein PRUPE_ppb015526mg           53.5    9e-05   
ref|XP_010534642.1|  PREDICTED: uncharacterized protein LOC104810140  53.1    9e-05   Tarenaya hassleriana [spider flower]
ref|XP_006378920.1|  hypothetical protein POPTR_0009s00580g           53.1    9e-05   
ref|XP_009618988.1|  PREDICTED: glutamic acid-rich protein-like       52.4    1e-04   
ref|XP_006371222.1|  hypothetical protein POPTR_0019s06260g           52.4    1e-04   
ref|XP_009758696.1|  PREDICTED: uncharacterized protein LOC104211352  52.8    1e-04   Nicotiana sylvestris
ref|XP_006296775.1|  hypothetical protein CARUB_v10015820mg           53.1    1e-04   
ref|XP_007023839.1|  Uncharacterized protein TCM_028132               52.4    1e-04   
ref|XP_006296651.1|  hypothetical protein CARUB_v10015577mg           53.1    1e-04   
ref|XP_008780092.1|  PREDICTED: uncharacterized protein LOC103699874  53.1    1e-04   Phoenix dactylifera
ref|XP_003589413.1|  hypothetical protein MTR_1g023970                53.1    1e-04   
ref|XP_008779513.1|  PREDICTED: uncharacterized protein LOC103699249  52.4    1e-04   Phoenix dactylifera
ref|XP_009766911.1|  PREDICTED: uncharacterized protein LOC104218...  53.1    1e-04   
ref|XP_009766914.1|  PREDICTED: uncharacterized protein LOC104218...  52.8    1e-04   
gb|AEL30359.1|  RNA-directed DNA polymerase                           53.1    1e-04   
ref|XP_009593244.1|  PREDICTED: uncharacterized protein LOC104089929  52.8    1e-04   
ref|XP_003620586.1|  hypothetical protein MTR_6g087240                52.8    1e-04   
ref|XP_006374351.1|  hypothetical protein POPTR_0015s06320g           52.8    1e-04   
ref|XP_009121380.1|  PREDICTED: uncharacterized protein LOC103846234  52.8    1e-04   
emb|CDY42220.1|  BnaA01g25750D                                        52.8    1e-04   
gb|KDO48120.1|  hypothetical protein CISIN_1g045413mg                 51.6    1e-04   
ref|XP_006301940.1|  hypothetical protein CARUB_v10022418mg           52.8    1e-04   
ref|XP_008780218.1|  PREDICTED: uncharacterized protein LOC103700017  52.4    1e-04   
ref|XP_006387324.1|  hypothetical protein POPTR_1250s00200g           52.8    1e-04   
gb|KEH22611.1|  DUF4283 domain protein                                52.4    1e-04   
ref|XP_008810124.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...  53.1    1e-04   
gb|KJB31058.1|  hypothetical protein B456_005G174000                  51.6    1e-04   
ref|XP_006378909.1|  hypothetical protein POPTR_0009s00490g           52.8    1e-04   
ref|XP_010314877.1|  PREDICTED: uncharacterized protein LOC104645238  52.4    1e-04   
ref|XP_010317681.1|  PREDICTED: uncharacterized protein LOC101254124  52.8    1e-04   
emb|CDY66297.1|  BnaAnng22080D                                        52.8    1e-04   
ref|XP_008780032.1|  PREDICTED: uncharacterized protein LOC103699804  52.4    1e-04   
emb|CDY28852.1|  BnaC06g26400D                                        52.4    1e-04   
ref|XP_010324142.1|  PREDICTED: uncharacterized protein LOC104648514  51.6    2e-04   
ref|XP_006372295.1|  hypothetical protein POPTR_0017s00301g           52.0    2e-04   
ref|XP_010694770.1|  PREDICTED: uncharacterized protein LOC104907528  52.0    2e-04   
ref|XP_007036697.1|  Uncharacterized protein TCM_012582               52.8    2e-04   
ref|XP_007162543.1|  hypothetical protein PHAVU_001G160900g           52.0    2e-04   
ref|XP_004243802.1|  PREDICTED: uncharacterized protein LOC101261248  52.4    2e-04   
gb|KDO40022.1|  hypothetical protein CISIN_1g048317mg                 50.1    2e-04   
ref|XP_008238489.1|  PREDICTED: uncharacterized protein LOC103337115  52.8    2e-04   
ref|XP_009612471.1|  PREDICTED: uncharacterized protein LOC104105787  52.0    2e-04   
ref|XP_010696567.1|  PREDICTED: uncharacterized protein LOC104909079  51.6    2e-04   
ref|XP_007023729.1|  Uncharacterized protein TCM_027856               52.4    2e-04   
ref|XP_009792300.1|  PREDICTED: uncharacterized protein LOC104239367  52.0    2e-04   
ref|XP_006388049.1|  hypothetical protein POPTR_0380s00210g           52.0    2e-04   
ref|XP_010314397.1|  PREDICTED: uncharacterized protein LOC104645079  52.4    2e-04   
ref|XP_008232499.1|  PREDICTED: uncharacterized protein LOC103331632  52.4    2e-04   
ref|XP_006372334.1|  hypothetical protein POPTR_0017s00650g           52.0    2e-04   
ref|XP_012070540.1|  PREDICTED: uncharacterized protein LOC105632710  51.6    2e-04   
ref|XP_006375666.1|  hypothetical protein POPTR_0014s19100g           52.0    2e-04   
ref|XP_003614149.1|  hypothetical protein MTR_5g045440                52.4    2e-04   
gb|KDO38287.1|  hypothetical protein CISIN_1g044376mg                 52.0    2e-04   
ref|XP_008788747.1|  PREDICTED: uncharacterized protein LOC103706430  52.4    2e-04   
ref|XP_009107815.1|  PREDICTED: uncharacterized protein LOC103833484  52.0    2e-04   
ref|XP_010481113.1|  PREDICTED: uncharacterized protein LOC104759949  51.6    2e-04   
ref|XP_006469095.1|  PREDICTED: uncharacterized protein LOC102629728  52.0    2e-04   
ref|XP_006372335.1|  hypothetical protein POPTR_0017s00660g           51.6    2e-04   
ref|XP_010668397.1|  PREDICTED: uncharacterized protein LOC104885398  50.4    2e-04   
ref|XP_009614260.1|  PREDICTED: uncharacterized protein LOC104107231  50.8    2e-04   
ref|XP_010666462.1|  PREDICTED: uncharacterized protein LOC104883615  51.6    2e-04   
ref|XP_003590362.1|  hypothetical protein MTR_1g059010                51.2    2e-04   
gb|AAD37019.2|  putative non-LTR retrolelement reverse transcriptase  52.0    2e-04   
ref|XP_007010283.1|  Uncharacterized protein TCM_043801               51.6    2e-04   
ref|XP_011101871.1|  PREDICTED: uncharacterized protein LOC105179909  52.0    3e-04   
ref|XP_009794040.1|  PREDICTED: uncharacterized protein LOC104240845  50.4    3e-04   
ref|XP_006301503.1|  hypothetical protein CARUB_v10021929mg           52.0    3e-04   
ref|XP_010681517.1|  PREDICTED: uncharacterized protein LOC104896467  51.6    3e-04   
ref|XP_008779478.1|  PREDICTED: uncharacterized protein LOC103699206  51.2    3e-04   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               52.0    3e-04   
ref|XP_010670315.1|  PREDICTED: uncharacterized protein LOC104887397  51.6    3e-04   
ref|XP_010666883.1|  PREDICTED: uncharacterized protein LOC104884000  52.0    3e-04   
ref|XP_011004563.1|  PREDICTED: uncharacterized protein LOC105111...  51.2    3e-04   
ref|XP_011457337.1|  PREDICTED: uncharacterized protein LOC105349398  51.6    3e-04   
gb|KHN42514.1|  hypothetical protein glysoja_031450                   51.6    3e-04   
ref|XP_009138593.1|  PREDICTED: uncharacterized protein LOC103862660  51.6    3e-04   
emb|CDY30362.1|  BnaA09g09150D                                        51.6    3e-04   
gb|KCW51546.1|  hypothetical protein EUGRSUZ_J01056                   50.8    3e-04   
ref|XP_006376733.1|  hypothetical protein POPTR_0012s04950g           51.2    3e-04   
gb|KDO46597.1|  hypothetical protein CISIN_1g041945mg                 51.2    3e-04   
ref|XP_009604425.1|  PREDICTED: uncharacterized protein LOC104099216  48.9    4e-04   
ref|XP_010682589.1|  PREDICTED: uncharacterized protein LOC104897413  51.2    4e-04   
ref|XP_006397098.1|  hypothetical protein EUTSA_v10029226mg           51.2    4e-04   
ref|XP_003628610.1|  Coronatine-insensitive 1-like protein            51.6    4e-04   
ref|XP_006295613.1|  hypothetical protein CARUB_v10024726mg           51.2    4e-04   
gb|KFK41288.1|  hypothetical protein AALP_AA2G110500                  51.2    4e-04   
ref|XP_008780208.1|  PREDICTED: uncharacterized protein LOC103700005  51.2    4e-04   
ref|XP_008780225.1|  PREDICTED: uncharacterized protein LOC103700022  51.2    4e-04   
ref|XP_011004561.1|  PREDICTED: uncharacterized protein LOC105111...  50.8    5e-04   
gb|KFK27190.1|  hypothetical protein AALP_AA8G347600                  51.2    5e-04   
ref|XP_010681272.1|  PREDICTED: uncharacterized protein LOC104896254  50.1    5e-04   
ref|XP_010064319.1|  PREDICTED: uncharacterized protein At4g02000...  50.1    5e-04   
gb|KCW80626.1|  hypothetical protein EUGRSUZ_C02001                   50.4    5e-04   
ref|XP_009612570.1|  PREDICTED: uncharacterized protein LOC104105862  50.4    5e-04   
emb|CDX98312.1|  BnaC06g16730D                                        50.1    5e-04   
ref|XP_006375665.1|  hypothetical protein POPTR_0014s19090g           50.8    5e-04   
ref|XP_009765500.1|  PREDICTED: uncharacterized protein LOC104217044  50.4    5e-04   
ref|XP_010692626.1|  PREDICTED: uncharacterized protein LOC104905715  51.2    5e-04   
ref|XP_010513494.1|  PREDICTED: uncharacterized protein LOC104789504  50.4    6e-04   
ref|XP_010682177.1|  PREDICTED: uncharacterized protein LOC104897068  50.8    6e-04   
ref|XP_006287598.1|  hypothetical protein CARUB_v10000810mg           50.8    6e-04   
ref|XP_009587269.1|  PREDICTED: uncharacterized protein LOC104085011  49.7    6e-04   
ref|XP_011013664.1|  PREDICTED: uncharacterized protein LOC105117...  50.1    6e-04   
gb|KJB60540.1|  hypothetical protein B456_009G311100                  48.5    7e-04   
ref|XP_003607073.1|  hypothetical protein MTR_4g071930                50.1    7e-04   
ref|XP_009804631.1|  PREDICTED: uncharacterized protein LOC104249830  49.7    7e-04   
ref|XP_010680847.1|  PREDICTED: uncharacterized protein LOC104895900  50.1    7e-04   
ref|XP_009593384.1|  PREDICTED: uncharacterized protein LOC104090048  48.5    7e-04   
ref|XP_003599061.1|  hypothetical protein MTR_3g027260                50.4    7e-04   
gb|KFK27189.1|  hypothetical protein AALP_AA8G347600                  50.4    7e-04   
ref|XP_003635992.1|  hypothetical protein MTR_021s0028                50.4    7e-04   
ref|XP_009605272.1|  PREDICTED: uncharacterized protein LOC104099852  48.9    7e-04   
ref|XP_006380102.1|  hypothetical protein POPTR_0008s21930g           50.1    8e-04   
ref|XP_010467353.1|  PREDICTED: uncharacterized protein LOC104747...  50.1    8e-04   
ref|XP_004252199.1|  PREDICTED: uncharacterized protein LOC101262390  50.4    8e-04   
emb|CDY32898.1|  BnaC02g11820D                                        50.4    8e-04   
ref|XP_010467351.1|  PREDICTED: uncharacterized protein LOC104747...  50.1    8e-04   
ref|XP_006286068.1|  hypothetical protein CARUB_v10007601mg           50.4    8e-04   
ref|XP_012085930.1|  PREDICTED: uncharacterized protein LOC105645040  50.4    8e-04   
ref|XP_006369223.1|  hypothetical protein POPTR_0001s19460g           50.1    8e-04   
ref|XP_003605440.1|  hypothetical protein MTR_4g031410                50.1    9e-04   
ref|XP_008779482.1|  PREDICTED: uncharacterized protein LOC103699210  49.3    0.001   
ref|XP_006375691.1|  hypothetical protein POPTR_0014s19670g           50.1    0.001   
ref|XP_010314925.1|  PREDICTED: uncharacterized protein LOC104645270  49.7    0.001   



>emb|CDP20930.1| unnamed protein product [Coffea canephora]
Length=497

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 74/132 (56%), Gaps = 11/132 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ LP LPIH FD   L  I  P+GR +   SAT   TRP++A+V +E+DV KS   R+
Sbjct  148  VWVVLPALPIHYFDKHSLFSILSPVGRPLFLDSATAAGTRPSLARVCVELDVAKSFTQRV  207

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ--TEVRLR------RREER  411
            W+      G  GFWQ++  E +P +C +CSR GH    CK+  TEV  R       + +R
Sbjct  208  WVAV---EGESGFWQRIVPENMPLYCSSCSRLGHSQEQCKKNVTEVGSRYLYKHNSKLQR  264

Query  410  GTSLTCKNVPMT  375
              SL   NV ++
Sbjct  265  DLSLEVNNVQVS  276



>ref|XP_009799697.1| PREDICTED: uncharacterized protein LOC104245737 [Nicotiana sylvestris]
Length=293

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 73/122 (60%), Gaps = 2/122 (2%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            LVW+ LP LP HL  +  + +I   +G  +E   AT R+TRP++A+VR+E+D+ K + + 
Sbjct  20   LVWILLPKLPFHLHTWPYVKQIAREVGTPLEMDVATRRKTRPSMAEVRVEVDLLKPLPNH  79

Query  569  IWI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE-VRLRRREERGTSLT  396
            IW+    +   L GF QK+E E +P +C  C + GH + NC+  E +R+  ++E   ++ 
Sbjct  80   IWVGNEDDDSPLKGFEQKLEYESVPKYCRHCRKLGHDLINCRVVEKMRIAEKKEEDRTMM  139

Query  395  CK  390
             +
Sbjct  140  LQ  141



>emb|CDP14239.1| unnamed protein product [Coffea canephora]
Length=587

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 11/128 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W +LP LPIHLF    L  +   +G  +   +AT   +RPNVA+V +E+D+ KS+  R+
Sbjct  111  IWFRLPKLPIHLFAKPCLFHLVSCLGTPLFVDAATSSFSRPNVARVCVEVDLLKSIPSRV  170

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
            W++ G+G   DGFWQ +  E LPN+C  C R GH    C+     LR  + +G       
Sbjct  171  WVDMGDG---DGFWQVLIPENLPNYCSHCYRQGHGEDQCRVKHPDLRLPKTQGG------  221

Query  386  VPMTPGVI  363
              + PGV+
Sbjct  222  --LVPGVM  227



>ref|XP_009764067.1| PREDICTED: uncharacterized protein LOC104215844 [Nicotiana sylvestris]
Length=354

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 77/139 (55%), Gaps = 10/139 (7%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP H+F ++ L ++ E IG  ++   ATI RTR  +AKVR+E+D+ KS+ + +
Sbjct  171  IWILLPELPFHMFKWEYLKQVLEQIGTPMKEDIATIARTRSYMAKVRVEVDLMKSLPNSV  230

Query  566  WIEF-GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCK  390
            +I   G+   L G  QK+E E +P FC  C  +GH    CK   V  R+RE+   +   K
Sbjct  231  FIGIEGDTTRLKGKDQKLEYEGVPTFCKTCKLYGHDYERCK---VEARKREQARANQETK  287

Query  389  NVPMTPGVIRKEDGQTPNV  333
            N        +KED    N+
Sbjct  288  NAE------KKEDQARTNI  300



>ref|XP_009766744.1| PREDICTED: uncharacterized protein LOC104218041 [Nicotiana sylvestris]
Length=216

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             LVW+ LP LP H +++  L RI  PIG  +    AT  +TRP  AK+RIEID+ K +  
Sbjct  62   ALVWINLPDLPWHYYEWASLCRIVGPIGTAIVMDKATQTKTRPTTAKMRIEIDLLKPLIT  121

Query  572  RIWIEFGEGGGL-DGFWQKVEVERLPNFCVACSRFGHLVGNCK------QTEVRLRRREE  414
             + +      G+ + F QK+E E +P FC  C   GH++  C+      Q + + + R +
Sbjct  122  DVQVTIQNPEGIVETFNQKIEYETVPLFCSHCRIQGHIIEGCQKAPKTAQVDDQPKERND  181

Query  413  RGTS  402
             G S
Sbjct  182  EGMS  185



>ref|XP_009621358.1| PREDICTED: uncharacterized protein LOC104112999 [Nicotiana tomentosiformis]
Length=274

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ LP L  H   +  + +I  PIG  +    AT  RTRPN+AKVR+E+D+ K   + I
Sbjct  107  VWVLLPELSFHCHTWHYVKQIAGPIGTPLSMDIATDYRTRPNIAKVRVEVDLTKPKLNSI  166

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE  438
            W+    E   L+GF Q +E E +P +C  C   GH +  C++ E
Sbjct  167  WVGSEDEQSPLNGFTQNLEYENVPKYCRHCKLLGHSILQCRKIE  210



>ref|XP_010326232.1| PREDICTED: uncharacterized protein LOC104649186 [Solanum lycopersicum]
Length=591

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W+ LP LP+H ++ + ++ +  PIGR++   +A+I +TR + A+V++++D+ K     
Sbjct  1    MYWISLPELPLHCYNKEFITSLLSPIGRVLYLDAASINKTRGSQARVKVQVDLTKERPPH  60

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC--KQTEVRLRRREE  414
            IW+ +      DG WQK+E + +P++C  C   GH   +C  KQ +   + R+E
Sbjct  61   IWMGYIGENITDGRWQKIEYDNIPDYCFYCKHQGHNEIDCIVKQRDEENQHRKE  114



>ref|XP_010319987.1| PREDICTED: uncharacterized protein LOC104647107 [Solanum lycopersicum]
Length=1448

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 46/150 (31%), Positives = 80/150 (53%), Gaps = 18/150 (12%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP H ++ + ++ +  PIGR++   SA+I +TR + A+V++++D+ K     I
Sbjct  166  IWISLPELPWHCYNKEFITSLLSPIGRVLYLDSASINKTRGSQARVKVQVDLTKDRPSHI  225

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC--KQTEV------RLRRREER  411
            W+ +     +DG WQK++ + +P++C  C   GH    C  KQ +V      ++ R +ER
Sbjct  226  WMGYIGEDIIDGRWQKIDYDNIPDYCFYCKHQGHKEMACIIKQRDVENKRKKQMERNKER  285

Query  410  GTSLTCKNVPMTPGVIRKEDGQTPNVDDSG  321
              S+   N          ED Q P   +SG
Sbjct  286  LDSVHNNN----------EDMQIPKPMESG  305



>ref|XP_009760564.1| PREDICTED: uncharacterized protein LOC104212897 [Nicotiana sylvestris]
Length=260

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ L  LP H + +  + +I  P+G  +    AT  RTRP++AKVR+E+D+ K     +
Sbjct  21   IWVLLSGLPFHCYTWHYVKQILGPVGLPLSMDIATDYRTRPSMAKVRVEVDLTKPQLKYV  80

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLV  459
            W+ +  E   L GF QK+E E +P +C  C R GH +
Sbjct  81   WVGQENETNPLKGFMQKLEYEGVPKYCKHCRRLGHSI  117



>ref|XP_009768438.1| PREDICTED: myb-like protein D [Nicotiana sylvestris]
Length=334

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 71/131 (54%), Gaps = 12/131 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW  LP LP H+  ++ + ++   IG   E   AT  RTRP++AKVR+EID+ K   + +
Sbjct  21   VWALLPGLPFHMHTWNYVKQVVSAIGTPFEMDLATRGRTRPSIAKVRVEIDLLKDQPNSV  80

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK--------QTEVRLRRR--  420
            ++ +  +     GF QK+E E +P +C  C + GH + NC+        +TE  + ++  
Sbjct  81   YVGQIYDNAPQKGFMQKIEFEGVPKYCKFCRKLGHNMINCRALERKRLLKTENWMTKKLN  140

Query  419  -EERGTSLTCK  390
             E +GT L  K
Sbjct  141  AENKGTDLNNK  151



>ref|XP_009765415.1| PREDICTED: uncharacterized protein LOC104216966 [Nicotiana sylvestris]
Length=407

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 4/114 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ LP LP H   +  + +I  PIG  +    AT  +TRP++AKVRIE+D+ K   + +
Sbjct  173  VWVLLPDLPFHCHTWYYIKQILSPIGIPLTMDMATNNKTRPSMAKVRIEVDLTKPKLNSV  232

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERG  408
            W+ +  E   L GF QK+E E +P +   C   GH +  C++ E   ++ EE G
Sbjct  233  WVGQEYETSPLKGFTQKLEYENVPKYYRHCRLLGHSLVQCRKAE---KKVEEEG  283



>gb|KDP31715.1| hypothetical protein JCGZ_14928 [Jatropha curcas]
Length=194

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 4/99 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+    LPIHLFD   L  I   IG+ ++  + T   +R +VA+V +E+D+ K + +R+
Sbjct  21   VWILFEGLPIHLFDKAALFPIANLIGKPLKVDATTSTLSRRSVARVCVELDLSKDLHNRV  80

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI+ G+     GF+Q V  E LP FC  C RFGH + +C
Sbjct  81   WIDNGDL----GFFQPVSYESLPLFCPKCCRFGHKIQSC  115



>ref|XP_010324834.1| PREDICTED: uncharacterized protein LOC104648709 [Solanum lycopersicum]
Length=361

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 69/122 (57%), Gaps = 2/122 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP H ++ + ++ +  PIGR++   SA+I +TR + A+V++++D+ K     I
Sbjct  77   IWISLPELPWHCYNKEFITSLLSPIGRVLYLDSASINKTRGSQARVKVQVDLTKERPSHI  136

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC--KQTEVRLRRREERGTSLTC  393
            W+ +      DG WQK++ + + ++C  C   GH    C  KQ +   ++R+E   S   
Sbjct  137  WMGYMGEDITDGRWQKIDYDNILDYCFYCKHQGHKEVACIIKQRDEENKKRKEMEKSRAG  196

Query  392  KN  387
            K+
Sbjct  197  KD  198



>ref|XP_009765570.1| PREDICTED: uncharacterized protein LOC104217118 [Nicotiana sylvestris]
Length=305

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 1/114 (1%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ LP LP HL  +  + +I  P+G  +    AT  +TRP++AKVR+EID+ K     +
Sbjct  21   VWVLLPKLPFHLHTWHYIKQILSPVGTPMYMDVATNGKTRPSMAKVRVEIDLSKPRLSHV  80

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERG  408
            ++        L G  QKVE E +  +C  C   GH +  C++ E  L   EE+ 
Sbjct  81   FVGSKNATNPLHGHEQKVEYEGITKYCNHCRLQGHEISQCRRLEKELADPEEQN  134



>ref|XP_012068458.1| PREDICTED: uncharacterized protein LOC105631070 [Jatropha curcas]
Length=313

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+    LPIHLF    L  I   IG+ ++  +AT   +RP+VA+V +E+D+ K + +++
Sbjct  21   TWILFEGLPIHLFAKAALFPIANLIGKPLKVDAATATLSRPSVARVCVELDLSKDLPNKV  80

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI+ G+     GF+Q V  E LP FC  C R GH + +C
Sbjct  81   WIDDGDL----GFFQPVNYESLPLFCTKCCRIGHEILSC  115



>ref|XP_012081344.1| PREDICTED: uncharacterized protein LOC105641421 [Jatropha curcas]
Length=223

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 58/98 (59%), Gaps = 4/98 (4%)
 Frame = -2

Query  743  WLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIW  564
            W+    LPIHLF    L  I   IG+ ++  SAT   +RP+VA+V +E+D+ K + +++W
Sbjct  74   WILFEGLPIHLFAKAALFPIANLIGKPLKIDSATTTLSRPSVARVCVELDLSKDLPNKVW  133

Query  563  IEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            I+ G+     GF+Q V  E LP FC  C R GH + +C
Sbjct  134  IDDGDL----GFFQPVNYESLPLFCPKCCRLGHEIPSC  167



>ref|XP_009766116.1| PREDICTED: uncharacterized protein LOC104217535 [Nicotiana sylvestris]
Length=316

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T V + LP LP   +++D L  I  P+G  +    AT+ +TRP  AKVR+EI++ K +  
Sbjct  169  TPVGITLPNLPWQYYEWDALCHILGPVGIPLIMDKATMSKTRPTTAKVRVEINLTKPIVQ  228

Query  572  RIWIEF-GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
             + +EF  + G  +   QK+E E +P FC  C   GH    C+     L++
Sbjct  229  EVLLEFINDEGSKEMVVQKIEYESMPAFCTHCKIRGHSDATCRILHPELKK  279



>ref|XP_009794929.1| PREDICTED: uncharacterized protein LOC104241685 [Nicotiana sylvestris]
Length=228

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 2/116 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W  L  LP H   ++ + +I  P+G  +    AT  RTRP +AKVR+++D+ K + + I
Sbjct  93   IWFLLLGLPFHCHTWNYVKKILGPLGVPLSMDIATNYRTRPGMAKVRVKVDLTKPLVNSI  152

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
            W+ +  E   L GF QK+E E +P +C  C   GH V  C+  E R + +E++  +
Sbjct  153  WVGQEEEAYPLKGFTQKLEYEGVPKYCKHCRILGHSVLQCRVLE-REKNKEKQSKN  207



>ref|XP_007010391.1| Uncharacterized protein TCM_044158 [Theobroma cacao]
 gb|EOY19201.1| Uncharacterized protein TCM_044158 [Theobroma cacao]
Length=830

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   LS I + +GR +    AT   TRP+VA+V +E D  +   D++
Sbjct  185  VWISFPNLKAHLYEKSALSAIVKTVGRPLMVDEATANGTRPSVARVCVEFDCQQPPIDQV  244

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       G  + G+ QKVE  RL  FC  CS  GH V +C
Sbjct  245  WIVTRNRQSGSVMGGYMQKVEFARLSEFCTHCSHVGHGVSSC  286



>ref|XP_007031319.1| Uncharacterized protein TCM_016772 [Theobroma cacao]
 gb|EOY02245.1| Uncharacterized protein TCM_016772 [Theobroma cacao]
Length=1296

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 7/104 (7%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  H ++   L  I + +GR +    AT   TRPNVA++ +E D  KS+ D+I
Sbjct  191  VWISFPNLRAHFYEKSTLMMIAKSVGRPLFVDEATANGTRPNVARICVEYDCQKSLLDQI  250

Query  566  WI-----EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI     + GE  G  GF QKVE  ++P++C  C   GH    C
Sbjct  251  WIVTRSRQTGEVTG--GFIQKVEFVKMPDYCTHCCHVGHNASAC  292



>ref|XP_007032187.1| Uncharacterized protein TCM_017591 [Theobroma cacao]
 gb|EOY03113.1| Uncharacterized protein TCM_017591 [Theobroma cacao]
Length=487

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 71/155 (46%), Gaps = 23/155 (15%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VW+  P L   L++   L  I + +G  +    AT   TRP++A+V IE D  K + D+
Sbjct  17   VVWIVFPNLRAQLYEKSALMVIAKAVGHPLLVDEATANGTRPSIARVCIEFDCQKPLLDQ  76

Query  569  IWI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL  399
            IWI   +   G   DGF QKVE ERL  +C+ C   GH                   ++L
Sbjct  77   IWIVTRDRSTGEVTDGFMQKVEFERLSEYCMHCCHVGH-------------------SAL  117

Query  398  TCKNVPMTPGVIRKEDGQTPNVDDSGQGTEKVEAD  294
            TC  +   PG    E  +TP       GTE +E D
Sbjct  118  TCIVMGNGPGKQGLERSKTP-AGKKKMGTEGIERD  151



>ref|XP_012065816.1| PREDICTED: uncharacterized protein LOC105628933 [Jatropha curcas]
Length=397

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 4/99 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+    LPIHLF    L  I   IG+ ++  +AT   +RP+VA+V +E+D+ K + +++
Sbjct  163  TWILFEGLPIHLFAKAALFPIANLIGKPLKVDAATATLSRPSVARVCVELDLSKDLPNKV  222

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI+ G+     GF+Q V  E LP FC  C R GH + +C
Sbjct  223  WIDDGDL----GFFQPVNYESLPLFCTKCCRIGHEILSC  257



>ref|XP_009613478.1| PREDICTED: uncharacterized protein LOC104106604 [Nicotiana tomentosiformis]
Length=174

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ +  LP H +   +L  +  PIG+ +    A+ ++ R +VAKV+++ID+ KS    +
Sbjct  41   IWVVILELPWHFYCMKILRGLLSPIGKALHLDLASFQKIRGSVAKVKMQIDLTKSRPHHV  100

Query  566  WIEFG--EGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            W EF   +    DG W +V+ E +P +C+ C    H + +C
Sbjct  101  WFEFDYKQDENRDGQWLEVQYENIPEYCLYCKHLAHNIQDC  141



>ref|XP_009801081.1| PREDICTED: uncharacterized protein LOC104246885 [Nicotiana sylvestris]
Length=209

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 63/107 (59%), Gaps = 1/107 (1%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+ +P LP H+ D+  + ++   +GR +    AT  RTRP++A +R+E+++ K + D +
Sbjct  82   AWVLIPGLPFHMHDWYYIKQLLSSVGRPLALDVATFGRTRPSMANMRVEVNLLKPLPDSV  141

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRL  429
            ++ +  +   L GF QK+E E +P +C  C + GH + N +  E ++
Sbjct  142  FVGQEDDESPLKGFTQKLEYEEVPKYCKHCRKLGHNMINRRVLEKKM  188



>ref|XP_007023857.1| Uncharacterized protein TCM_028230 [Theobroma cacao]
 gb|EOY26479.1| Uncharacterized protein TCM_028230 [Theobroma cacao]
Length=748

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 7/104 (7%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   +  I + +GR +    AT   TRP++A+V IE D  K   D++
Sbjct  162  VWISFPNLRAHLYEKSAVLVIAKTVGRPLFVDEATDNGTRPSLARVCIEYDCLKPPLDQV  221

Query  566  WI-----EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       GE  G  GF QKV+ ER+P++C  C   GH V  C
Sbjct  222  WIVMRDRRTGEITG--GFMQKVDFERMPDYCTHCCHVGHSVSTC  263



>ref|XP_010275342.1| PREDICTED: uncharacterized protein LOC104610424 [Nelumbo nucifera]
Length=287

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 12/137 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W  LP+LP++ ++   L  I +  GR+++   AT R TR    +V + +D+ K    R+
Sbjct  152  LWNFLPMLPVNFYNDKYLRSIVQVAGRVLKVDPATARLTRTTAGRVCMVVDLLKENPSRV  211

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRR-----EERGTS  402
            W+    G   +GFWQK+  E LP +C  C + GH  G CK   ++L+R      E   + 
Sbjct  212  WV----GLSKEGFWQKIVYENLPKYCTFCFKHGHGEGECK---LKLKRNLKSEGEVTKSK  264

Query  401  LTCKNVPMTPGVIRKED  351
             T   + + P   RKE 
Sbjct  265  PTSAKMLVNPEAPRKEQ  281



>ref|XP_009788948.1| PREDICTED: uncharacterized protein LOC104236667 [Nicotiana sylvestris]
Length=488

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+ LP LP H+ D+  + ++   +   +   +ATI RTRP++AK+R+E+D+ K++   +
Sbjct  21   AWVLLPRLPFHMHDWHYVKQLLSSVRTPLALDAATIGRTRPSMAKIRVEVDLLKTLPQSV  80

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE  438
            ++ +  E   L G+ QK+E E +P +   C + GH + NC+  E
Sbjct  81   FVGQEYEDSPLKGYTQKLEYEGVPKYFKHCRKIGHYIINCRVLE  124



>ref|XP_009758915.1| PREDICTED: uncharacterized protein LOC104211540 isoform X1 [Nicotiana 
sylvestris]
Length=392

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 55/101 (54%), Gaps = 1/101 (1%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW  LP L  H   +    ++ +P+G+ +    AT  RTRP+ AKVR++ID+ K     +
Sbjct  173  VWFLLPELLFHCHSWHYAKQVLKPVGKPLSMDVATFGRTRPSTAKVRVDIDLTKPQETSV  232

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            ++ +  E   L GF +K+E E +P +C  C   GH +  C+
Sbjct  233  YVGQEEETNPLKGFTEKIEYEHVPKYCKHCKLIGHSLVQCR  273



>ref|XP_007022011.1| Uncharacterized protein TCM_032141 [Theobroma cacao]
 gb|EOY13536.1| Uncharacterized protein TCM_032141 [Theobroma cacao]
Length=345

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 52/102 (51%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+  P L  HLF+   L  I + +GRL+    AT   +RP++A V +E D  K   D I
Sbjct  32   IWISFPGLHAHLFEKLALLMIAKTVGRLLFVDEATANGSRPSIAWVCVEYDCQKPPLDHI  91

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G    GF QKVE  +LP +C  CS  GH    C
Sbjct  92   WIVTRDRQTGIVTGGFVQKVEFSKLPAYCTHCSHVGHDFAAC  133



>ref|XP_007017130.1| Uncharacterized protein TCM_042329 [Theobroma cacao]
 gb|EOY34749.1| Uncharacterized protein TCM_042329 [Theobroma cacao]
Length=2606

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 57/113 (50%), Gaps = 3/113 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + +GR +    AT   TRP+VA+V +E D  +   ++I
Sbjct  191  VWISFPNLRAHLYEKSALLMIAKSVGRPLFVDEATANGTRPSVARVCVEYDCQQPPLEQI  250

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRRE  417
            WI   +   G    GF QKV+  +LPN+C  C   GH    C     R+ + E
Sbjct  251  WIVTRDRRTGDITGGFQQKVDFAKLPNYCTHCCHVGHSASTCLVMGHRMEKAE  303


 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -2

Query  746   VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             VW+  P L  HLF+   L  I + +G+ +    AT   +RP+VA+V IE D  +   D++
Sbjct  1817  VWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEFDCRRPPIDQV  1876

Query  566   WI--EFGEGGGL-DGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             WI  +  E G +  G+ Q+VE  ++P +C  C   GH   +C
Sbjct  1877  WIVVQNRETGTVTSGYPQRVEFSQMPAYCDHCCHVGHKENDC  1918



>ref|XP_007026454.1| Uncharacterized protein TCM_030494 [Theobroma cacao]
 gb|EOY29076.1| Uncharacterized protein TCM_030494 [Theobroma cacao]
Length=876

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 51/102 (50%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + IG  +    AT   TRP+VA+V IE D  K   D +
Sbjct  218  VWISFPNLKAHLFEKSALLMIAKAIGNPLYIDEATANGTRPSVARVCIEYDCLKPPVDSV  277

Query  566  WIEFGEGGGLD---GFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   + G  D   G+ QKVE   +P +C  C   GH V  C
Sbjct  278  WIVVSKRGSEDMSGGYLQKVEFAPMPEYCNHCCHVGHNVSKC  319



>ref|XP_007013807.1| Uncharacterized protein TCM_038365 [Theobroma cacao]
 gb|EOY31426.1| Uncharacterized protein TCM_038365 [Theobroma cacao]
Length=534

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 73/157 (46%), Gaps = 20/157 (13%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+ LP +P+  +D+DV++RI   +GR ++    T + TR   A++ +EID+      +I
Sbjct  61   AWIPLPGMPLEYYDYDVIARIGNELGRTLKIDQTTYQATRGKFARMCVEIDLKNPFVPKI  120

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
            +I         G WQKVE E L   C  C +FGH +  C+Q     RR            
Sbjct  121  FI--------GGRWQKVEYEGLRILCFHCGKFGHNIDCCEQRFKNYRRG-----------  161

Query  386  VPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISFKDN  276
             P T   +RK++  T     SG     +E D   +D+
Sbjct  162  -PSTKVKVRKQEDTTMARMQSGSRFVVLEHDTDIQDD  197



>ref|XP_009600554.1| PREDICTED: uncharacterized protein LOC104095990 [Nicotiana tomentosiformis]
Length=188

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ +P L  H +  +VLS +  PIG+++    A++++TR +VAK ++++++ +     +
Sbjct  77   VWIVIPELSWHFYYMEVLSVLLSPIGKVLHLDLASMQKTRGSVAKAKMQVNLTQFRPHHV  136

Query  566  WIEFGEGGGLDG--FWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREER  411
            W+ F E   ++G   W +V  E LP +C  C   GH   +C    VR R  E++
Sbjct  137  WLGFDEDQDVNGDRQWLEVVYEDLPTYCSHCKYLGHEEYSCP---VREREEEDK  187



>ref|XP_007010246.1| Uncharacterized protein TCM_043721 [Theobroma cacao]
 gb|EOY19056.1| Uncharacterized protein TCM_043721 [Theobroma cacao]
Length=359

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 50/102 (49%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + IG  +    AT   TRP+VA+V IE D  K   D +
Sbjct  73   VWISFPNLKAHLFEKSALLLIAKAIGNPLWIDEATANGTRPSVARVCIEYDCLKLPVDSV  132

Query  566  WIEFGEGGGLD---GFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   + G  D   G+ QKVE   +  +C  C   GH V  C
Sbjct  133  WIVVSKRGSKDMLGGYLQKVEFSPMSEYCNHCCHVGHSVSEC  174



>ref|XP_007040951.1| Uncharacterized protein TCM_016760 [Theobroma cacao]
 gb|EOY25452.1| Uncharacterized protein TCM_016760 [Theobroma cacao]
Length=1109

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 50/168 (30%), Positives = 79/168 (47%), Gaps = 15/168 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + +G+ +    AT   +RP+VA+V +E D  K   + I
Sbjct  189  VWISFPNLKAHLYEKSALLLIAKTVGKPLYVDEATANGSRPSVARVCVEYDCRKQPVEEI  248

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC-----KQTEVRLRRREER  411
            WI       G    G+ Q+VE  R+P++C  CS  GH    C     K  ++     + R
Sbjct  249  WIVIRNRETGAVTGGYSQRVEFARMPDYCGYCSHVGHKENECIVLGTKSKQLGYGNLQTR  308

Query  410  GTSLTCKNVPMTPGVIRKEDGQ-TPNVDDSGQGTEKVEADISFKDNEM  270
            G     + +P      R EDG+ T +  + G+ T + E ++  KD  M
Sbjct  309  GKDTQARVLPS-----RTEDGEKTKSSTEGGKKTLQKEKNMD-KDKTM  350



>ref|XP_007026457.1| Uncharacterized protein TCM_021521 [Theobroma cacao]
 gb|EOY06959.1| Uncharacterized protein TCM_021521 [Theobroma cacao]
Length=1951

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + +GR +    AT   TRP+VA+V +E D  +   ++I
Sbjct  191  VWISFPNLRAHLYEKSALLMIAKSVGRPLFVDEATANGTRPSVARVCVEYDCQQPPLEQI  250

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G    GF QKV+  +LPN+C  C   GH    C
Sbjct  251  WIVSRDRRTGDITGGFQQKVDFAKLPNYCTHCCHVGHSASTC  292



>ref|XP_007031317.1| Uncharacterized protein TCM_016768 [Theobroma cacao]
 gb|EOY02243.1| Uncharacterized protein TCM_016768 [Theobroma cacao]
Length=351

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 3/112 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + +GR +    AT + TRP+VA+V IE D  K   D++
Sbjct  160  VWISFPNLRAHLYEKFALLVIAKTVGRPLMVDEATAKGTRPSVARVCIEYDCQKPPIDQV  219

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRR  420
            WI   +   G  + G+ QKV+  +L  +C  C   GH V  C     R  +R
Sbjct  220  WIVTRDRKTGSVIGGYMQKVDFAKLLEYCSHCCHVGHGVSTCIMLGHRPEKR  271



>gb|KHN25996.1| hypothetical protein glysoja_046925 [Glycine soja]
Length=134

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VW++ P L ++ +D  +L  +   +G  ++    T+  TR  VA+V IE+D+ K V  +
Sbjct  33   MVWIRFPGLNLYFYDESILLALATRVGSPIKANENTLDFTRGRVARVCIEVDLNKPVIGK  92

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            +W++        G W KVE E L + C  C  +GHL+  CK
Sbjct  93   VWMK--------GHWYKVEYEGLHHICSNCGCYGHLIRECK  125



>ref|XP_007040952.1| Uncharacterized protein TCM_005954 [Theobroma cacao]
 gb|EOX96783.1| Uncharacterized protein TCM_005954 [Theobroma cacao]
Length=1134

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 52/102 (51%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + IG  +    AT   TRP+VA+V IE D  K   + +
Sbjct  21   VWISFPNLRAHLFEKSALLLIAKAIGNPLGVDEATANGTRPSVARVFIEYDCLKPPIESV  80

Query  566  WIEFGEGGGLD---GFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   + G  D   G+ QKV+   +P +C  C   GH + NC
Sbjct  81   WIVTSKRGSEDVTGGYLQKVDFAPMPEYCNHCCHVGHGMENC  122



>ref|XP_007044276.1| Uncharacterized protein TCM_009619 [Theobroma cacao]
 gb|EOY00108.1| Uncharacterized protein TCM_009619 [Theobroma cacao]
Length=230

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            LVW+  P L +HL++   L  + + + + +    AT +R+RP+VA+V +E D  K + D+
Sbjct  20   LVWISFPNLKVHLYEQSALLLVAKIVEKPLFVDEATAKRSRPSVARVCVEYDCRKPLVDQ  79

Query  569  IWI-----EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            +WI     E GE   +  + Q+VE   + ++C  C   GH   NC
Sbjct  80   VWIVIQNRETGEVTSI--YSQRVEFSPMLDYCYHCCHVGHKEANC  122



>ref|XP_009610625.1| PREDICTED: uncharacterized protein LOC104104285 [Nicotiana tomentosiformis]
Length=306

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 64/117 (55%), Gaps = 5/117 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ LP L  H+  +  + ++   +G  +E   AT  + RP++AKVRIEID+ K   D +
Sbjct  107  VWVLLPRLHFHMHRWQYVKQVVSAVGTPLEMDLATRGKARPSMAKVRIEIDLLKQQPDSV  166

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC----KQTEVRLRRREER  411
            ++ +  +     GF QK+E E +P +   C +  H + NC    ++ E++ + RE +
Sbjct  167  YVGQVYDDAPQKGFVQKLEYEGVPRYYKHCRKLRHNMMNCRVLERKGEMKKKEREAK  223



>ref|XP_006361065.1| PREDICTED: putative NPIP-like protein LOC613037-like [Solanum 
tuberosum]
Length=499

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 55/103 (53%), Gaps = 2/103 (2%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W+  P LP   F  + L  +   +G+ ++   AT  +TRP+ A+V++E+++ + +  R
Sbjct  1    MAWISFPSLPCQYFARNALFSMASAVGQPLDVDRATYDKTRPSTARVKVEVNLLRILPKR  60

Query  569  IWIEFGE--GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            I ++F     G +   WQK+  + +P +C  C   GH   +C+
Sbjct  61   IRVQFNNLVTGEITNVWQKIRYDYVPYYCKRCKHQGHREADCR  103



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 46/139 (33%), Positives = 69/139 (50%), Gaps = 18/139 (13%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + +G+ +    AT   +RP+VA+V +E D  KS  D++
Sbjct  76   VWISFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCVEYDCRKSPVDQV  135

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREER--GTS  402
            WI       G  ++G+ Q+VE  ++P +C  C   GH     K+T+  L   + R  GTS
Sbjct  136  WIVVQNRKTGEVMNGYSQRVEFAQMPAYCDHCCHVGH-----KETDCILLGNKPRPPGTS  190

Query  401  LTCKNVPMTPGVIRKEDGQ  345
                     P   R EDG+
Sbjct  191  --------KPPTSRIEDGE  201



>ref|XP_009777335.1| PREDICTED: stress response protein NST1-like [Nicotiana sylvestris]
Length=248

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 2/122 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ L  LP H   +  + +I  P+G  +    AT  RTR  +AKVR+E+++ K     +
Sbjct  23   IWVLLLGLPFHCHMWYYIKQILSPVGVPLSMDLATDYRTRLGMAKVRVEVNLTKPRLQSV  82

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEV-RLRRREERGTSLTC  393
            W  +  E   L GF QK+E E +P +C  C   GH V   K  E  R + +E +   L  
Sbjct  83   WFRQEDESNPLKGFTQKLEYEGVPKYCKHCRILGHSVVQYKILEKERQKEKEAKDKGLEE  142

Query  392  KN  387
            KN
Sbjct  143  KN  144



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 51/106 (48%), Gaps = 11/106 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P LP HL +   L  +   +G+ +    AT  R+RP+VA+V +E D  K   D +
Sbjct  21   VWISFPNLPAHLHEKSALMMVARTVGKPLFVDEATANRSRPSVARVCVEYDCQKPPLDHV  80

Query  566  WI-------EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       E   G    G  Q+VE  +LP +C  C   GH V  C
Sbjct  81   WIVSRNRKTETMTG----GLSQRVEFAKLPEYCQHCCHVGHAVTEC  122



>ref|XP_007026455.1| Uncharacterized protein TCM_021519 [Theobroma cacao]
 gb|EOY06957.1| Uncharacterized protein TCM_021519 [Theobroma cacao]
Length=667

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + IG+ +     T + +RP+VA+V +E D  +   D++
Sbjct  185  VWISFPNLKAHLYEKSALLLIAKTIGKPLFVDEPTAKGSRPSVARVCVEYDCREPPIDQV  244

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G   +G+ QKVE  ++P++C  C   GH    C
Sbjct  245  WIVTQKRETGMVTNGYAQKVEFSQMPDYCEHCCHVGHNETTC  286



>ref|XP_007040947.1| Uncharacterized protein TCM_016754 [Theobroma cacao]
 gb|EOY25448.1| Uncharacterized protein TCM_016754 [Theobroma cacao]
Length=868

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL +   L  I + +G+L+    AT   +RP+VA+V +E D  K   D I
Sbjct  76   VWISFPNLRTHLHEKSALMIIAKAVGKLLFADEATANGSRPSVARVCVEYDCQKQPLDHI  135

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +      + GF Q+    +LP++C  C   GH +  C
Sbjct  136  WIVSRDQKTRAAVGGFTQRENFSKLPDYCSHCGHVGHAISEC  177



>ref|XP_007031313.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
 gb|EOY02239.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
Length=2127

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (51%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + +G+ +    AT   +RP+VA+V IE D  +   D++
Sbjct  214  VWISFPNLKAHLFEKSALLLIAKTVGKPLFIDEATANGSRPSVARVCIEYDCREPPVDQV  273

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       G    G+ QKVE  ++P +C  C   GH   NC
Sbjct  274  WIVVQNRATGAVTSGYPQKVEFAQMPAYCDHCCHVGHKEINC  315



>ref|XP_007026458.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
 gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
Length=3503

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (47%), Gaps = 11/172 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + +G+ +    AT   +RP+VA+V +E +   +  + I
Sbjct  76   VWISFPNLKAHLYEKSALLLIAKTVGKPLFIDEATSNASRPSVARVCVEYNCRNAPVEEI  135

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLT  396
            WI   +   G    G+ QKVE  ++P++C  C   GH V  C    + L  R E      
Sbjct  136  WIVIKDRVTGTVTGGYAQKVEFSKMPDYCEHCGHVGHSVSTC----LVLGNRSENLRKEK  191

Query  395  CKNVPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISFKDNEMKSPNQRGLVT  240
              NV       +K   QT N DD G  ++ ++     K+ + K   +R ++T
Sbjct  192  LSNVHSKSLAGKK---QTEN-DDKGLDSKPMDDLKRNKETDRKISEERPMMT  239


 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 3/102 (3%)
 Frame = -2

Query  746   VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             VW+  P L  HLF+   L  I + +G+ +    AT   +RP+VA+V +E D  +   D++
Sbjct  1886  VWISFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCVEFDCRQPPLDQV  1945

Query  566   WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             WI       G   +G+ Q+VE  ++P +C  C   GH   +C
Sbjct  1946  WIVVQNRKTGEITNGYSQRVEFAQMPAYCDHCCHVGHKETDC  1987



>ref|XP_008780422.1| PREDICTED: uncharacterized protein LOC103700244, partial [Phoenix 
dactylifera]
Length=318

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 54/119 (45%), Gaps = 3/119 (3%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VWL+LP LP+  +  + + R+    G  +     T +R R   A+V++E+D    +   
Sbjct  167  VVWLRLPSLPMDFWKKESIFRVAARAGTPLALDGFTEQRRRYGFARVKVELDASAPLVPG  226

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK---QTEVRLRRREERGTS  402
             W+      G   FWQ    E LP  C  C R GH    C+    TE RL   EE G S
Sbjct  227  TWVRGSSADGGAAFWQGFVYENLPVPCARCGRIGHSAVGCEFVSPTEGRLNPAEESGGS  285



>ref|XP_009799814.1| PREDICTED: uncharacterized protein LOC104245823 isoform X2 [Nicotiana 
sylvestris]
Length=483

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 55/104 (53%), Gaps = 2/104 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+ LP LP  LF    L  I   +G+ +    AT  ++RP+ A+V++ +D+   + D
Sbjct  91   AVVWISLPNLPTELFAMKALLSIASVVGKPIAIDKATQTKSRPSAARVKVILDLMDKLHD  150

Query  572  RIWIEF--GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            +++++F   + G +  F+Q    + LP +C  C   GH    C+
Sbjct  151  KLFLQFVDKQTGKIVEFFQDFVYDNLPLYCNYCKHQGHDEKTCR  194



>ref|XP_009768291.1| PREDICTED: uncharacterized protein LOC104219326 [Nicotiana sylvestris]
Length=242

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP+  +  + L RI   +G+ +     T +  R + A++ +E+D+ + + D +
Sbjct  72   IWINLPRLPVQCWAEENLGRIASLLGKPICTDKLTAQCKRISFARILVEMDITQPLPDGV  131

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ  444
             IE  +G   +   Q+VE E  P  C+ C++FGH  GNC+Q
Sbjct  132  TIENPDGSTWE---QRVEFEWKPKLCMDCNKFGHSTGNCQQ  169



>ref|XP_010326471.1| PREDICTED: uncharacterized protein LOC104649283 [Solanum lycopersicum]
Length=918

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 45/150 (30%), Positives = 70/150 (47%), Gaps = 11/150 (7%)
 Frame = -2

Query  725  LPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGEG  546
            LP H ++   LS I E IG+++   S T +RTR +  +V++++D+ K +   +W+ F   
Sbjct  403  LPWHCYNKVFLSTILESIGKVMFLDSPTSQRTRGSTTRVKVQVDITKEIPSHVWLGFKHS  462

Query  545  GGLDGFWQKVEVERLPNFCVACSRFGHLVGNC----KQTEVRLRRRE--ERGTSLTCKNV  384
                G   KVE E +P++C  C   GH    C    K  E++ RR    E+ +     + 
Sbjct  463  NPNKGRSLKVEYEGIPSYCFYCKHQGHKDEECTIKRKDEEIKKRREMEVEKNSKEKVSDK  522

Query  383  PMTPGVIRKED----GQTPNVDDSGQGTEK  306
                G   KED       PN +  G G EK
Sbjct  523  LQEQGKRAKEDTSKTSNQPNTNQKG-GNEK  551



>ref|XP_007045383.1| Uncharacterized protein TCM_011161 [Theobroma cacao]
 gb|EOY01215.1| Uncharacterized protein TCM_011161 [Theobroma cacao]
Length=148

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (52%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+  P L  HL++   L  I + + + +    AT   +RP+VA+  +E D  K+  D++
Sbjct  21   IWISFPNLKAHLYEKSALLLIAKTVKKSLFIDEATANGSRPSVARGCMEYDCRKAPVDQV  80

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +      + G+ ++VE  ++P +C  C   GH V NC
Sbjct  81   WIVVKDRVTRAVIGGYAERVEFSKMPKYCDHCCHVGHSVSNC  122



>ref|XP_009799813.1| PREDICTED: uncharacterized protein LOC104245823 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+ LP LP  LF    L  I   +G+ +    AT  ++RP+ A+V++ +D+   + D
Sbjct  91   AVVWISLPNLPTELFAMKALLSIASVVGKPIAIDKATQTKSRPSAARVKVILDLMDKLHD  150

Query  572  RIWIEF--GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            +++++F   + G +  F+Q    + LP +C  C   GH    C
Sbjct  151  KLFLQFVDKQTGKIVEFFQDFVYDNLPLYCNCCKHQGHDEKTC  193



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (51%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + +G+ +    AT   +RP+VA+V IE D  K   D++
Sbjct  220  VWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEYDCRKPPIDQV  279

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       G    G+ QKVE  ++P +C  C   GH   +C
Sbjct  280  WIVVQNRETGTVTSGYPQKVEFSQMPAYCDHCCHVGHKEIDC  321



>ref|XP_010687516.1| PREDICTED: uncharacterized protein LOC104901625 [Beta vulgaris 
subsp. vulgaris]
Length=228

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+H +  D LSRI   +G  V     T +  R + A++ IE+DV + + + I
Sbjct  49   IWVKLPNLPLHYWSSDSLSRIGSLLGMPVYADECTSKALRVSFARILIEMDVTQKIPNEI  108

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             IE   G     F QKV  + LP +C  C + GH   NCK
Sbjct  109  QIEDPNGA---TFKQKVTYDWLPPYCKKCLKVGH---NCK  142



>ref|XP_010272338.1| PREDICTED: uncharacterized protein LOC104608143 [Nelumbo nucifera]
Length=321

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 7/108 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP+L I+L++   L  I +  GR+++   AT   TR   A+V +E+D+ K    R+
Sbjct  152  LWISLPMLLINLYNDKYLRSIVQVAGRVIKVDLATTHLTRTTTARVCMEVDLLKENPSRV  211

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
            W+  G+    +GFWQK+  E LP +C  C + G+  G CK   ++L+R
Sbjct  212  WVRLGK----EGFWQKIVYENLPKYCTFCFKHGYGEGECK---LKLKR  252



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + IG+ +    AT + +RP+VA+V +E D  +   D++
Sbjct  185  VWISFPNLKAHLYEKSALLLIAKTIGKPLFVDEATAKGSRPSVARVCVEYDCREPPIDQV  244

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G   +G+ QKVE  ++P++C  C   GH    C
Sbjct  245  WIVTQKRETGMVTNGYAQKVEFSQMPDYCEHCCHVGHNETTC  286



>gb|KHN17248.1| hypothetical protein glysoja_010707, partial [Glycine soja]
Length=554

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+QLP LP+HL+    L +I   +G+ +     T ++ R + A++ +E+DV + + + I
Sbjct  164  IWIQLPQLPLHLWGARSLGKIGSALGKPITTDECTAKKYRVSYARILVEVDVTQKLPNDI  223

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
             I   EG  L    Q V  E  P FC  C +FGH     K  +V   + ++  TS
Sbjct  224  TIRDSEGKKLK---QPVHYEWKPMFCDKCQKFGHHCEEVKAKKVWQMKSKQGSTS  275



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + +G+ +    AT   +RP+VA+V IE D  +S  D++
Sbjct  76   VWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEYDCRRSPIDQV  135

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       G    G+ Q+VE  ++P +C  C   GH   +C
Sbjct  136  WIVVQNRETGTVTSGYPQRVEFSQMPAYCDHCCHVGHKEIDC  177



>gb|KHN21001.1| hypothetical protein glysoja_009309, partial [Glycine soja]
Length=524

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 3/115 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+QLP LP+HL+    L +I   +G+ +     T ++ R + A++ +E+DV + + + I
Sbjct  134  IWIQLPQLPLHLWGARSLGKIGSALGKPITTDECTAKKYRVSYARILVEVDVTQKLPNDI  193

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
             I   EG  L    Q V  E  P FC  C +FGH     K  +V   + ++  TS
Sbjct  194  TIRDSEGKKLK---QPVHYEWKPMFCDKCQKFGHHCEEVKAKKVWQMKSKQGSTS  245



>ref|XP_010695085.1| PREDICTED: uncharacterized protein LOC104907793 [Beta vulgaris 
subsp. vulgaris]
Length=390

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 6/100 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+H +  D LSRI   +G+ V     T +  R + A++ IE+DV K +   I
Sbjct  166  LWVKLPNLPLHYWSGDSLSRIGSLLGKPVYADECTSKALRVSFARILIEMDVTKKLPSEI  225

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             IE   G     F QKV  + LP +C  C + GH   NCK
Sbjct  226  QIEEPNGA---TFTQKVSYDWLPPYCKKCLKVGH---NCK  259



>ref|XP_010670298.1| PREDICTED: uncharacterized protein LOC104887379 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 6/100 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+H +  D LSRI   +GR V     T +  R + A++ IE+DV K++   I
Sbjct  206  LWVKLPNLPLHYWSGDSLSRIGSLLGRPVYADECTSKALRVSFARILIEMDVTKTLPTEI  265

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             IE   G     F QKV  + LP +C  C + GH   NC+
Sbjct  266  QIEEPNGA---TFTQKVSYDWLPPYCKKCLKVGH---NCE  299



>ref|XP_010690660.1| PREDICTED: uncharacterized protein LOC104904165 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VW++ P LP+  ++ D L  I E +G+ ++   AT    R   A+V IE+++ K++  R
Sbjct  214  MVWIRFPELPLEYYEKDALFAIAEKVGKPIKVDYATDTVVRGRYARVCIELELSKALVTR  273

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            +W+           WQ VE E L   C  C R GH    C
Sbjct  274  VWVAKA--------WQTVEYENLDLVCFKCGRIGHRQDQC  305



>ref|XP_007046403.1| Uncharacterized protein TCM_011922 [Theobroma cacao]
 gb|EOY02235.1| Uncharacterized protein TCM_011922 [Theobroma cacao]
Length=928

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + IGR +    AT + +RP+VA+V  E D  K   +++
Sbjct  185  VWISFPNLKAHLYEKFALLLIAKTIGRPLFVDEATAKGSRPSVARVCAEYDCRKPPINQV  244

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G   +G+ QKVE  ++P +C  C   GH   NC
Sbjct  245  WIVTQKRETGTVTNGYAQKVEFSQMPAYCDHCCHVGHNETNC  286



>ref|XP_009765551.1| PREDICTED: uncharacterized protein LOC104217093, partial [Nicotiana 
sylvestris]
Length=652

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 2/111 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+ W+  P LP++LF    L  I   +G+ +    AT  RTRP+ A+V++ ID+      
Sbjct  188  TVAWVSFPDLPMNLFAKKPLLSIASAVGKPIAIDKATQTRTRPSTARVKVIIDLLDKYPK  247

Query  572  RIWIEF--GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLR  426
             I ++F   + G +    Q+   + LP++C  C R GH+  +C+    R R
Sbjct  248  NIKLQFIDEKSGKVIEHLQEFVFDNLPSYCNVCKRQGHVGEDCRSLMTRNR  298



>ref|XP_010263702.1| PREDICTED: uncharacterized protein LOC104601894 [Nelumbo nucifera]
Length=332

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW+++  LPI  FD +VL  I   IGRLV+  S T   +R   A++ +EID+ K++  
Sbjct  184  TAVWVRVAELPIEYFDQEVLELIGNKIGRLVKIDSVTQLASRGRFARLCVEIDLRKALKT  243

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
            RI +E        G W  V  ERLP  C +C   GH    C + 
Sbjct  244  RIKVE--------GQWYVVIYERLPLICFSCGVVGHKKDECPEN  279



>ref|XP_009758922.1| PREDICTED: uncharacterized protein LOC104211540 isoform X2 [Nicotiana 
sylvestris]
Length=301

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query  686  ICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWI-EFGEGGGLDGFWQKVEV  510
            + +P+G+ +    AT  RTRP+ AKVR++ID+ K     +++ +  E   L GF +K+E 
Sbjct  102  VLKPVGKPLSMDVATFGRTRPSTAKVRVDIDLTKPQETSVYVGQEEETNPLKGFTEKIEY  161

Query  509  ERLPNFCVACSRFGHLVGNCK  447
            E +P +C  C   GH +  C+
Sbjct  162  EHVPKYCKHCKLIGHSLVQCR  182



>ref|XP_008799663.1| PREDICTED: uncharacterized protein LOC103714254 [Phoenix dactylifera]
Length=438

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 52/101 (51%), Gaps = 4/101 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++LP LP+  +D + +  I   +G  +E    +  R R   A+V++EI+V + +  
Sbjct  167  TVVWVRLPGLPVEYWDMEAIRVIVAEVGNPLELDRFSHERRRIGYARVKVEINVRQPLIP  226

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
               ++    G    FWQ    E LP  C  C+R  HL G+C
Sbjct  227  GTIVQ----GVQARFWQTFAYEDLPGLCYRCARLDHLAGDC  263



>ref|XP_011092915.1| PREDICTED: uncharacterized protein LOC105172985 [Sesamum indicum]
Length=470

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 4/101 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++LP LPI  FD + L  I   +G  +    +T    RP+VA+V +EI+    + + +
Sbjct  114  VWVRLPELPIQFFDREALFSIAHLLGTPLRTDVSTATLVRPSVARVCVEIN----LLEPL  169

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ  444
              E G G G +   Q V  ERLP +C AC   GH    C +
Sbjct  170  QTEIGLGIGTEVIIQPVIYERLPKYCGACKHLGHDEDECYE  210



>ref|XP_007037791.1| Uncharacterized protein TCM_014510 [Theobroma cacao]
 gb|EOY22292.1| Uncharacterized protein TCM_014510 [Theobroma cacao]
Length=593

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 62/115 (54%), Gaps = 13/115 (11%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+ LP +P+  +D ++L +I + IG+ V+    T  +++   A++ +EID+ K +  +I
Sbjct  255  TWVCLPGMPLEYYDREILDKIGDRIGKSVKIDRTTSSQSKGKFARLCVEIDLKKPLIPKI  314

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
            +I         G WQK+E E L   C  C +FGH    C      ++++E++G S
Sbjct  315  FI--------GGRWQKIEYEGLKMLCFHCEKFGHSEEGC-----VMKQQEKKGLS  356



>ref|XP_008806373.1| PREDICTED: uncharacterized protein LOC103719081 [Phoenix dactylifera]
Length=865

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 63/134 (47%), Gaps = 9/134 (7%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             ++WL+LP LP   +  +++  I    GR +     T +  +   A+V++E+DV + +  
Sbjct  167  AIMWLRLPNLPTEYWSKELIWCIAGKAGRPLALDKFTDQGRKLGFARVKVEMDVGEPLRP  226

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
              +I+ G     D  WQ+   E LP FC  C+R GH  G+C           E+G SL  
Sbjct  227  GTFIQVGG----DSHWQEFRYENLPGFCYRCARLGHGEGDCPFPSTDPATSAEQGGSL--  280

Query  392  KNVPMTPGVIRKED  351
               P  P  + KED
Sbjct  281  ---PPEPEAVAKED  291



>gb|KJB67209.1| hypothetical protein B456_010G180600 [Gossypium raimondii]
Length=227

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 9/124 (7%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+QL  LP+  F+ +VL ++ + +GR ++  S T+  TR   A++ IEID+ K +   I
Sbjct  104  VWIQLLGLPLEYFNEEVLVKVGKLVGRPIKLDSNTVYTTRGKFARIYIEIDLSKPLIPSI  163

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             I          F Q +E E L N C +C  FGH    C   ++ +   EE   ++  KN
Sbjct  164  RI--------GNFVQNIEYEGLHNICFSCGCFGHRTEACVLKKM-VTDLEELSEAVQTKN  214

Query  386  VPMT  375
               T
Sbjct  215  TKAT  218



>gb|KHN07236.1| hypothetical protein glysoja_045025, partial [Glycine soja]
Length=212

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 8/101 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW+  P L +  +D  +L  +   IG L++  S T+   R   A++ ++ID+ K V  
Sbjct  108  TMVWVCFPGLNLIYYDESILLALARAIGTLIKVDSNTLDVRRERFARIYVQIDLNKPVVG  167

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            ++        GL G+W KVE E L   C +C  +GHL   C
Sbjct  168  KV--------GLKGYWYKVEYEGLHRICSSCGCYGHLAREC  200



>ref|XP_008795223.1| PREDICTED: uncharacterized protein LOC103711032 [Phoenix dactylifera]
Length=305

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 56/118 (47%), Gaps = 4/118 (3%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             ++WL+LP LP+  +  +++  I E  GR +     T +  +   A+V++E+DV +    
Sbjct  169  AVIWLRLPSLPMEYWRKELIWSIAEKAGRPLALDKVTDQGRKLGFARVKVEMDVGEPFRP  228

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL  399
              +I+ G     D  WQ    E LP FC  C+R GH  G C           E+G SL
Sbjct  229  GTFIQVG----ADSHWQAFRYENLPGFCYRCARLGHGEGVCPFPPTTPAMSGEQGDSL  282



>ref|XP_006596845.1| PREDICTED: uncharacterized protein At4g02000-like [Glycine max]
Length=546

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 8/101 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW+  P L +  +D  +L  +   IG L++  S T+   R   A++ ++ID+ K V  
Sbjct  197  TMVWVCFPGLNLIYYDESILLALARAIGTLIKVDSNTLDVRRERFARIYVQIDLNKPVVG  256

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            ++        GL G+W KVE E L   C +C  +GHL   C
Sbjct  257  KV--------GLKGYWYKVEYEGLHRICSSCGCYGHLAREC  289



>ref|XP_008777413.1| PREDICTED: uncharacterized protein LOC103697350 [Phoenix dactylifera]
Length=329

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 4/106 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++LP LP+  +D +++  I     R +E  S + RR R   A+ ++E+D  + +  
Sbjct  50   TVVWVRLPGLPLEYWDREMILAIVAAAERPMELDSISSRRRRLGFARAKVEVDSLQPLVP  109

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEV  435
               +E  +      FWQ    E LP  C  C+R GH    C+  EV
Sbjct  110  GTLVEVRQ----RRFWQDFVFEDLPGLCYLCARMGHQASECRFHEV  151



>emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=744

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 52/112 (46%), Gaps = 8/112 (7%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VW++ P LP+  +D + L  I   +G+ ++   AT    R   A+V IE+D+ K++  +
Sbjct  210  MVWIRFPELPLEYYDKEALFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAKALVSK  269

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREE  414
            +W+           WQ VE E L   C  C + GH    C        R+ E
Sbjct  270  VWVARA--------WQNVEYENLSLVCFLCGKIGHRRDQCSHGLGEQNRKNE  313



>ref|XP_007010894.1| Uncharacterized protein TCM_044962 [Theobroma cacao]
 gb|EOY19704.1| Uncharacterized protein TCM_044962 [Theobroma cacao]
Length=439

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 5/102 (5%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +WL+   +  HL++   L  I + +GR +    AT   TRP+VA V +E D  K   +++
Sbjct  92   IWLKQ--VWAHLYEKSALLVIAKTVGRPLLADEATANGTRPSVAWVCVEYDCQKPPIEQV  149

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G  + G+ QKVE  RLP +C  C   GH + +C
Sbjct  150  WIVTRDRQIGSVMGGYMQKVEFARLPEYCTHCCHVGHGITSC  191



>gb|KHN33899.1| hypothetical protein glysoja_031761, partial [Glycine soja]
Length=212

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 8/101 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++ P L +  +D ++L  +   IG  ++  S T+   R + A++ ++ID+ K V  
Sbjct  108  TMVWVRFPSLNLIYYDENILLALARAIGTPIKVDSNTLDVRRGHFARICVQIDLNKPVVG  167

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            ++        GL G+W KVE E L   C +C  +GHL   C
Sbjct  168  KV--------GLKGYWYKVEYEGLHRICSSCGCYGHLAREC  200



>ref|XP_010682918.1| PREDICTED: uncharacterized protein LOC104897680 [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 65/150 (43%), Gaps = 16/150 (11%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ LP LP+  +D + L  I   +G+ +    AT   TR   A++ IEI++ K +  +I
Sbjct  184  VWIHLPELPVEYYDKEALFAIASKLGKPIRVDYATNHITRARYARICIEINLSKPIISKI  243

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC-----KQTEVRLRRREERGT-  405
            WI           WQ +  E L + C  C   GH    C     K    +L      GT 
Sbjct  244  WI--------GNQWQVILYENLHSLCFVCGGIGHQKNQCIEPKGKAVMDQLESESREGTD  295

Query  404  -SLTCKNVPMTPGVIR-KEDGQTPNVDDSG  321
             S    +  + PGV   K+DG T   D+ G
Sbjct  296  GSQLYPSQNIDPGVSNAKDDGGTFVSDNQG  325



>ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula]
Length=513

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (51%), Gaps = 8/110 (7%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++ P L +  +D   L  +   IGR ++  + T++  R   A+V +EID+   V  
Sbjct  171  TVVWVRFPGLNLVYYDESFLLAMASAIGRPIKVDTNTLKVERGKFARVCVEIDLTVPVVG  230

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
            +IW+        +G W K++ E L   C  C  +GHL  NC Q   ++ +
Sbjct  231  KIWV--------NGHWYKIQYEGLHLICTNCGCYGHLGRNCNQPTTKIDK  272



>ref|XP_006374361.1| hypothetical protein POPTR_0015s06420g, partial [Populus trichocarpa]
 gb|ERP52158.1| hypothetical protein POPTR_0015s06420g, partial [Populus trichocarpa]
Length=459

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (45%), Gaps = 14/147 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +  D LS+I   +G+ ++    T   +R + A+  +EID+ + +   +
Sbjct  179  VWVKFPNLPLCCWSPDCLSKIASVLGKPIQCDQPTSTLSRLSYARALVEIDLLEELQHSV  238

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC--  393
             I   EG  L    Q+V  + LP +C  C   GH       T +   +     T+LTC  
Sbjct  239  AITLPEGPVLH---QQVVYDNLPKYCHLCHVLGH-------THLLCPKAAANATTLTCPP  288

Query  392  --KNVPMTPGVIRKEDGQTPNVDDSGQ  318
                VP+ PG +    G  P +    Q
Sbjct  289  LSPAVPVAPGNVASRLGPRPPIPSQAQ  315



>ref|XP_006387777.1| hypothetical protein POPTR_0590s00210g [Populus trichocarpa]
 gb|ERP46691.1| hypothetical protein POPTR_0590s00210g [Populus trichocarpa]
Length=404

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 73/168 (43%), Gaps = 5/168 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS++   IG+ V   ++T   TR + A+V IEID+   +   I
Sbjct  153  VWVRFPNLPLQCWSPLCLSKLASVIGKPVHSDTSTNSMTRLSYARVLIEIDLLADLPTSI  212

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC--KQTEVRLRRREERGTSLTC  393
             I    G   D   QKV  E LP FC  C   GH    C  K +  R +  +       C
Sbjct  213  NIILPNG---DSLSQKVMYESLPRFCKQCRTRGHTTSTCTNKSSHKRNKHSQTAPAPSGC  269

Query  392  KNVPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISFKDNEMKSPNQRG  249
             +      V+ K+  +     + G     VEA ++ ++  + S  +R 
Sbjct  270  SSSSAETAVVEKQSIREEPQGEPGIDPMFVEAAVAVEERAIGSGRKRA  317



>ref|XP_003592213.1| hypothetical protein MTR_1g100160 [Medicago truncatula]
Length=651

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 56/101 (55%), Gaps = 4/101 (4%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            ++W++L  LP   +    L  I   +G  +   +AT  RT  + A++ I++D+ K +F+ 
Sbjct  1    MIWIRLIDLPQEYWRHTTLFEIANGVGTPIALDNATKNRTFGHYARILIDLDLSKRIFNE  60

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            I +E  EG     F+ +V+ E+LP +C  C+  GH +G CK
Sbjct  61   IMVE-REGFS---FYVEVQYEQLPEYCNNCATIGHSIGQCK  97



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 8/99 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++LP L +HL+    L+RI + +G +++   +T   TR   A+V + I + K +  ++
Sbjct  193  VWIRLPGLGLHLYHQKTLNRIGKLVGEVIKLDDSTESSTRGKFARVAVRISLAKPLVSQV  252

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
                     L+G  QK+E E LP  C  C R+GH  G C
Sbjct  253  --------ELNGRIQKIEYEGLPVICFKCGRYGHNSGEC  283



>ref|XP_007050032.1| Uncharacterized protein TCM_003626 [Theobroma cacao]
 gb|EOX94189.1| Uncharacterized protein TCM_003626 [Theobroma cacao]
Length=172

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%)
 Frame = -2

Query  698  VLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGE---GGGLDGF  528
             L  I   +G+      AT  R+RP+VA++ +E D  K   D +WI   +       +GF
Sbjct  5    ALMMIARTVGKPFFVDEATTNRSRPSVARLCVEYDCQKPPLDHVWIMSHDRETKAMTEGF  64

Query  527  WQKVEVERLPNFCVACSRFGHLVGNC  450
             Q+VE  +LP++C  C   GH V  C
Sbjct  65   SQRVEFSKLPDYCFHCCHVGHAVTEC  90



>gb|KDO47636.1| hypothetical protein CISIN_1g041417mg, partial [Citrus sinensis]
Length=381

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 58/118 (49%), Gaps = 8/118 (7%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++L  + IH +  +V+ R+ + IG +V+  S TI   R   A++ +E+D+ K +  +
Sbjct  192  VAWIRLSEMNIHFYHKNVIRRLGQIIGPVVKIDSNTITAQRGKFARLAVELDLQKPLVSQ  251

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLT  396
                      L+G  QKVE E LP  C  C +FGH    C  +       ++   SLT
Sbjct  252  F--------NLEGRIQKVEYENLPTICFGCGKFGHYREACPDSADITHMAKDDQHSLT  301



>ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago truncatula]
Length=423

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 8/110 (7%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++ P L +  +D + L  +   IGR ++  + T+   R   A+V +EID+   V  
Sbjct  122  TVVWVRFPGLNLVYYDENFLLAMASAIGRPIKVDTNTLNVERGKFARVCVEIDLTAPVVG  181

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
            +IW+        +G W K++ E L   C  C   GHL  NC Q    L +
Sbjct  182  KIWV--------NGHWYKIQYEWLHLICTNCGCCGHLRRNCSQKSTTLHQ  223



>ref|XP_008780119.1| PREDICTED: uncharacterized protein LOC103699903, partial [Phoenix 
dactylifera]
Length=316

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 51/119 (43%), Gaps = 3/119 (3%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VWL+LP LP+  +  + + R+    G  +     T +R R   A+V++E+D    +   
Sbjct  167  VVWLRLPSLPMDFWKKEAIFRVAARAGTPLALDGFTEQRRRYGFARVKVELDASAPLVPG  226

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC---KQTEVRLRRREERGTS  402
             W+      G   FWQ    E LP  C  C R GH    C      E RL   E  G S
Sbjct  227  TWVRGSSADGGAPFWQGFVYENLPVPCAKCGRVGHSAVGCVFVPPAEGRLNPEEVSGGS  285



>ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula]
 gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula]
Length=504

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (46%), Gaps = 8/127 (6%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++ P L +  +D   L  +   +GR ++  + T++  R   A+V +EID+   V  
Sbjct  174  TVVWVRFPGLNLVYYDESFLLAMASALGRPIKVDTNTLKVERGKFARVCVEIDLTVPVVG  233

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
            +IW+        +G W KV+ E L   C  C  +GHL  NC +       R     +   
Sbjct  234  KIWV--------NGHWYKVQYEGLHLICTNCGCYGHLGRNCMEKPSTFDPRSPNHHTAGG  285

Query  392  KNVPMTP  372
             N P  P
Sbjct  286  NNPPSNP  292



>ref|XP_009601640.1| PREDICTED: uncharacterized protein LOC104096893 [Nicotiana tomentosiformis]
Length=160

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = -2

Query  635  RTRPNVAKVRIEIDVYKSVFDRIWI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLV  459
            +TRP++AKV++E+D+ K + + +W+ +  +   L GF QK+E E +P +   C + GH +
Sbjct  8    KTRPSMAKVQVEVDLLKPLLNSVWVGDEDDDSPLKGFVQKLEYENVPKYYKHCKKLGHAL  67

Query  458  GNCKQTE-VRL---RRREERGTSLTCKNV  384
             NC+  E +RL   +  EER   +  + V
Sbjct  68   INCRVLEHIRLMEDKEAEEREKEVAKEKV  96



>ref|XP_007013771.1| Uncharacterized protein TCM_038318 [Theobroma cacao]
 gb|EOY31390.1| Uncharacterized protein TCM_038318 [Theobroma cacao]
Length=203

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + +G+ +    AT   +RP+VA+V +E D  K+  +++
Sbjct  76   VWIFFPNLKAHLYEKLALLLIAKTMGKPLFIDKATTNGSRPSVARVYVEYDCKKASVNQV  135

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGN  453
            WI   ++  G  + G+ Q VE  ++  +C  C   GH V N
Sbjct  136  WIVVKDWVIGAVIRGYTQWVEFSKMLKYCDHCCHVGHSVSN  176



>ref|XP_007022378.1| Uncharacterized protein TCM_032655 [Theobroma cacao]
 gb|EOY13903.1| Uncharacterized protein TCM_032655 [Theobroma cacao]
Length=217

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+  P L  HLF+   L  I + +G+ +    AT   +RP+VA V +E D  K + +++
Sbjct  76   IWISFPNLKAHLFEKSTLLLIAKTVGKPLFLDEATTNGSRPSVAHVCVEYDCRKRMVEQV  135

Query  566  WIEFGE---GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI          ++G+ QKVE   +P +   C   GH    C
Sbjct  136  WIVVQNRETSAVMNGYSQKVEFAHMPAYYDHCCHVGHKKVEC  177



>ref|XP_003593078.1| hypothetical protein MTR_2g007560 [Medicago truncatula]
Length=578

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 53/104 (51%), Gaps = 8/104 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++ P L +  +D   L  +   +GR ++    T++  R   A+V +EID+   V  
Sbjct  97   TIVWVRYPGLNLVYYDESFLLAMASALGRPIKVDRNTLKIERGKFARVCVEIDLTMPVVG  156

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
            +IW+        +G W KV+ E L   C +C  +GHL  NC  T
Sbjct  157  KIWV--------NGHWYKVQYEGLHLICTSCGCYGHLGRNCTTT  192



>ref|XP_009785329.1| PREDICTED: uncharacterized protein LOC104233603 [Nicotiana sylvestris]
 ref|XP_009785330.1| PREDICTED: uncharacterized protein LOC104233603 [Nicotiana sylvestris]
Length=539

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 58/115 (50%), Gaps = 2/115 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+  P LP + F    L  I   +G+ +    AT  RTRP+VA+V++ +D+      
Sbjct  162  AVVWISFPDLPPNYFAKKSLISIPSAVGKPLAIDKATKDRTRPSVARVKVLLDLLDKHPK  221

Query  572  RIWIEFGE--GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREE  414
            ++ I   +   G  + F QKV  + LP +C  C+  GH   +C+  + R +  +E
Sbjct  222  KVKISVVDKLSGKFNNFCQKVIYDYLPMYCTCCNHQGHDEISCRAMKGRNKNAKE  276



>ref|XP_010687419.1| PREDICTED: uncharacterized protein LOC104901529 [Beta vulgaris 
subsp. vulgaris]
Length=417

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 6/109 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+H +  D LSRI   +G  +     T +  R + A+V IE+D+ K +   I
Sbjct  190  IWVKFPNLPLHYWSDDSLSRIGSLLGVPIYADECTSKALRVSFARVLIEMDITKEIPKEI  249

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRR  420
             I   E  G+  F QKV  + LP FC  CS  GH   NC+  + + + +
Sbjct  250  QIV--EPNGVT-FAQKVTYDCLPPFCSKCSMIGH---NCESLQAKAKTQ  292



>ref|XP_011083357.1| PREDICTED: uncharacterized protein At4g02000-like [Sesamum indicum]
Length=143

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 5/116 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+ L  LPI  FD + L  I   +G  ++   +T    +P+VA+V +EI++ + +  +I
Sbjct  21   VWVHLSELPIQFFDREALFSIALLLGTPLKTDVSTATLVQPSVARVYVEINLLEPLQTKI  80

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL  399
             +    G G +   Q V  ERLP +C AC   GH    C + ++R   R++R   +
Sbjct  81   SL----GIGTEVIIQPVIYERLPKYCGACKHLGHDKDKCYE-KLRPANRDDRPPPI  131



>ref|XP_007037027.1| Uncharacterized protein TCM_013236 [Theobroma cacao]
 gb|EOY21528.1| Uncharacterized protein TCM_013236 [Theobroma cacao]
Length=175

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 3/91 (3%)
 Frame = -2

Query  713  LFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGE--GGG  540
            +++   L  I + IG+ +    AT  R+RP+VA+V +E D  K   +++WI   +   G 
Sbjct  3    MYEKSALLLIAKTIGKPLYIDEATATRSRPSVARVCVEYDCRKDPVEQVWIVVKDRVSGT  62

Query  539  LDG-FWQKVEVERLPNFCVACSRFGHLVGNC  450
            + G + Q+VE  ++P +C  C   GH V  C
Sbjct  63   VTGCYMQRVEFSKIPEYCGHCCHVGHAVSTC  93



>ref|XP_007008705.1| Uncharacterized protein TCM_042331 [Theobroma cacao]
 gb|EOY17515.1| Uncharacterized protein TCM_042331 [Theobroma cacao]
Length=1176

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL++   L  I + IG+ +    AT + +RP +A+V ++ D  K   D++
Sbjct  164  VWISFPNLKAHLYEKFALLLIVKTIGKPLFVDEATTKGSRPTMARVCVKYDCRKLPIDQV  223

Query  566  WI---EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI   +   G   +G+ QKVE   +PN+   C   GH   NC
Sbjct  224  WIVTQKRNTGIVTNGYAQKVEFSHMPNYWDHCCHVGHNETNC  265



>ref|XP_009777941.1| PREDICTED: uncharacterized protein LOC104227398 [Nicotiana sylvestris]
Length=202

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LPI  +  + L RI   +G+ +     T    R + A+V +E+D+ + + +  
Sbjct  6    IWVNLPGLPIQCWAEENLGRIASLLGKPICTDRLTAECERISYARVLVEMDITQPLPNES  65

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ  444
            +IE  +G     + Q V+ E  P FC+ C  FGH  G+C++
Sbjct  66   YIEIPDG---RSWMQNVKFEWKPKFCLECYTFGHNTGDCQK  103



>ref|XP_006580860.1| PREDICTED: uncharacterized protein LOC102664004 [Glycine max]
Length=344

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++L+    + +I   +G+ +     T +R R + A++ +EID+ + +   I
Sbjct  220  IWIKLPQLPLYLWGAKTMGKIGSILGKPIVTDECTAQRLRISYARMLVEIDITQEMPKEI  279

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
             I   EG  L    Q VE E  P +C  C +FGH+   C++ +VR  +
Sbjct  280  TIADNEGHELI---QAVEYEWKPKYCGKCKKFGHV---CEKPKVRKEK  321



>ref|XP_009770480.1| PREDICTED: uncharacterized protein LOC104221176 [Nicotiana sylvestris]
Length=146

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 53/95 (56%), Gaps = 3/95 (3%)
 Frame = -2

Query  719  IHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWI-EFGEGG  543
            +H +++  + ++   IG  +E   AT  RTRP++AKVR+EID  K+    +++ +  +  
Sbjct  1    MHTWNY--VKQVVSAIGTPLEMDLATRGRTRPSMAKVRVEIDQLKNQPYSVYVGQIYKNA  58

Query  542  GLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE  438
                F QK+E E +P +C  C   GH + NC+  E
Sbjct  59   PQKDFVQKLEFEGIPKYCKFCRTLGHNMINCRALE  93



>ref|XP_006599769.1| PREDICTED: uncharacterized protein LOC102668549 [Glycine max]
Length=399

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++L+    + +I   +G+ +     T +R R + A++ +EID+ + +   +
Sbjct  204  IWIKLPQLPLYLWGAKTMGKIGSILGKPIVTDECTAQRLRISYARMLVEIDITQEMPKEV  263

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
             I   EG  L    Q VE E  P +C  C +FGH+   C++ +VR  +
Sbjct  264  TIADNEGHEL---IQAVEYEWKPKYCGKCKKFGHV---CEKPKVRKEK  305



>ref|XP_010520311.1| PREDICTED: uncharacterized protein LOC104799464 [Tarenaya hassleriana]
Length=548

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 8/102 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++ P +PI  +   +L  I   IGR++     T+  +R   A+V +E+D+ K +   
Sbjct  184  VAWIRFPAMPIQYYHAALLEIIAGNIGRVIRVDYNTVSASRGRFARVAVELDLSKPLISS  243

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ  444
              IE        G  Q VE E LP  C +C   GHL   C +
Sbjct  244  FEIE--------GLTQLVEYENLPTICFSCGVIGHLKEQCSK  277



>gb|KDO58401.1| hypothetical protein CISIN_1g046952mg, partial [Citrus sinensis]
Length=428

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++L  + IH +  +++ R+ + IG +++  S T+   R   A++ +E+D+ K +  +
Sbjct  132  VAWIRLSEMNIHFYHKNIIRRLGQIIGPVIKIDSNTVAAQRGKFARLAVELDLQKPLVSQ  191

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
                      L+G  QKVE E LP  C  C +FGH    C
Sbjct  192  F--------NLEGRIQKVEYENLPMICFGCGKFGHYKDAC  223



>gb|KDO37843.1| hypothetical protein CISIN_1g047084mg, partial [Citrus sinensis]
Length=437

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 8/96 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW++LP +  HL+D  +L +I + +G +++    T  R R   A++ + I + + +  
Sbjct  298  AIVWIRLPGMAFHLYDKRILRKIGQLVGNVIKIDYHTALRERGKFARIAVRISLSQPLLS  357

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
            R          +DG  QKVE E LP  C  C ++GH
Sbjct  358  RF--------NIDGKIQKVEYEGLPIICYQCGKYGH  385



>gb|KDO60122.1| hypothetical protein CISIN_1g045711mg [Citrus sinensis]
Length=504

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 51/101 (50%), Gaps = 8/101 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW++LP L +HL+    L +I   +G +++F   T   TR   A++ + I + + +  
Sbjct  157  AVVWIRLPGLAMHLYHQKTLQKIGHLVGEVIKFDDNTKLSTRGKFARIAVRISLVQPLVS  216

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            ++ I        +G  QK+E E LP  C  C R+GH    C
Sbjct  217  QVKI--------NGRVQKIEYEGLPVICFKCGRYGHHSDTC  249



>ref|XP_006605232.1| PREDICTED: uncharacterized protein LOC102667279 [Glycine max]
Length=315

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++L+    + +I   +G+ +     T +R R + A++ +EID+ + +   +
Sbjct  120  IWIKLPQLPLYLWGAKTMGKIGSILGKPIVTDECTAQRLRISYARMLVEIDITQEMPKEV  179

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
             I   EG  L    Q VE E  P +C  C +FGH+   C++ +VR  +
Sbjct  180  TIADNEGHELI---QAVEYEWKPKYCGKCKKFGHV---CEKPKVRKEK  221



>gb|KDO35980.1| hypothetical protein CISIN_1g037800mg [Citrus sinensis]
Length=402

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VW++LP + +H +   +L  I + IG +V     T   TR   A++ +E+ + K +  +
Sbjct  37   IVWIRLPGMALHYYHKRILRMIGQVIGNVVRVNYNTESATRGKFARIAVEVSLSKPLVSQ  96

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
                      LDG  QKVE E LP  C +C ++GH    C
Sbjct  97   FL--------LDGKVQKVEYENLPFICFSCGKYGHYYEAC  128



>ref|XP_006490301.1| PREDICTED: uncharacterized protein LOC102612828 [Citrus sinensis]
Length=585

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VW++LP L +HL+    L +I   +G +++F   T   TR   A++ + I + + +  +
Sbjct  192  VVWIRLPGLAMHLYHQKTLQKIGHLVGEVIKFDDNTKLSTRGKFARIAVRISLVQPLVSQ  251

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            + I        +G  QK+E E LP  C  C R+GH    C
Sbjct  252  VKI--------NGRVQKIEYEGLPVICFKCGRYGHHSDTC  283



>gb|KHN15915.1| hypothetical protein glysoja_013131, partial [Glycine soja]
Length=526

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 6/105 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++L+    + +I   +G+ +     T +R R + A++ +EID+ + +   +
Sbjct  162  IWIKLPQLPLYLWGAKTMGKIGSILGKPIVTDECTAQRLRISYARMLVEIDITQEMPKEV  221

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVR  432
             I   EG  L    Q VE E  P +C  C +FGH+   C++ +VR
Sbjct  222  TIADNEGHELI---QAVEYEWKPKYCGKCKKFGHV---CEKPKVR  260



>ref|XP_007039835.1| Uncharacterized protein TCM_015964 [Theobroma cacao]
 gb|EOY24336.1| Uncharacterized protein TCM_015964 [Theobroma cacao]
Length=192

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 48/94 (51%), Gaps = 8/94 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++ P +P+H++   +L RI   IGR+++    T    R   A+V +E+D+ + +  + 
Sbjct  105  AWVRFPGIPLHMYHKSILKRITSLIGRMLKIDHNTGAEKRGKFARVTVELDLSEPLTPKF  164

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
            +        L+G  QK+  E LP  C  C  FGH
Sbjct  165  F--------LNGKEQKIVYEGLPQVCFTCGVFGH  190



>ref|XP_008795215.1| PREDICTED: uncharacterized protein LOC103711023 [Phoenix dactylifera]
Length=298

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 46/101 (46%), Gaps = 4/101 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VWL+LP LP   +  + +  I    GR +     T    +   A+V++E+D       
Sbjct  170  TVVWLRLPSLPTEYWSKETIWGIAAKAGRPLALDKVTDEGRKLGFARVKVEVDAGAPFRP  229

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
              +I+ G     D  WQ    E LP FC  C+R GH  G C
Sbjct  230  GTFIKVGS----DLHWQAFRYESLPGFCFKCARLGHEEGAC  266



>gb|KDO54331.1| hypothetical protein CISIN_1g037263mg, partial [Citrus sinensis]
Length=155

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 11/112 (10%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             + W+QLP + +H +   +L  I + +G++V         TR   A++ IE+ + K +  
Sbjct  29   VIAWIQLPGMALHYYHKLILWMIGQTVGKVVRINYNMESATRGKFARIAIEVTLSKPLVS  88

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRRE  417
            +          LDG  QKV+ E LPN    CS++GH   +C+    R+ R E
Sbjct  89   QFL--------LDGKVQKVKYENLPNISFGCSKYGH---SCESCPDRVMRNE  129



>ref|XP_008782044.1| PREDICTED: uncharacterized protein LOC103701669 [Phoenix dactylifera]
 ref|XP_008782045.1| PREDICTED: uncharacterized protein LOC103701669 [Phoenix dactylifera]
 ref|XP_008782046.1| PREDICTED: uncharacterized protein LOC103701669 [Phoenix dactylifera]
Length=247

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++LP LP+  ++ + +  I    GR +     T +  +   A+V++EI+    +  
Sbjct  142  TVVWIRLPCLPLEYWERESILDIAAAAGRPLAVDYCTAQLQKLGYARVKVEINAITLLKL  201

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
              +I+  E      FWQ    E LP FC +C+R GHL  +C+
Sbjct  202  GTFIQREE----QRFWQAFVYENLPAFCFSCARIGHLESSCQ  239



>ref|XP_009800930.1| PREDICTED: probable basic-leucine zipper transcription factor 
Q [Nicotiana sylvestris]
Length=425

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 2/82 (2%)
 Frame = -2

Query  686  ICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGEGGG--LDGFWQKVE  513
            + E +G  +    AT  + R NVAK+++E+D+ K   D+IW+ F   G    DG+W  +E
Sbjct  1    MVESVGTAMAPDLATFSKFRGNVAKLKVEVDLLKPRQDQIWVGFKRLGSNEEDGYWLDIE  60

Query  512  VERLPNFCVACSRFGHLVGNCK  447
             E  P +C  C   GH   +C+
Sbjct  61   YEDAPAYCQYCLMQGHSQSSCR  82



>ref|XP_009779392.1| PREDICTED: uncharacterized protein LOC104228608 [Nicotiana sylvestris]
Length=232

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+ LP LP + F    L  I   +G+ +    A   RTRP+ A+V++ +D+      
Sbjct  76   AVVWISLPDLPANFFAKRSLMSIASAVGKPLAVDKAMQDRTRPSTARVKVVLDLLDKHPK  135

Query  572  RIWIEFGE--GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVR  432
            RI I   +   G +   +Q++  + LP +C  C   GH   +C+   V+
Sbjct  136  RIKIHIMDKNSGKVVEHYQEIVYDNLPKYCTYCKHQGHDERSCRWKTVK  184



>gb|KDO38897.1| hypothetical protein CISIN_1g046520mg [Citrus sinensis]
Length=369

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (51%), Gaps = 9/106 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++LP +P+H +   VL  + E +GR++     T    R   A+V +EI + K +  +
Sbjct  97   VAWIRLPGMPLHYYHKRVLRILGEVVGRVIRIDYNTEAAKRGKFARVAVEICLNKPLVSQ  156

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK-QTEV  435
                      L+G  Q++E E LP  C  C ++GH V  C+ Q EV
Sbjct  157  F--------QLNGKIQRIEYEGLPTICFECGKYGHTVDTCQWQQEV  194



>ref|XP_006577696.1| PREDICTED: uncharacterized protein LOC102664242 [Glycine max]
Length=449

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 18/127 (14%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++L+    + +I   +G+ +       +R R + A++ +EID+ + +   +
Sbjct  254  IWIKLPQLPLYLWGAKTMGKIGSILGKPIVTDECKAQRLRISYARMLVEIDITQEMPKEV  313

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR------------  423
             I   EG  L    Q VE E  P +C  C +FGH+   C++ +VR  +            
Sbjct  314  TIADNEGHEL---IQAVEYEWKPKYCGKCKKFGHV---CEKPKVRKEKVWVPKPTLKSNE  367

Query  422  REERGTS  402
            +EERG S
Sbjct  368  QEERGPS  374



>ref|XP_006375693.1| hypothetical protein POPTR_0014s19700g, partial [Populus trichocarpa]
 gb|ERP53490.1| hypothetical protein POPTR_0014s19700g, partial [Populus trichocarpa]
Length=367

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 49/110 (45%), Gaps = 3/110 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+  +    LS++   IG+ V   S T   TR + A+V IEID++  +   I
Sbjct  122  IWVRFPNLPLQCWSPPCLSKLVSVIGKPVHADSPTSSMTRLSYARVLIEIDLFAELPSLI  181

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRRE  417
             I    G       Q V  E LP FC  C   GH    C       R++ 
Sbjct  182  DITLPNGVSKA---QVVVYESLPRFCKQCKTLGHSTSACNSASSHKRKKH  228



>ref|XP_006595286.1| PREDICTED: uncharacterized protein LOC102660169 [Glycine max]
Length=224

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP+HL+    +S+I   +G+ +     T ++ R + A+V +E+D+ +   + +
Sbjct  11   IWITLPQLPLHLWGERSISKIASVVGKPITTDECTAKKLRISYARVLVEVDITQKPIETV  70

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
             I   +G  ++   QK+E E  P +C +C + GH
Sbjct  71   DIMDHKGKLVE---QKIEYEWRPMYCQSCLKIGH  101



>gb|AAT38805.1| hypothetical protein SDM1_47t00008 [Solanum demissum]
Length=1155

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = -2

Query  647  ATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGEG-GGLDGFWQKVEVERLPNFCVACSRF  471
            AT  ++RP +AK+R+E+D+ K     + +E     GGL+ F QKVE E LP FC  C   
Sbjct  4    ATSTKSRPTIAKLRVELDLAKPRIREVVVEIRNAEGGLEMFTQKVEYEDLPEFCSHCITQ  63

Query  470  GHLVGNCKQTEVRLRRREERGTSLT  396
            GH    C+   V L+R + +   +T
Sbjct  64   GHTNDKCR---VVLQRNQSKKVQVT  85



>ref|XP_010689623.1| PREDICTED: uncharacterized protein LOC104903305 [Beta vulgaris 
subsp. vulgaris]
Length=335

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ +  + LSRI   +G  +     T +  R + A++ IEIDV K     I
Sbjct  120  IWVKLPNLPLNCWSDNSLSRIGSVLGVPIYADECTTKMLRVSFARILIEIDVTKPATKEI  179

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             +E   G     F Q+VE + LP FC  C + GH   NC+
Sbjct  180  IVEDPSG---RKFVQRVEYDWLPAFCNKCQKIGH---NCE  213



>ref|XP_009793772.1| PREDICTED: uncharacterized protein LOC104240602 [Nicotiana sylvestris]
Length=306

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 2/102 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P LP  LF    L  I   +G+ +    AT  R+RP+ A+V++ +D+ +   ++I
Sbjct  198  VWISFPSLPPELFARRALMSIAATVGKPIAIDKATQLRSRPSTARVKVILDILEKHPEQI  257

Query  566  WIEF-GEG-GGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             +++  EG G +    Q+V  + LP +C  C   GH   NC+
Sbjct  258  RLKYVDEGTGKIVEQLQQVTYDNLPLYCNHCKHQGHDESNCR  299



>ref|XP_010689805.1| PREDICTED: uncharacterized protein LOC104903466 [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 59/122 (48%), Gaps = 10/122 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+H +  D LSRI   +G  +     T +  R +  +V IE+D+ K +   I
Sbjct  120  IWVKFPNLPLHYWSGDSLSRIGSLLGIPIYADECTFKALRVSFVRVLIEMDITKEIPKEI  179

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             I   E  G+  F QKV  +  P FC  CS  GH   NC+     LR   +  T +  K 
Sbjct  180  HIV--EPSGM-SFSQKVTYDWRPAFCTKCSTIGH---NCEN----LRSNPKPQTKVIPKW  229

Query  386  VP  381
            VP
Sbjct  230  VP  231



>ref|XP_011101715.1| PREDICTED: uncharacterized protein LOC105179777 [Sesamum indicum]
Length=225

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/177 (25%), Positives = 74/177 (42%), Gaps = 11/177 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++L  LP+  +  + LS +   +G+ +   + T   TR + A+V + +DV +++   I
Sbjct  13   IWIKLRHLPMEYWTMEGLSTVASVVGKPLYPDAITRACTRLDFARVCVMLDVTQTLRKHI  72

Query  566  WI-EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCK  390
             I    E GG       VE E LP  C +C   GH+  +C+  +     +      +   
Sbjct  73   IIMTPNEDGGETPCKIDVEYEWLPPKCTSCITIGHMTKDCELNKPLKPTKTPVAVYIPKV  132

Query  389  NVPMTPGVIRKEDGQTP----------NVDDSGQGTEKVEADISFKDNEMKSPNQRG  249
            NV   P    K   Q P          N+D +G G  +   D   K++     N RG
Sbjct  133  NVSQPPPATEKNISQPPPATEKNRKASNIDSTGVGAPRKAEDEKHKEHNADKHNDRG  189



>ref|XP_008778888.1| PREDICTED: uncharacterized protein LOC103698628 [Phoenix dactylifera]
Length=195

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 49/101 (49%), Gaps = 0/101 (0%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VWL+LP LP+  ++   + +I    G+ +   + T +  R   A+ +IE+D    V  
Sbjct  49   VVVWLRLPHLPLEYWEKSTILQIASKAGKPLALDNFTDQGKRLGFARDKIEVDFKSPVRP  108

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             I+++    G  + FWQ    E L  FC  C R GH+   C
Sbjct  109  GIFVKGRTEGSKEKFWQVFIYENLSAFCCRCGRIGHVEAAC  149



>ref|XP_006376764.1| hypothetical protein POPTR_0012s06220g, partial [Populus trichocarpa]
 gb|ERP54561.1| hypothetical protein POPTR_0012s06220g, partial [Populus trichocarpa]
Length=292

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 3/110 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++LP LP+  +    LS++   IG+ +     T   TR + A++ IE+D+ + + D I
Sbjct  159  TWVKLPNLPLRCWTPLCLSKLAGMIGKPIHCDVPTANMTRLSYARILIEVDLLQELLDAI  218

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRRE  417
             +    G     F Q+V  E LP FC  C   GH    C +  V  R+  
Sbjct  219  QVVLPNG---TPFSQQVTYESLPRFCKRCRVIGHSANTCNRPPVPHRKNN  265



>ref|XP_010677868.1| PREDICTED: uncharacterized protein LOC104893461 [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 65/133 (49%), Gaps = 11/133 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+H    D LSRIC  +G  +       +  R + A+V IE+D+ K +    
Sbjct  137  IWVKLPNLPLHYLSDDSLSRICSLLGVPIYADECNTKALRMSFARVLIEMDITKEIHRE-  195

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             ++  E  G+  F  KV  + LP FC  CS  GH   NC      L+   +  T L  K 
Sbjct  196  -LKIVEPTGV-TFTLKVIYDWLPAFCHKCSIIGH---NCDG----LKANPKAPTKLIKKW  246

Query  386  VP-MTPGVIRKED  351
            VP + P V R E+
Sbjct  247  VPKVIPPVERIEE  259



>ref|XP_009783588.1| PREDICTED: uncharacterized protein LOC104232162 [Nicotiana sylvestris]
Length=301

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 3/100 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P LPI  +  + L RI   IG  +     T +  R + A++ IE+DV + + + I
Sbjct  72   VWVNFPELPIKYWTVENLGRIASSIGNPICTDKLTAQEARISYARMLIEMDVSQPLPETI  131

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             IE  EG   +   Q++  +  P FC  C   GH  G C+
Sbjct  132  LIEMAEGKNRE---QRLSYDWQPTFCQDCLVIGHGTGECR  168



>ref|XP_009600598.1| PREDICTED: uncharacterized protein LOC104096022 [Nicotiana tomentosiformis]
Length=201

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP+  +  + L RI   +G+ +     T    R + A++ +E+D+ + + + I
Sbjct  105  IWVNLPGLPVQCWAEENLGRIASLLGKPICTDKLTTECERISYARILVEMDITQPLPEEI  164

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             I+  +G     + Q+V+ E  P FC+ C++FGH  G C+
Sbjct  165  LIKKPDG---RSWMQRVDFEWKPKFCLDCNKFGHSTGECQ  201



>ref|XP_009610911.1| PREDICTED: uncharacterized protein LOC104104509 [Nicotiana tomentosiformis]
Length=180

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 3/103 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W+ LP LPI  +  + L RI   +G+ +     T +  R + A++ ++ID+ +   + +
Sbjct  72   TWVILPGLPIQYWTTENLGRITSYLGKPLCTDKLTAQGDRISYARILVDIDISQPFPEYV  131

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE  438
             IE  +GG  +   Q++E E  P++C  C + GH  GNCK+ +
Sbjct  132  LIEDEKGGYKE---QRLEYEWKPSYCQDCLQIGHNTGNCKKEQ  171



>ref|XP_003604531.1| hypothetical protein MTR_4g014190 [Medicago truncatula]
Length=382

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 75/154 (49%), Gaps = 22/154 (14%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+QLP LP+  +  D LSRI   +G  +     T +++R + A++ +EIDV + +  ++
Sbjct  218  LWIQLPNLPLTCWGLDFLSRIGSTLGNPLFADECTSKQSRISYARLLVEIDVTRPLLYKV  277

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             +E  +G     F Q++  +  P+FC  C + GH+   C +   +   R ++        
Sbjct  278  MVESPDGK---CFEQRIVYDWEPSFCKKCQQVGHV---CDKQSFQPVERPKKDW------  325

Query  386  VPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISF  285
            +P T            N+ D G+  EK+ +DI +
Sbjct  326  IPKT----------QVNLVDKGKQPEKINSDIEW  349



>ref|XP_010686465.1| PREDICTED: uncharacterized protein LOC104900672 [Beta vulgaris 
subsp. vulgaris]
Length=389

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 6/102 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+QLP LP+  +    LSRI   +G  +     TI +TR + A++ IEID       ++
Sbjct  207  VWIQLPNLPLSCWGTKSLSRIGSVLGTPIVADDFTINQTRISYARLLIEIDATIPPVKQL  266

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
             +E   GG    F Q V  E  P FC  C R GH   NC  T
Sbjct  267  MVENPNGG---TFKQNVVYEWEPVFCKKCQRVGH---NCDAT  302



>ref|XP_010686029.1| PREDICTED: uncharacterized protein LOC104900325 [Beta vulgaris 
subsp. vulgaris]
Length=326

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 3/102 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ +  D LSRI   +G  +     T ++ R + A++ +EIDV K +  ++
Sbjct  144  LWIKLPNLPLNYWSADSLSRIGSLLGVPLYADECTSKQIRISFARILVEIDVTKDIQYQV  203

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
              E   G  +    Q+V+ + LP FC  C + G+  GN KQ 
Sbjct  204  NFEDANGVIIK---QQVKYDWLPPFCKICQKVGYDCGNRKQA  242



>ref|XP_006598642.1| PREDICTED: uncharacterized protein LOC102666350 [Glycine max]
Length=465

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (49%), Gaps = 4/125 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+ L+    L++I   IG  +     T ++ R + A++ +E+D  + + + I
Sbjct  3    IWVKLPQLPLCLWGLKSLNKIGSAIGNPLMTDECTTQKLRVSYARILVEVDTTQKLVEEI  62

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             I    GG +    Q VE E  P FC  C + GH  G  K+   +   R ++   +    
Sbjct  63   TISDRTGGKIK---QIVEYEWKPEFCEKCQKAGHQCGK-KKVVKKWIPRNKQADEVKADP  118

Query  386  VPMTP  372
            +P TP
Sbjct  119  LPKTP  123



>ref|XP_008805281.1| PREDICTED: uncharacterized protein LOC103718305 [Phoenix dactylifera]
Length=442

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VWL+LP LP+  ++ +++ R+    GR +    AT +  +   A+V+IE+D+   +   
Sbjct  52   VVWLRLPRLPLDYWEKEIILRLAAKAGRPLALDGATDQGKKRGFARVKIELDISAPLKPG  111

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEV  435
            +++     G    FWQ    E L  +   C R GH   NC    V
Sbjct  112  MFVNGVMEGCEGKFWQAFVYENLSEYYFRCGRVGHGRANCASNPV  156



>gb|KDO59838.1| hypothetical protein CISIN_1g037799mg [Citrus sinensis]
Length=131

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 48/94 (51%), Gaps = 8/94 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++LP L +HL++  +L ++ E +G ++     T    R   A++ + + + K +  + 
Sbjct  31   VWIRLPGLAVHLYNRKILQKLGELVGIVIRIDPHTASSARGRFARIAVRLSLDKPLVSQF  90

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
                     LDG  QKVE E LP  C  C R+GH
Sbjct  91   --------VLDGKVQKVEYEGLPVICFTCGRYGH  116



>ref|XP_010681834.1| PREDICTED: uncharacterized protein LOC104896742 [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 58/105 (55%), Gaps = 3/105 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP L +  +    L +I   +G L++   AT  R +   A+V +EI + +++ D +
Sbjct  166  IWIKLPQLDLKYWGERSLEKIAGLVGPLIKMDQATKLREKLLFARVLVEIQIEQNLPDAV  225

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVR  432
            + E  +G  ++   Q+VE E  P  C  C  +GH+V NC+ T+ +
Sbjct  226  FFENEKGIVVE---QRVEYEWRPLSCSKCKNYGHVVENCRATQAK  267



>ref|XP_011071645.1| PREDICTED: uncharacterized protein LOC105157045 [Sesamum indicum]
Length=507

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (51%), Gaps = 4/99 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P LP HLF  +VL  +   IG  ++   AT+ +++ + A+  IE+D+ K   +  
Sbjct  215  VWVSFPELPAHLFRKEVLFTVASMIGTPLQIDDATLNQSKLSKARACIELDLLKPRLENF  274

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             I+           Q++E E +P++C  C   GH   +C
Sbjct  275  QIQICGT----TIVQRIEYEDIPHYCSLCKHVGHQDSDC  309



>gb|KHN26207.1| hypothetical protein glysoja_035500, partial [Glycine soja]
Length=540

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 6/109 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+HL+    L++I   IG  +     T  + R + A++ +E+D+ K++   +
Sbjct  168  LWVKLPKLPLHLWGVKSLNKIGSAIGVPLVTDECTASKIRVSYARILVEVDITKTLVKEV  227

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRR  420
             I+  EG  +    Q VE E  P +C  C + GH    CK+  ++  ++
Sbjct  228  TIKDYEGRKIS---QGVEYEWRPLYCEKCHKLGH---QCKKNGIKKEKQ  270



>ref|XP_003625646.1| hypothetical protein MTR_7g101400 [Medicago truncatula]
Length=459

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 4/100 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+QL  LP   +    L  I   +G  +   +AT++R   + A++ ++ID  K +F  I
Sbjct  150  VWIQLMALPQEYWMEQTLREIASAVGTPLVLDNATLKRLFGHYARILVDIDFSKRIFHEI  209

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             +E  EG     +  +V  +R+P+FC  C   GH V NC+
Sbjct  210  IVE-REGAS---YPVEVVYKRIPDFCSHCQTLGHDVTNCR  245



>gb|KDO39120.1| hypothetical protein CISIN_1g048696mg [Citrus sinensis]
Length=248

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++LP +P+H +   +L  +   IG+++     T   TR   A++ +++ + K +  +
Sbjct  76   IAWIRLPGMPLHYYHKCILRMLGLIIGKVLRIDYNTESATRGKFARIAVQVALNKPLMSQ  135

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
                      LDG  QK+E E LP  C  C ++GH++  C
Sbjct  136  FL--------LDGKIQKMEYESLPTICFECGKYGHVLSEC  167



>ref|XP_009784900.1| PREDICTED: uncharacterized protein LOC104233234 [Nicotiana sylvestris]
Length=381

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 2/121 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+  P LP + F    L  I   +G+ +    A   RTRP+ A+V++ +D+      
Sbjct  162  AVVWISFPDLPPNYFAKKSLMSIASAVGKPLAIDKAMKDRTRPSAARVKVLLDLLDKHPK  221

Query  572  RIWIEFGEG--GGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL  399
            ++ I   +   G  + F QKV  + LP +C  C   GH   +C+  + R +  +E    +
Sbjct  222  KVKISVVDKICGKSNDFSQKVIYDYLPMYCTCCKHQGHDEISCRAMKGRNKNAKENTEQI  281

Query  398  T  396
            +
Sbjct  282  S  282



>ref|XP_006589932.1| PREDICTED: uncharacterized protein LOC102669251 [Glycine max]
Length=231

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++L+    L++I   IG  +     T  + + + A++ +E+D+ + + + I
Sbjct  38   IWIKLPKLPLYLWGERSLNKIGSAIGTPMVTDECTTHKLKVSYARMLVEVDITRKLVEEI  97

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGN  453
             I+  +G  +    Q +E E  P FC  C + GH  GN
Sbjct  98   AIKDKDGRKI---MQPIEYEWRPKFCDKCQKIGHQCGN  132



>ref|XP_010694057.1| PREDICTED: uncharacterized protein LOC104906925 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 65/123 (53%), Gaps = 12/123 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+  P LP++ +  D LSRI   +G  +     T ++ R + A++ IE+DV  +V + I
Sbjct  120  IWVTFPNLPLNCWSMDSLSRIGSTLGVPIYADECTTKQLRISFARILIEMDVTGAVKEEI  179

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             +E   G     F Q+V    LP FC  C + GHL   C++     R+++ +G  +T K 
Sbjct  180  NVEDPNG---RVFKQRVSYAWLPPFCNKCQKVGHL---CEE-----RKKQVKG-KVTQKW  227

Query  386  VPM  378
            +P+
Sbjct  228  IPV  230



>ref|XP_007019767.1| Uncharacterized protein TCM_036083 [Theobroma cacao]
 gb|EOY16992.1| Uncharacterized protein TCM_036083 [Theobroma cacao]
Length=153

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 45/96 (47%), Gaps = 3/96 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + IG  +     T   TRP+VA+V IE D  K   D +
Sbjct  52   VWISFPNLKAHLFEKSALLLIAKAIGNPLCIDETTANGTRPSVARVCIEYDCLKPPVDSV  111

Query  566  WIEFGEGGGLD---GFWQKVEVERLPNFCVACSRFG  468
            WI   + G  D   G+ QKVE  R  N  +  +   
Sbjct  112  WIVVSKRGSKDMSGGYLQKVEFLRCRNTVIIVATLA  147



>gb|KHN42237.1| hypothetical protein glysoja_044118, partial [Glycine soja]
Length=228

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP+ L+    L++I   IG  +     T ++ R + A++ +E+D+ + + + I
Sbjct  122  IWVKLPQLPLCLWGLKSLNKIGSAIGNPLMTDECTAQKLRVSYARILVEVDITQKLVEEI  181

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             I    GG +    Q VE E  P FC  C + GH  G  K
Sbjct  182  TISDRTGGKIK---QIVEYEWKPEFCEKCQKAGHQCGKKK  218



>ref|XP_003609254.1| hypothetical protein MTR_4g113700 [Medicago truncatula]
Length=484

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 53/101 (52%), Gaps = 8/101 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++ P L +  +D  +L  +   +G+ ++  + T++  R   A+V +EID+   V  
Sbjct  174  TVVWVRFPGLNLVYYDESLLLAMATTLGQPIKVDTNTLKVERGKFARVCVEIDLTVPVVG  233

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            +IW+        +G W KV+ + L   C  C  +GHL  NC
Sbjct  234  KIWV--------NGHWYKVQYKGLHLICTNCGCYGHLGRNC  266



>ref|XP_009759323.1| PREDICTED: uncharacterized protein LOC104211883 [Nicotiana sylvestris]
Length=207

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/171 (22%), Positives = 75/171 (44%), Gaps = 21/171 (12%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T +W++LP LP   +D  +L+++   IGRL++  + T    R   A++ +E+ + K V  
Sbjct  36   TAIWIRLPELPTKFYDEKILNKVGNTIGRLLKVDACTSAALRGRYARICVELPLNKQVKS  95

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
             +WI   +        Q++  E     C+ C   GH  G C  T+++             
Sbjct  96   SVWIGSHK--------QQILYECDKLLCLNCGFLGHSTGQCVTTKIQ-------------  134

Query  392  KNVPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISFKDNEMKSPNQRGLVT  240
                +T G   +++GQ+ ++        + E   + ++++  S  +   VT
Sbjct  135  PYTSITKGKDAEKEGQSNSIQAYQYNITQEEQHKALQEDQHTSKEEWQAVT  185



>gb|KDO39032.1| hypothetical protein CISIN_1g043150mg, partial [Citrus sinensis]
Length=588

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 57/118 (48%), Gaps = 8/118 (7%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++L  + IH +  +++  + + IG +V+  S TI   R   +++ +E+D+ K +  +
Sbjct  183  VAWIRLSEMNIHFYHKNIIRWLGQIIGPVVKIDSNTITAQRGKFSRLAVELDLQKPLVSQ  242

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLT  396
                      L+G  QKVE E LP  C  C +FGH    C  +       +E   SLT
Sbjct  243  F--------NLEGRIQKVEYENLPTICFGCGKFGHYREACPDSVDITHTAKEDQLSLT  292



>ref|XP_008800940.1| PREDICTED: uncharacterized protein LOC103715176 [Phoenix dactylifera]
Length=269

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + WL+LP LP+  +  + L +I    G+ +   +AT +  +   A+V++E+D+   +   
Sbjct  171  VAWLRLPRLPLDFWAKETLLQIASTAGKPLALDAATDQGKKRGFARVKVELDIRAPLKPG  230

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
            I+++  + G     WQ    E LP +C  C R GH
Sbjct  231  IFLKGAKEGLERKIWQDFVYENLPEYCYRCGRIGH  265



>ref|XP_007052625.1| Uncharacterized protein TCM_005953 [Theobroma cacao]
 gb|EOX96782.1| Uncharacterized protein TCM_005953 [Theobroma cacao]
Length=1659

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 11/106 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HL D   L  +   +G+ +    AT  R  P+VA+V +E D  K   D I
Sbjct  96   VWISFPNLSAHLHDKSALMMVARTVGKPLFVDEATANRICPSVARVCVEYDCQKPPLDHI  155

Query  566  WI-------EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            WI       E   G    G  Q+VE  +LP +C      GH +  C
Sbjct  156  WIVSRNRKTETMTG----GLSQRVEFAKLPKYCRHYCHVGHAMTEC  197



>ref|XP_008800194.1| PREDICTED: uncharacterized protein LOC103714647 [Phoenix dactylifera]
Length=1799

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 43/100 (43%), Gaps = 4/100 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VWL+LP LP   +    L  I    GR +     T  R     A+V++ ID  + +   I
Sbjct  311  VWLRLPGLPPEYWSTSTLLEIAAKAGRPLAVDRVTEERRAMGFARVKVSIDASEPLLPGI  370

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             I     G     WQ    E LP+ CV C R GHL   C+
Sbjct  371  RIL----GKTKALWQPFVFESLPDLCVRCGRIGHLESGCR  406



>ref|XP_003599472.1| Defensin-like protein [Medicago truncatula]
Length=255

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 4/107 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++L  LP   +    L  I   +G  ++   AT  RT  + A++ +++D+ K  FD I
Sbjct  18   VWIRLLELPQENWRPKTLFEIANGVGTPLDLDVATKNRTFGHYARILVDMDLSKRFFDEI  77

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLR  426
             +E  EG     F+  +  E +P +C  C+  GH +G CK   VRL 
Sbjct  78   LVE-CEGFS---FYVDIAYEWVPAYCRNCATIGHAIGQCKWLRVRLH  120



>ref|XP_006378895.1| hypothetical protein POPTR_0009s00290g [Populus trichocarpa]
 gb|ERP56692.1| hypothetical protein POPTR_0009s00290g [Populus trichocarpa]
Length=244

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 53/122 (43%), Gaps = 5/122 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS++   IG+ +   + T   TR + A+V +EID+   +   I
Sbjct  3    VWIRFPNLPLQCWSPICLSKLASVIGKPLHLDTPTSSMTRLSYARVLVEIDLLADLPAMI  62

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC--KQTEVRLRRREERGTSLTC  393
                  G  +    Q V  E LP FC  C   GH   +C       R +R +   T   C
Sbjct  63   NFSLPNGVTMT---QNVLYELLPRFCKQCRSLGHSTSSCATNSNHKRKKRGQPTPTPSGC  119

Query  392  KN  387
             N
Sbjct  120  SN  121



>ref|XP_003606538.1| hypothetical protein MTR_4g061520 [Medicago truncatula]
Length=335

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 4/103 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++L  LP   +    L  I   +G  +    AT+ R     A+V +++D+Y  +FD +
Sbjct  159  IWVRLMHLPQEYWRKKTLFEIASGLGTPLTIDEATLSRKFGLYARVLVDVDLYSQLFDSV  218

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE  438
             +E  EG  L      V+ ER P FCV C   GH   NCK+ +
Sbjct  219  VVE-SEGFALP---ISVQYERKPMFCVQCKMLGHSTHNCKKLQ  257



>gb|KDO36602.1| hypothetical protein CISIN_1g037725mg, partial [Citrus sinensis]
Length=276

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++LP +P+H +   +L  +   IG+++     T   TR   A++ +++ + K +  +
Sbjct  140  IAWIRLPGMPLHYYHKCILRMLGLIIGKVLRIDYNTESATRGKFARIVVQVALNKPLVSQ  199

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
                      LDG  QK+E E LP  C  C ++GH++  C
Sbjct  200  FL--------LDGKIQKMEYESLPTICFECGKYGHVLSEC  231



>ref|XP_009604860.1| PREDICTED: uncharacterized protein LOC104099538 [Nicotiana tomentosiformis]
Length=341

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 15/125 (12%)
 Frame = -2

Query  686  ICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGE-GGGLDGFWQKVEV  510
            +   +G  +     T  ++R NVA V++EID+ K   + +W+ F    G  DG W ++E 
Sbjct  1    MISAVGHAIAPDQDTYSKSRGNVAMVKVEIDLLKPKLNELWLGFKRLDGSEDGEWLQIEY  60

Query  509  ERLPNFCVACSRFGHLVGNC--KQTEVRLRRREERGTSLTCKNVPMTPGVIRKEDGQTPN  336
            E +P++C  C   GH    C  K  + R++++ E         V   P +I       PN
Sbjct  61   EDVPSYCNYCKLHGHNEIQCWTKARDERIKKQMEE--------VQSNPVIIT----HVPN  108

Query  335  VDDSG  321
            V+  G
Sbjct  109  VNSDG  113



>ref|XP_011094921.1| PREDICTED: uncharacterized protein LOC105174492 [Sesamum indicum]
Length=171

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P LP HLF  +VL  +   I   ++   AT+ +++ + A+  IE+D+ K   +  
Sbjct  21   VWVSFPKLPAHLFRKEVLFTVASMIETPLQIDDATLNQSKLSKARACIELDLLKPRLEDF  80

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             I+           Q++E E +P++C  C   GH   +C
Sbjct  81   QIQICGA----TIVQRIEYEDIPHYCSLCKHVGHRDSDC  115



>ref|XP_006382571.1| hypothetical protein POPTR_0005s034102g, partial [Populus trichocarpa]
 gb|ERP60368.1| hypothetical protein POPTR_0005s034102g, partial [Populus trichocarpa]
Length=429

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 3/114 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS++   IG+ +   + T   +R + A+V +E D+   +   I
Sbjct  189  VWIRFPNLPLQCWSPICLSKLASVIGKPLHLDTPTSSMSRLSYARVLVETDLLADLPATI  248

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGT  405
             I    G  +    Q V  E LP FC  C   GH   +C       RR+  + T
Sbjct  249  NISLPNGVTMT---QNVLYESLPRFCKQCRSLGHSTSSCATNSSHKRRKRGQPT  299



>ref|XP_010695579.1| PREDICTED: uncharacterized protein LOC104908189 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ +  + LSRI   +G  V     T +  R + A++ +EIDV K +   I
Sbjct  44   IWIRLPNLPLNCWSENSLSRIGSLLGVPVYADECTTKTLRISFARILVEIDVTKEILYEI  103

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             IE   G     F QKV  + LP FC  C   GH   NC+
Sbjct  104  AIEDPTGA---VFKQKVVYDWLPEFCKKCQVIGH---NCE  137



>ref|XP_009801511.1| PREDICTED: uncharacterized protein LOC104247246 [Nicotiana sylvestris]
Length=304

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 50/104 (48%), Gaps = 2/104 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            ++VW+ LP LP ++F    L  I   +G+ +     T  RTRP+ A+V+I +D+      
Sbjct  168  SVVWISLPDLPPNIFAKKSLLSIASAVGKPLAVDKETQDRTRPSAARVKILLDLLDKHPK  227

Query  572  RIWIEF--GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            R+ +       G     +Q+V  + LP FC  C   GH    C+
Sbjct  228  RVKLHIVDKSTGKFVEHYQEVVYDNLPKFCTFCKHQGHEERTCR  271



>gb|KDO70278.1| hypothetical protein CISIN_1g046866mg, partial [Citrus sinensis]
Length=583

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (49%), Gaps = 8/103 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++L  + I  +   ++ R+   IG +++  + TI   R   A++ +E+D+ K +  +
Sbjct  182  VAWIRLSQMNIQFYHKSIIRRLGHIIGPVIKIDNNTITAQRGKFARLAVELDLQKPLVSQ  241

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
                      L+G  QKVE E LP  C  C +FGH    C  +
Sbjct  242  F--------NLEGRIQKVEYENLPTICFGCGKFGHFKDTCPDS  276



>ref|XP_008780476.1| PREDICTED: uncharacterized protein LOC103700307, partial [Phoenix 
dactylifera]
Length=278

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 0/100 (0%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            ++WL+LP LP+  +  + + ++    G  +     T  R R   A+V++E+D    +   
Sbjct  171  VLWLRLPSLPLDFWKKNTIFKVAARAGNPLGLDGFTEDRRRYGYARVKVELDASAPLVPG  230

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             W+      G   FWQ    E LP  C  C R GH    C
Sbjct  231  TWVLGRSADGASKFWQGFVYENLPAPCSLCGRVGHWPAVC  270



>ref|XP_009783436.1| PREDICTED: uncharacterized protein LOC104232043 [Nicotiana sylvestris]
Length=339

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (49%), Gaps = 2/109 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+ LP LP + F    L  I   +G+ +    AT  RTRP+ A+V++ +D+      
Sbjct  168  AVVWISLPDLPANFFAKRSLMSIASAVGKPLAVDKATQDRTRPSTARVKVVLDLLDKHPK  227

Query  572  RIWIEFGE--GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVR  432
            RI I   +   G +   +Q++  + LP +C      GH   +C+   V+
Sbjct  228  RIKIHIMDKNSGKVVEHYQEIVYDNLPKYCTCYKHQGHDERSCRWKTVK  276



>ref|XP_008782095.1| PREDICTED: uncharacterized protein At4g02000-like [Phoenix dactylifera]
Length=246

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 50/101 (50%), Gaps = 4/101 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T++WL LP LP+     +++  I    GR +     T +  +   A+V++E+D  + +  
Sbjct  82   TVIWLWLPSLPMEYRTKELIWNIAAKAGRPLVQDKVTDQGRKLGFARVKVEMDACEPIRP  141

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
              +I+ G     D  W+    E LP+FC  C+R GH  G C
Sbjct  142  ETFIQVGA----DLHWRAFRYENLPSFCYRCARLGHGEGAC  178



>ref|XP_011016272.1| PREDICTED: uncharacterized protein LOC105119785, partial [Populus 
euphratica]
Length=1625

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 3/99 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS+I   +GR V+    T    R + A+V +E+++   +   I
Sbjct  333  VWVKFPNLPLKCWSLKCLSKIASVLGRPVQSDMFTASMARLSYARVLVEVNLLSDLPSSI  392

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             +    G  L    Q+V  E LP FC  C + GHL   C
Sbjct  393  EVTLPNGHILH---QQVVYETLPRFCKHCRKLGHLTSTC  428



>ref|XP_011004665.1| PREDICTED: uncharacterized protein LOC105111104, partial [Populus 
euphratica]
Length=1714

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 3/99 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS+I   +GR V+    T    R + A+V +E+++   +   I
Sbjct  333  VWVKFPNLPLKCWSLKCLSKIASVLGRPVQSDMFTASMARLSYARVLVEVNLLSDLPSSI  392

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             +    G  L    Q+V  E LP FC  C + GHL   C
Sbjct  393  EVTLPNGHILH---QQVVYETLPRFCKHCRKLGHLTSTC  428



>ref|XP_010693202.1| PREDICTED: uncharacterized protein LOC104906181 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 58/112 (52%), Gaps = 6/112 (5%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ +  D LSRI   +G  +    +T ++ R + A++ +EIDV K     I
Sbjct  22   IWVKLPNLPLNCWSPDSLSRIGSLLGIPLYADESTSKQMRISFARILVEIDVTKEKTQSI  81

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREER  411
             +E   G  +    Q V  +  P FC  C + GH   NC + + + ++ + +
Sbjct  82   MVEDANGKIIK---QDVRYDWWPPFCQKCQKIGH---NCGEKQFKPQQNKPK  127



>ref|XP_008782110.1| PREDICTED: uncharacterized protein LOC103701725 [Phoenix dactylifera]
Length=311

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 47/101 (47%), Gaps = 4/101 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VWL+LP LP+  +  +++  I    G+ +     T +  +   A+V++E+D       
Sbjct  182  TIVWLRLPSLPMEYWSKEMIWGIAAKAGQPLALDKVTDQGRKLGFARVKVEVDAGAPFRP  241

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
               I+ G     D  WQ    E  P FC  C+R GH  G C
Sbjct  242  GTLIKVGS----DLHWQAFRYESQPGFCFKCARLGHEEGAC  278



>ref|XP_010666802.1| PREDICTED: uncharacterized protein LOC104883924 [Beta vulgaris 
subsp. vulgaris]
Length=201

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 51/97 (53%), Gaps = 3/97 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ +  D LSRI   +G  +     T ++ R + A++ +EIDV K     I
Sbjct  22   IWVKLPNLPLNCWSPDSLSRIGSLLGIPLYADECTSKQMRISFARILVEIDVTKDKTQFI  81

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVG  456
             +E   G  +    Q+V+ +  P FC  C + GH  G
Sbjct  82   LVEDANGKTIR---QEVKYDWWPPFCQKCQKIGHTCG  115



>ref|XP_009802092.1| PREDICTED: uncharacterized protein At4g02000-like [Nicotiana 
sylvestris]
Length=216

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (46%), Gaps = 12/127 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP   +D ++   I   +GRL++  + T   TR   A++ IE+ + K +   +
Sbjct  72   LWVRLPELPTEFYDLEIFGMIGSKLGRLLKIDTCTSSTTRGRYARIYIEVPLEKPLKTHL  131

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL----  399
            +I            Q +  + L   C +C  FGH   NC ++    + + E    L    
Sbjct  132  YI--------GNHRQTLLYKGLNILCTSCGGFGHPANNCPESITVTKDQNEENKQLQSTT  183

Query  398  TCKNVPM  378
            +  N+P+
Sbjct  184  STNNIPL  190



>ref|XP_007014777.1| Uncharacterized protein TCM_040289 [Theobroma cacao]
 gb|EOY32396.1| Uncharacterized protein TCM_040289 [Theobroma cacao]
Length=333

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = -2

Query  716  HLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWI---EFGEG  546
            HLF    L  I + + R +    AT   +R  + +V IE +  K   D++WI   +    
Sbjct  90   HLFQKSALIMIAKIVRRPLFVDEATTNGSRLGITQVCIEYECQKPPMDQVWIVTRDRATK  149

Query  545  GGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREER--GTSLTCK  390
              + GF QKVE  +L  +C  C   GH V  C     R ++R ER  G  LT K
Sbjct  150  TVIGGFTQKVEFSKLSKYCSHCYHVGHSVSTCMVLGYRPKKRSEREAGQDLTLK  203



>ref|XP_010667274.1| PREDICTED: uncharacterized protein LOC104884335 [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ ++ D LSRI   +G  +     T ++ R + A++ +EIDV K     I
Sbjct  22   IWVKLPNLPLNCWNPDSLSRIGSLLGVPLYADECTSQQLRISFARILVEIDVTKDRQHTI  81

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGN  453
             +E   G  +    Q+V  +  P +C  C R GH  GN
Sbjct  82   QVEDSNGIIIQ---QEVRYDWWPPYCKKCQRVGHDCGN  116



>ref|XP_010463327.1| PREDICTED: uncharacterized protein LOC104743994 [Camelina sativa]
Length=851

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 64/140 (46%), Gaps = 13/140 (9%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW++L  LP+H +   +L  I E +G  ++    T+   R   A+V +E+++ K + +
Sbjct  164  TPVWIRLSNLPVHFYHRSILMAIAEGLGNPIKVDLTTLNFERARFARVCVEVNLKKPLKE  223

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
             + +        +G    V  E L   C  C  +GHLV NC  T   +R RE    S   
Sbjct  224  TVMV--------NGDRYFVSYEGLSAICSRCGIYGHLVHNCPHT---IRDRELVAASSPV  272

Query  392  KNVPMTPGVIRKEDGQTPNV  333
              +P + G    +DG T N 
Sbjct  273  --IPASSGEAPIDDGFTVNT  290



>ref|XP_006369230.1| hypothetical protein POPTR_0001s19740g, partial [Populus trichocarpa]
 gb|ERP65799.1| hypothetical protein POPTR_0001s19740g, partial [Populus trichocarpa]
Length=521

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 3/114 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS++   IG+ +   + T   +R + A+V +E D+   +   I
Sbjct  292  VWIRFPNLPLRCWSPICLSKLASVIGKPLHLDTPTSSMSRLSYARVLVETDLLADLPAMI  351

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGT  405
             I    G  +    Q V  E LP FC  C   GH   +C       RR+  + T
Sbjct  352  NISLPNGVTMT---QNVLYESLPRFCKQCRSLGHSTSSCATNSSHKRRKRGQPT  402



>emb|CDY62005.1| BnaCnng38950D [Brassica napus]
Length=306

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ L  +P HLF    L  + +P+G  ++      + TR N+A+V IE +++K +    
Sbjct  157  LWVDLKSVPSHLFSQVGLKALSKPVGSFIKLHPQMEKCTRLNLARVLIETNLHKPL----  212

Query  566  WIEFGEGGGLDGFWQKVEVER--LPNFCVACSRFGHLVGNCKQTEVRLRRREERGT  405
             IE  +    DG   KVEV    LP+ C  CS++GH    C   +V +  +E+  T
Sbjct  213  -IEVIKFADRDGSQVKVEVTYPCLPSRCSVCSKWGHKTKECVSRDVVILSKEKEIT  267



>ref|XP_006374505.1| hypothetical protein POPTR_0015s08050g, partial [Populus trichocarpa]
 gb|ERP52302.1| hypothetical protein POPTR_0015s08050g, partial [Populus trichocarpa]
Length=367

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 51/110 (46%), Gaps = 3/110 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS++   IG+ V   S T   +R + A+V IEID+   +    
Sbjct  130  VWVRFPNLPLQCWSPLCLSKLASVIGKPVHSDSPTTSMSRLSYARVLIEIDLLVELPS--  187

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRRE  417
            WI+     G+    Q V  E LP FC  C   GH    C +     R++ 
Sbjct  188  WIDITLPNGVTKS-QAVIYESLPRFCKQCKTLGHSTSACNKAFSHKRKKS  236



>ref|XP_006591625.1| PREDICTED: uncharacterized protein LOC102667520 [Glycine max]
Length=383

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 71/160 (44%), Gaps = 17/160 (11%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++LP LP++L+    L +I   +G  +     T  + R + A++ +EIDV +   + I
Sbjct  208  VWVKLPNLPLYLWGTKSLGKIGSALGNPLFTDECTANKLRVSYARILVEIDVTQKQRENI  267

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             I   EG  +    Q VE E  P FC  C + GH    CK+   + + RE+  + +  KN
Sbjct  268  TIRDKEGNKIT---QPVEFEWKPKFCELCQKAGH---QCKEKPNK-QWREKPKSEVIVKN  320

Query  386  VPM--------TPGVIRKEDGQTPNVDDSGQGTEKVEADI  291
                        PG    E     NV  S +   K+E  I
Sbjct  321  AKQKTVERARNNPG--EPESSSWTNVKSSSRNKGKMEETI  358



>emb|CCA65978.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=428

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 3/95 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+  P LP++ +  D LSRI   IG  +     T ++ R + A++ IE+DV   + + I
Sbjct  210  IWVTFPNLPLNCWSPDSLSRIGSTIGVPIYADECTTKQLRISFARILIEMDVTGKIQEEI  269

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHL  462
             +E   G     F QKV    LP FC  C + GH+
Sbjct  270  KVEDPNG---RVFTQKVGYAWLPPFCPKCQKIGHV  301



>ref|XP_006380103.1| hypothetical protein POPTR_0008s21940g, partial [Populus trichocarpa]
 gb|ERP57900.1| hypothetical protein POPTR_0008s21940g, partial [Populus trichocarpa]
Length=818

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 3/99 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS+I   +G  ++    T   +R + A+V +E+D+  ++   I
Sbjct  349  VWVKFPNLPLKYWSPRCLSKIASKLGTPIQSDQLTFNMSRISYARVLVELDLLANLKSSI  408

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             I    G  L+   Q V  E LP FC  C   GH  G C
Sbjct  409  VINLPNGSTLN---QPVIYETLPRFCKLCKVLGHNTGTC  444



>ref|XP_007208970.1| hypothetical protein PRUPE_ppb020897mg [Prunus persica]
 gb|EMJ10169.1| hypothetical protein PRUPE_ppb020897mg [Prunus persica]
Length=575

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 11/107 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             WL++  + +  FD   L RI   +G+L++  S T  + R   A++ +E+D+ K +    
Sbjct  210  AWLRVSAIQLECFDVWSLKRIGNMLGKLLKIDSLTTAQNRGKFARLCVELDLTKPL--EA  267

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLR  426
            +++  +       W  +E E LP+ C  C R+GH   NC   E+R++
Sbjct  268  FVQINQN------WYNIEYEGLPDICYHCGRYGHKRENC---ELRVK  305



>ref|XP_006376160.1| hypothetical protein POPTR_0013s10355g [Populus trichocarpa]
 gb|ERP53957.1| hypothetical protein POPTR_0013s10355g [Populus trichocarpa]
Length=556

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 52/111 (47%), Gaps = 3/111 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS+I   +G+ ++    T    R + A+V IE+D+   +   I
Sbjct  306  VWVKFPNLPLKCWSVQGLSKIASVLGKPLQSDKFTATMERLSFARVLIELDLMDELPSSI  365

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREE  414
             I    G  L    Q V  E LP FC  C   GH +G C ++   +   +E
Sbjct  366  PICLPNGTTLH---QSVVYESLPRFCKHCQVLGHSIGACTKSSTLVDPDKE  413



>ref|XP_008779956.1| PREDICTED: uncharacterized protein LOC103699731, partial [Phoenix 
dactylifera]
Length=533

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 4/102 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VWL+LP LP+  +  + +  I    G  +E  + T  R R   A+V++E++    V   +
Sbjct  127  VWLRLPGLPLEYWRKESIWEIANEAGVPIEVDAFTEDRRRMGYARVKVEVNASLPVRPGV  186

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
            +I   EG      WQ    E LP  C  C R GH    C+ T
Sbjct  187  FIRGKEG----KLWQSFTYESLPPVCSYCGRLGHGGNGCRAT  224



>ref|XP_008780080.1| PREDICTED: uncharacterized protein LOC103699861, partial [Phoenix 
dactylifera]
Length=280

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + WL+LP LP+  +  + + +I     R +   +AT + ++   A+V++E+D+   +   
Sbjct  143  VAWLRLPRLPLDFWAKETILQIAATARRPLALDAATDQGSKRGFARVKVELDIKIPLRPG  202

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            I+++  E G     WQ    E LP++C  C R GH    C+
Sbjct  203  IFMKGVEEGIERKIWQGFVYENLPDYCYRCGRIGHGEAACE  243



>ref|XP_006576082.1| PREDICTED: uncharacterized protein LOC102659506 [Glycine max]
Length=964

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 3/100 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++L  LP+ L++   L +I   IG  +     T  +   + A+  +E+D    + D +
Sbjct  262  VWVKLRNLPLELWNPQALGKILSKIGSPIRSDHLTASKGSISFARALVEVDASLELIDEV  321

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
                  G     F QK+E E  P+FC  C   GH + NCK
Sbjct  322  RFRLPTG---KTFVQKIEYENRPSFCTHCKMTGHRLTNCK  358



>ref|XP_010667206.1| PREDICTED: uncharacterized protein LOC104884282 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 52/103 (50%), Gaps = 3/103 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+  +  D LSRI   +G  +     T +  R + A+V IEIDV + +   I
Sbjct  94   IWVKFPNLPLKCWGEDSLSRIGSVLGVPLYADECTSKCLRVSFARVLIEIDVTQDLVKEI  153

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTE  438
             +E   G     F QKV  + LP FC  C + GH  GN  Q +
Sbjct  154  EVEDPYGV---VFKQKVSFDWLPPFCKKCQKVGHNCGNQSQVK  193



>ref|XP_009139876.1| PREDICTED: uncharacterized protein LOC103863864 [Brassica rapa]
Length=473

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 71/147 (48%), Gaps = 14/147 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ L  +PIH++ ++ LS I  PIG  V+    TI  T    AKV  ++D  K +    
Sbjct  209  MWVHLEKVPIHMYSWEGLSFITSPIGFPVKLHQETIACTNLKEAKVFAKVDTSKVLPKE-  267

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             I F +GG  + F  K     LP  C  C ++GH    C+     L+R EE+   +    
Sbjct  268  -ITFTKGG--EEFTVKYFYPWLPLRCNRCEKWGHGEKVCE-----LKRTEEK---MNGSP  316

Query  386  VPMTPGVI--RKEDGQTPNVDDSGQGT  312
            V  +PG++  +KE+G    V    +G+
Sbjct  317  VAKSPGIVNKKKEEGSVMGVKQGEKGS  343



>ref|XP_009621007.1| PREDICTED: uncharacterized protein LOC104112712 isoform X1 [Nicotiana 
tomentosiformis]
Length=307

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 8/106 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T +W +LP LP   +D ++L ++   IG+L++  + T+  +R   A++ IE+ + + +  
Sbjct  115  TAIWTRLPELPTEFYDLEILQKVGNKIGKLLKIDTCTLATSRGRYARICIEVPLEQPLKS  174

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEV  435
             ++I            Q++  E L   C +C R GH    C    V
Sbjct  175  HVFIGTHR--------QRILYEGLNMLCTSCGRLGHTRTTCSHNSV  212



>ref|XP_010674912.1| PREDICTED: uncharacterized protein LOC104890982 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674913.1| PREDICTED: uncharacterized protein LOC104890982 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 52/101 (51%), Gaps = 3/101 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+Q P L +  +    L++I   IG+ V+   ATI + + + A+V IEI + +++ D +
Sbjct  177  VWVQFPSLDLKFWSVRALTKISSLIGKFVKADRATIEKEKLHFARVLIEISINETLPDSV  236

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ  444
             +   E   +    Q V  E  P+ C  C ++GH   NC+ 
Sbjct  237  -LFLNESDKM--VEQLVHYEWKPDLCDVCHKYGHTGNNCRN  274



>ref|XP_006375670.1| hypothetical protein POPTR_0014s19150g [Populus trichocarpa]
 gb|ERP53467.1| hypothetical protein POPTR_0014s19150g [Populus trichocarpa]
Length=243

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 58/121 (48%), Gaps = 3/121 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++ P L I  +    LS++   IG+ +     T  +++ + A+V IE+D+  ++   +
Sbjct  54   TWVRFPNLLIRCWTPLCLSKLASVIGKPLHCDEPTSTKSKLSNARVLIEVDLLGTLPTLV  113

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             ++   G  L    Q+V  E LP+ C  C+  GH    CK++  + + +   G +    +
Sbjct  114  TVQLLNGSSLG---QQVIYESLPHLCTYCASMGHFTTTCKKSSFKRKNKSPEGHTTASPS  170

Query  386  V  384
            +
Sbjct  171  I  171



>ref|XP_006279197.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
 gb|EOA12095.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
Length=457

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 62/138 (45%), Gaps = 15/138 (11%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW++L  LP+  +  D+L  I   +G+ ++    T+   R   A+V +EI++ K V  
Sbjct  160  TPVWVRLSNLPVFFYHQDILLGIASGLGKPIKVDVTTLNFERARFARVCVEINLSKPVKG  219

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
             + I        +G    V  E L N C  C  +GHLV NC       RR  E+      
Sbjct  220  SVMI--------NGDRYYVAYEGLSNICSGCGVYGHLVHNCP------RRVLEKVVEKPT  265

Query  392  KNVPMTPGVI-RKEDGQT  342
               P TP    +++DG T
Sbjct  266  SVAPHTPSETGQRQDGFT  283



>gb|KDO50386.1| hypothetical protein CISIN_1g046148mg, partial [Citrus sinensis]
Length=248

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 8/100 (8%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W+ L  + IHL+  +++ R+ E +G +V+     ++  R   A+V +EID+ K +  +
Sbjct  62   VAWICLAEINIHLYHKNIIRRVGEIVGPIVKIDHKILKAQRGKFARVTVEIDLNKLLISQ  121

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
                       +G  Q+VE E LP  C  C + GH    C
Sbjct  122  F--------NFEGRIQRVEYEYLPTICFGCGKIGHYKDAC  153



>ref|XP_009586783.1| PREDICTED: uncharacterized protein LOC104084588 [Nicotiana tomentosiformis]
Length=255

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 62/120 (52%), Gaps = 8/120 (7%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP LP+  +  + LS+I   IG+L+     T ++TR + A++ IE+++ K++   I
Sbjct  120  LWVILPKLPMSCWGSESLSKIASAIGKLLFADECTTKQTRISYARMLIEVNITKTLPTEI  179

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK-----QTEVRLRRREERGTS  402
             +    G  L    Q++  +  PN+C  C   GH+    K     + E   RRRE++  +
Sbjct  180  TVMDPRGRKLQ---QQLAYDWKPNYCDKCQMIGHICPAQKGPKMQKNEKPKRRREQKKVT  236



>ref|XP_009762889.1| PREDICTED: uncharacterized protein LOC104214865 [Nicotiana sylvestris]
Length=292

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 84/183 (46%), Gaps = 17/183 (9%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++   LP++ +  + LSRI   I   +     T ++ R + A++ IE+DV K + D +
Sbjct  115  LWIRFSKLPLNCWGVNSLSRIASSICMPMYADECTAKQLRVSYARMLIEVDVTKPLKDEV  174

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             +E   G     F Q +  +  P FC  C   GH   +CKQ     R  ++   ++  K 
Sbjct  175  IVEDSNGR---TFLQPINYDWKPKFCETCQVIGH---DCKQ---EWRGHKQYSEAMNEKR  225

Query  386  VP---MTPGVIRKEDGQTPNVDDSGQGTEKV-EADISFKDNEMKSPNQRGLVTEIVKLA*  219
             P    T   + KE G+T  V+    G E + E D+S +  E     + G  + ++K+  
Sbjct  226  KPKKITTHQWVTKEKGKTQQVE----GEEAMPEQDLSKQQQETARVMEVGQSSGVIKVNM  281

Query  218  SKL  210
            S L
Sbjct  282  SVL  284



>ref|XP_007019346.1| Uncharacterized protein TCM_035367 [Theobroma cacao]
 gb|EOY16571.1| Uncharacterized protein TCM_035367 [Theobroma cacao]
Length=514

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 55/116 (47%), Gaps = 9/116 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++ P + +HL+    L R+   +G L++    T  + R   A++ +E+D+ K +   +
Sbjct  169  AWVRFPGMLLHLYHKSALRRLASLLGCLLKIDYNTYSKNREKFARITVELDLTKPLVPLV  228

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEV-RLRRREERGTS  402
            +++        G  QKVE E L   C  C  +GH+   C + E  R     E+G +
Sbjct  229  YVK--------GRRQKVEYEGLLRICYTCGMYGHVKEECHRKEATRSANTNEKGQT  276



>ref|XP_006428819.1| hypothetical protein CICLE_v10013460mg, partial [Citrus clementina]
 gb|ESR42059.1| hypothetical protein CICLE_v10013460mg, partial [Citrus clementina]
Length=332

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 61/133 (46%), Gaps = 14/133 (11%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++LP +P+H +   ++  +   IG++++        TR   A + +E+ +   +  + 
Sbjct  158  AWIRLPGMPLHYYYKKIIRMLGHVIGKVIKIDYNMELATRGKFACIAVEVSLESPLISQF  217

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL----  399
                     LDG  Q+VE E LP  C  C ++GH   +C    + L+ R E+   +    
Sbjct  218  L--------LDGRIQRVEYEALPTICFGCGKYGHTSSSCLDKLI-LKARGEKMNDMALGE  268

Query  398  -TCKNVPMTPGVI  363
             T  N  ++P V+
Sbjct  269  TTKGNSDVSPAVV  281



>ref|XP_006375696.1| hypothetical protein POPTR_0014s19730g, partial [Populus trichocarpa]
 gb|ERP53493.1| hypothetical protein POPTR_0014s19730g, partial [Populus trichocarpa]
Length=512

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 54/115 (47%), Gaps = 3/115 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++LP LP+  +    LS+I   IG+ +     T   +R + A++ +E+D+ + + + I
Sbjct  257  TWVKLPNLPLRCWTPLCLSKISSMIGKPIHCDIPTATMSRLSYARILVEVDLLQELPNVI  316

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
             +    G  L    Q+V  E LP FC  C   GH    C +  ++ +R      S
Sbjct  317  QVVLPNGSPLS---QQVTYESLPRFCKRCRVIGHSANTCNRGPMQKKRPHTAAIS  368



>ref|XP_006380152.1| hypothetical protein POPTR_0008s22400g, partial [Populus trichocarpa]
 gb|ERP57949.1| hypothetical protein POPTR_0008s22400g, partial [Populus trichocarpa]
Length=320

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 52/108 (48%), Gaps = 3/108 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++LP LP+  +    LS+I   IG+ +     T   +R + A++ +E+D+ + +   I
Sbjct  57   TWVKLPNLPLRCWTPLCLSKIGSMIGKPIHCDIPTTTMSRLSYARILVEVDLLQELPHAI  116

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
             +    G  L    Q+V  E LP FC  C   GH    C +  ++ +R
Sbjct  117  QVVLPNGTPLS---QQVTYESLPRFCTRCRVIGHSANTCNRGPMQKKR  161



>ref|XP_010034731.1| PREDICTED: uncharacterized protein LOC104424031 [Eucalyptus grandis]
Length=374

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 4/100 (4%)
 Frame = -2

Query  743  WLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIW  564
            W+Q+  +P   F  DV++ + E +GR+VE     I        KVR+E+D+   +     
Sbjct  68   WVQMGGIPPGWFREDVVADLAERMGRVVEIQMEAIGNGPNKAGKVRVELDLNSPLKSGAI  127

Query  563  IEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ  444
            ++     G    W + + ERLP+ C +C R GH   N ++
Sbjct  128  LDI----GTKKLWVEFKYERLPHCCYSCGRIGHYATNYEE  163



>ref|XP_008778450.1| PREDICTED: uncharacterized protein LOC103698238 [Phoenix dactylifera]
 ref|XP_008778518.1| PREDICTED: uncharacterized protein LOC103698300 [Phoenix dactylifera]
Length=333

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 49/101 (49%), Gaps = 4/101 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VWL+LP LP+  +  +++  I    GR +     T +  +   A+V++E+D    +  
Sbjct  159  TVVWLRLPSLPMEYWTKELIWGITTKAGRPLALDKVTDQGRKLGFARVKVEVDAGVPIRP  218

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
              +I+ G     D  WQ    E L  FC  C+R GH  G C
Sbjct  219  GTFIQVGS----DLHWQAFCYENLLGFCYKCARLGHGEGAC  255



>ref|XP_006380098.1| hypothetical protein POPTR_0008s218701g, partial [Populus trichocarpa]
 gb|ERP57895.1| hypothetical protein POPTR_0008s218701g, partial [Populus trichocarpa]
Length=234

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 50/95 (53%), Gaps = 3/95 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS+I   +G+ ++    T   TR + A+V +E+D+ + +   +
Sbjct  122  VWVKFPNLPLCCWSPSCLSKIASVLGKPIQCDHMTSSLTRLSYARVLVELDLREDLQHSV  181

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHL  462
             +    G  L+   QKV  E LP FC  C+  GH+
Sbjct  182  AVTLPSGPILN---QKVVYEALPKFCNCCNVLGHM  213



>ref|XP_007042412.1| Uncharacterized protein TCM_007050 [Theobroma cacao]
 gb|EOX98243.1| Uncharacterized protein TCM_007050 [Theobroma cacao]
Length=341

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW+  P L  HLF+   L  I + IG  +    AT   TRP+VA+V IE D  K+  D +
Sbjct  76   VWISFPNLKAHLFEKSALLLIAKAIGYPLYVDEATANGTRPSVARVCIEYDCLKAPLDSV  135

Query  566  WI-------EFGEGGGLDGFWQK  519
            WI       E   GG L  +W +
Sbjct  136  WIVVSKRGLEDMSGGYLQKYWDR  158



>gb|ABN08700.1| Endonuclease/exonuclease/phosphatase [Medicago truncatula]
Length=814

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 74/154 (48%), Gaps = 22/154 (14%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+QLP LP+  +  D LSRI   +G  +     T +++R + A++ +EIDV + +  ++
Sbjct  357  LWIQLPNLPLTCWGLDSLSRIGSTLGNPLFADECTSKQSRISYARLLVEIDVTRPLLYKV  416

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             +E  +G     F Q++  +  P+FC  C +  H+   C +  V+   R ++        
Sbjct  417  MVESPDG---KCFEQRIVYDWEPSFCKKCQQVDHV---CDKQSVQPVERPKKDW------  464

Query  386  VPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISF  285
            +P T            N+ D G+  EK+ +D  +
Sbjct  465  IPKT----------QVNLVDKGKQPEKINSDTEW  488



>ref|XP_009622058.1| PREDICTED: uncharacterized protein LOC104113559 [Nicotiana tomentosiformis]
Length=328

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 61/118 (52%), Gaps = 3/118 (3%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             + W++ P LP + F  + +  +   +G  +    AT   TRP+ AKV++E+++      
Sbjct  150  AVAWIRFPELPPNFFGKECIFSLASAVGNPLHVNLATQNDTRPSCAKVKVEVNLLSKFSQ  209

Query  572  RI-WIEFGEGGGLDGF-WQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRR-EERG  408
            RI  +E  +  GL+ F W K++ + +P +C AC++ GH    C   +  L +  EER 
Sbjct  210  RIKLVEEEDEFGLEEFKWIKIKYDYIPKYCSACNKQGHNELECSVIDPELHKTFEERA  267



>ref|XP_009796298.1| PREDICTED: uncharacterized protein LOC104242883 [Nicotiana sylvestris]
 ref|XP_009796299.1| PREDICTED: uncharacterized protein LOC104242883 [Nicotiana sylvestris]
Length=524

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (47%), Gaps = 2/103 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            ++VW+  P LP + F    L  I   +G+ +    AT  +TRP+ A+V++ +D+      
Sbjct  168  SVVWISFPDLPPNFFAKKSLLSIASAVGKPLAVDKATQDQTRPSAARVKVLLDLLDKHPK  227

Query  572  RIWIEF--GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            R+ +       G     +Q+V  + LP FC  C   GH    C
Sbjct  228  RVKLHIVDKSTGKFVEHYQEVVYDNLPKFCTFCKHQGHEERTC  270



>ref|XP_010668455.1| PREDICTED: uncharacterized protein LOC104885464, partial [Beta 
vulgaris subsp. vulgaris]
Length=385

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 66/133 (50%), Gaps = 14/133 (11%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP L +H +  D LSRI   +G+ V     T +  R + A++ IE+DV K +   I
Sbjct  161  LWVKLPNLLLHYWSGDSLSRIESLLGKPVYADECTSKALRVSFARILIEMDVTKKLPSEI  220

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQ--TEVRLRRREERGTSLTC  393
             I+   G     F QKV  + LP +C  C + G+   NC+   ++ +  R+  +      
Sbjct  221  QIDEPNGA---TFTQKVSYDWLPPYCKKCLKVGN---NCEAGGSKPKTNRKPVQ------  268

Query  392  KNVPMTPGVIRKE  354
            K VP    V+ KE
Sbjct  269  KWVPKNQAVVEKE  281



>ref|XP_012084349.1| PREDICTED: uncharacterized protein LOC105643761 [Jatropha curcas]
Length=220

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDV  591
             L+W+ LP LPIH FD + L  I E IGR ++  ++T    RP+VAKV +E+D+
Sbjct  162  ALIWVSLPGLPIHFFDKEALYSIVELIGRPLKVDASTASLIRPSVAKVCVELDI  215



>ref|XP_011075643.1| PREDICTED: uncharacterized protein LOC105160077 [Sesamum indicum]
Length=464

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 75/185 (41%), Gaps = 26/185 (14%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW  LP LP+  +  + L +I   IG  +   S T++  R + A++ +EI+  K + D
Sbjct  15   TPVWATLPSLPLECWHPNALGKISSRIGSPIAMDSLTMKMERVSYARILVEINASKKLID  74

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC-------------------  450
            +  +EF     +    Q V  E  P FC    + GHL   C                   
Sbjct  75   Q--VEFVMPNDITRK-QPVVYEFTPKFCTDYHKLGHLQETCQGAHLQVVAAAPAKQAEAK  131

Query  449  --KQTEVRLRRREERGTSLTCKNVPMTPGVIRKEDGQTPNVDDSGQGTEKVEADISFKDN  276
              + TE  + +R  +G ++     P   G   +    T +  D G+ + KV   +  +D 
Sbjct  132  KPQTTEWTIVQRRNKGKAIDTAAKPAVEG--HQPISPTASKVDKGRMSTKVPHSLKLQDR  189

Query  275  EMKSP  261
            E+  P
Sbjct  190  EVPLP  194



>ref|XP_006603418.1| PREDICTED: uncharacterized protein LOC102664224 [Glycine max]
Length=243

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 6/105 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LPI L+    L++I   +G  +     T  R R + A++ +E+D+   +   I
Sbjct  28   IWVKLPQLPIILWGDTSLNKIGSALGNPIMTDECTANRLRVSYARILVEMDITNELPQTI  87

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVR  432
             I   EG  +    Q +E E  P FC  C + GH   +C + +VR
Sbjct  88   TIADNEGEKIQ---QAIEYEWRPLFCNKCQKVGH---SCDKPKVR  126



>ref|XP_011069433.1| PREDICTED: uncharacterized protein LOC105155259, partial [Sesamum 
indicum]
Length=274

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 49/97 (51%), Gaps = 3/97 (3%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW  LP LP+  +  + L +I   +G  +   S T++  R + A++ +E+D  K + D
Sbjct  181  TPVWATLPSLPLECWHPNALGKIGSRVGSPIAMDSLTMKMERVSYARILVEVDSSKKLVD  240

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHL  462
            +  +EF    G+    Q V  E  P FC  C RF HL
Sbjct  241  Q--VEFVMPNGITR-KQPVVYEFTPKFCTDCHRFDHL  274



>ref|XP_006377607.1| hypothetical protein POPTR_0011s08300g, partial [Populus trichocarpa]
 gb|ERP55404.1| hypothetical protein POPTR_0011s08300g, partial [Populus trichocarpa]
Length=204

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 50/98 (51%), Gaps = 3/98 (3%)
 Frame = -2

Query  743  WLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIW  564
            W++ P LP+  +    LS++   IG+ +     T  ++R + A+V IE+D+  ++   + 
Sbjct  19   WVRFPNLPLRYWTPLCLSKLASVIGKPIHCDEPTSNKSRLSYARVLIEVDLLGALPSSVN  78

Query  563  IEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            ++   G  L+   Q+V  E LP FC  C+   H+   C
Sbjct  79   VKLPNGSTLN---QQVFYESLPQFCKLCASIRHITTTC  113



>ref|XP_003589692.1| hypothetical protein MTR_1g035150 [Medicago truncatula]
Length=509

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 4/100 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++L  LP   +    L  I   IG L+   SAT  R   + A+V +++D+ K +F+ +
Sbjct  169  VWIRLLELPQEFWMDRTLREIASAIGTLLLIDSATQNRVFGHYARVLVDMDLSKHIFNEV  228

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             I   E  G   F   +  ERLP FC  C   GH   +C+
Sbjct  229  MI---ERTGF-SFAIGISYERLPVFCTHCGNIGHHTSSCR  264



>ref|XP_002298564.2| hypothetical protein POPTR_0001s35780g [Populus trichocarpa]
 gb|EEE83369.2| hypothetical protein POPTR_0001s35780g [Populus trichocarpa]
Length=341

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 53/115 (46%), Gaps = 3/115 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+  +    LS++   IG+ + + S T   TR + A+V +EID+   +   I
Sbjct  38   IWVKFPNLPLQCWSPLCLSKLASVIGKPMYYDSPTTSITRLSYARVLVEIDLLAELPSSI  97

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
                  G       Q V  E LP FC  C+  GH    C ++    R++    TS
Sbjct  98   NTTLPNGVSKP---QVVLYESLPWFCKKCNILGHSNSACNKSSSHKRKKHPPTTS  149



>gb|KDO40369.1| hypothetical protein CISIN_1g048241mg, partial [Citrus sinensis]
Length=354

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 57/127 (45%), Gaps = 15/127 (12%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W++LP +P+H +   VL  + E +GR++     T+   R   A+V +EI + K +  +
Sbjct  127  VAWIRLPGMPLHYYHKRVLRILGEVVGRVIRIAYNTLAAKRGKFARVAVEICLNKPLVSQ  186

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCK  390
                      L+G  Q++E E LP  C    + GH V  C+       R++E      C 
Sbjct  187  F--------QLNGKIQRIEYEGLPTICFEYGKDGHTVDTCQ-------RKKEVSIGHGCD  231

Query  389  NVPMTPG  369
              P   G
Sbjct  232  GGPQLEG  238



>ref|XP_008779623.1| PREDICTED: uncharacterized protein LOC103699378 [Phoenix dactylifera]
Length=475

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 4/100 (4%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VWL LP LP+  +   ++  I    G        T    R   A+V++E+D  + +   
Sbjct  178  VVWLMLPNLPMEYWTRSMIMSIAAKAGHPPTLDKFTDLGRRLGYARVKVELDAREPIRPG  237

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
             ++  G     D  WQ    E LP FC  C+R GH V  C
Sbjct  238  TFVRLG----TDVHWQTFSYENLPAFCYQCARLGHGVEVC  273



>ref|XP_006595367.1| PREDICTED: uncharacterized protein LOC102665188 [Glycine max]
Length=200

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 3/100 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++L  LP+ L++   L +I   IG  +     T  +   + A+  IE+D    + D +
Sbjct  17   VWVKLRNLPLELWNPQALGKILSKIGSPIRSDHLTASKGSISFARALIEVDASLELIDEV  76

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
                  G     F QK+E E   +FC  C   GH + NCK
Sbjct  77   RFRLPTG---KTFVQKIEYENRLSFCTHCKMIGHRLTNCK  113



>ref|XP_011075252.1| PREDICTED: uncharacterized protein LOC105159763 [Sesamum indicum]
Length=476

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 50/98 (51%), Gaps = 4/98 (4%)
 Frame = -2

Query  743  WLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIW  564
            W+  P LP +LF  +VL  +   IG  ++   AT+ +++ + A+  IE+D+ K   +   
Sbjct  185  WVSFPELPAYLFRKEVLFTVASMIGTPLQIDDATLNQSKLSKARACIELDLLKPRLENFQ  244

Query  563  IEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            I+           Q++E E +P++C  C + GH   +C
Sbjct  245  IQICGT----TIVQRIEYEDIPHYCSLCKQVGHQDSDC  278



>ref|XP_003627837.1| NBS resistance protein [Medicago truncatula]
Length=1731

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 8/102 (8%)
 Frame = -2

Query  746   VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             +W++L  LP   +   +L  I   +G  ++    T  RT  + A++ ++ID+ K  FD I
Sbjct  1218  LWIRLVELPQEYWRERILKEIASAVGTPIDIDGPTRNRTFGHYARILVDIDLSKRTFDEI  1277

Query  566   WIEFGEGGGLDGFWQKVEV--ERLPNFCVACSRFGHLVGNCK  447
              +E       D F  KVEV  ER P FC  C   GH V  C+
Sbjct  1278  LVE------RDDFAFKVEVQYERRPLFCHHCFAIGHDVSTCR  1313



>ref|XP_008779654.1| PREDICTED: uncharacterized protein LOC103699413 [Phoenix dactylifera]
Length=262

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 46/96 (48%), Gaps = 4/96 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VWL+LP LP+  +  +++  I    GR +     T +  +   A+V++E+D       
Sbjct  170  TVVWLRLPSLPMEYWSKEMIWGIAAKAGRPLALDKVTDQGRKLGFARVKVEVDAGAPFRL  229

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
              +I  G     +  WQ    E LP FC  C+R GH
Sbjct  230  GTFIRVGS----ELHWQAFRYESLPGFCFKCARLGH  261



>ref|XP_006285413.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
 gb|EOA18311.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
Length=446

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 63/137 (46%), Gaps = 14/137 (10%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW+++  +P+  +  D+L  I   +G+ V+    T++  R   A+V +E+++ K +  
Sbjct  141  TPVWIRVSNIPVIYYHEDILLGIASGLGKPVKVDLTTLQIERARFARVCVEVNLSKPLKG  200

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
             + I        +G    V  E L N C  C  FGHLV NC + ++      E     + 
Sbjct  201  SVMI--------NGERYYVAYESLSNICSGCGVFGHLVHNCPRWQL------EPEVDHSV  246

Query  392  KNVPMTPGVIRKEDGQT  342
             NV   P   + EDG T
Sbjct  247  PNVSPPPETNQHEDGFT  263



>ref|XP_007044224.1| Uncharacterized protein TCM_009467 [Theobroma cacao]
 gb|EOY00056.1| Uncharacterized protein TCM_009467 [Theobroma cacao]
Length=428

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 10/105 (10%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++L ++P+  +D  VL++I   +GR+++    T +      A++ +EID+ + +  R+
Sbjct  61   TWIRLHVMPLEFYDKFVLAKINNKLGRVLKNDRNTTQAISGRFARLCVEIDLDQPLVPRV  120

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC--KQTE  438
             I         G+WQ+VE E L   C  C RFG+    C  K TE
Sbjct  121  RIV--------GWWQRVEYEGLRLLCFHCGRFGNSFKGCAMKSTE  157



>ref|XP_009765697.1| PREDICTED: uncharacterized protein LOC104217212 [Nicotiana sylvestris]
Length=466

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (52%), Gaps = 2/102 (2%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+ LP L   LF    L  I   IG+ +    AT  R+RP  A+V++ ID+   + ++I
Sbjct  170  IWISLPNLSPELFARKPLLSIAAAIGKPIAIYKATQVRSRPITARVKVIIDLLDKLPEKI  229

Query  566  WIEFGE--GGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
             +++ +   G +   +Q++  + LP++C  C   GH    C+
Sbjct  230  RLQYFDVKTGKIVEDYQEIIYDNLPSYCGHCKHQGHEENQCR  271



>ref|XP_006378905.1| hypothetical protein POPTR_0009s00440g [Populus trichocarpa]
 gb|ERP56702.1| hypothetical protein POPTR_0009s00440g [Populus trichocarpa]
Length=350

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 52/108 (48%), Gaps = 3/108 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++LP LP+  +    LS+I   IG+ +     T   +R + A++ +E+D+ + +   +
Sbjct  94   TWVKLPNLPLRCWTPLCLSKIGSMIGKPIHCDIPTATMSRLSYARILVEVDLLQKLLHVV  153

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRR  423
             +    G  L    Q+V  E LP FC  C   GH   +C +   + +R
Sbjct  154  QVVLPNGTPLS---QQVTYESLPRFCTRCRVIGHSANSCNRGPKQKKR  198



>ref|XP_010684435.1| PREDICTED: uncharacterized protein LOC104898994 [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 11/136 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP   +    L +I   +G+ V+  +AT  + R N A++ IE+ V   + D I
Sbjct  53   IWIKLPGLPFKYWGEKSLYKIVGQVGKAVKMDAATKSKDRLNYARIMIEVGVQGKLPDAI  112

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVR-------LRRREERG  408
               + E G L    QK+  E  P  C  C  FGH    C++ E R       ++++++ G
Sbjct  113  NF-YNEHGVL--VEQKMGFEWRPIQCATCHGFGHENEVCRKKEGRRLWVKKKIQQQDQEG  169

Query  407  -TSLTCKNVPMTPGVI  363
             T +T   V   P  +
Sbjct  170  FTKITSNRVATKPNEV  185



>ref|XP_006378911.1| hypothetical protein POPTR_0009s005102g, partial [Populus trichocarpa]
 gb|ERP56708.1| hypothetical protein POPTR_0009s005102g, partial [Populus trichocarpa]
Length=216

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 66/161 (41%), Gaps = 19/161 (12%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++ P LP+  +    LS+I   +G+ ++    T   +R + A+V +EID+ + +   +
Sbjct  46   VWVKFPNLPLCCWSPTCLSKIASVLGKPIQCDQPTSTLSRISYARVLVEIDLLEDLRHSV  105

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             I   EG  L    Q V  E +P +C  C   GH          RL   +   +  T  N
Sbjct  106  EISLPEGPALR---QPVVYEAMPKYCTFCHVLGH---------TRLLCPKAAASQATPCN  153

Query  386  VPMTP-------GVIRKEDGQTPNVDDSGQGTEKVEADISF  285
             P+ P        V  +   Q P      Q   + + D++ 
Sbjct  154  QPLPPTTQAVNGNVFSRLGPQPPLQPSPAQPQVQTQQDVAI  194



>ref|XP_009590293.1| PREDICTED: uncharacterized protein LOC104087503 [Nicotiana tomentosiformis]
Length=466

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 65/154 (42%), Gaps = 3/154 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
              VW+    LP  LF    L  I    G+ +    AT  ++RP+ A+V++E+D+  ++  
Sbjct  103  AFVWISFLSLPPILFAKKSLMFIASAAGKPIAIDKATQEKSRPSTARVKVELDLLGNLPQ  162

Query  572  RIWIEF--GEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSL  399
             + ++    + G +    QK   + LP +C  C   GH   +C+        + +     
Sbjct  163  HLKVQLVDEKTGKIIEHVQKFVYDNLPRYCTFCKHQGHDEDDCRSIVGNHDVKSQEDAER  222

Query  398  TCKNVPMTPGVIRK-EDGQTPNVDDSGQGTEKVE  300
             C  +    G  R+  D +    D SG+G   +E
Sbjct  223  ICTGIEKYRGDARQLLDAKNLQKDASGKGLASIE  256



>ref|XP_008796020.1| PREDICTED: uncharacterized protein LOC103711587 [Phoenix dactylifera]
Length=333

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 44/101 (44%), Gaps = 4/101 (4%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            +VWL+LP LP   +    +  I    GR +     T  R     A+V++ ID  + +   
Sbjct  198  VVWLRLPGLPPEYWSTATILEIAGKAGRPLAVDGVTKGRRAMGFARVKVSIDASEPLLPG  257

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            I I     G     WQ    E +P+ CV C R GHL   C+
Sbjct  258  IRIL----GKTKALWQPFVFESIPDLCVRCGRIGHLEPGCR  294



>ref|XP_010313013.1| PREDICTED: uncharacterized protein LOC104644633 [Solanum lycopersicum]
Length=241

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W+  P LP++ +   +LSRI   IG  +     T ++TR + A++ +E++V K++  +I
Sbjct  26   LWVNFPKLPLNCWGVGLLSRIASAIGVPLFADECTTKQTRISYARMLVEVNVTKAIPQKI  85

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHL--VGNCKQTEVRLRRREERGTSLT  396
             +    G     F Q VE+E  P +   C + GH+  +    + E+  RRR  +  + T
Sbjct  86   TVVDPNG---KTFMQDVELEWRPQYYDKCQKIGHVCKMEQASKEEMPKRRRPWKKVTQT  141



>gb|KHN04954.1| hypothetical protein glysoja_013861, partial [Glycine soja]
Length=243

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 12/104 (12%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGR--LVEFGSATIRRTRPNVAKVRIEIDVYKSV  579
            T+VW++ P L +  +D  +L  +   IG+   V+     +RR R   A+V IE+++ K V
Sbjct  147  TMVWIRFPGLNLVYYDETILLALASAIGKPVKVDINPKDVRRGR--FARVCIEVNLTKPV  204

Query  578  FDRIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
              R+W        L   W  VE E L   C  C  +GHL+  CK
Sbjct  205  VGRVW--------LKDLWYHVEYEGLHRICGTCGCYGHLMRECK  240



>ref|XP_010687396.1| PREDICTED: uncharacterized protein LOC104901505 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 51/98 (52%), Gaps = 3/98 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++LP LP++ +  D LSRI   +G  +     T ++ R + A++ +EIDV K     I
Sbjct  168  IWVKLPNLPLNCWSPDSLSRIGSLLGVPLYADECTSQQLRISFARILVEIDVTKDRQHTI  227

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGN  453
             +E   G  +    Q+V  +  P +C  C R GH  GN
Sbjct  228  QVEDSNGIIIQ---QEVRYDWWPPYCKKCQRVGHDCGN  262



>ref|XP_009785180.1| PREDICTED: uncharacterized protein LOC104233481 isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 8/106 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            +++WLQLP LP   +D  +L +I   IG+L++  + T    R   A++ IE+ + + V  
Sbjct  138  SVIWLQLPQLPTEFYDAIILKKIGNTIGKLLKIDACTSAALRERYARLCIEMQLEEPVQP  197

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEV  435
             I         +  + Q++  E     C AC R GH   +C  T++
Sbjct  198  CI--------SIGNYKQQIIYEGEHILCKACGRLGHTTQHCSYTKL  235



>ref|XP_009770244.1| PREDICTED: uncharacterized protein LOC104220969 [Nicotiana sylvestris]
Length=315

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LPI+ +    LS I   IG  +   S T ++TR + A++ IE++V K + D +
Sbjct  218  IWVKFPKLPINCWGAKSLSSIASTIGTPLYADSCTAKQTRISFARILIEVNVTKPLPDEV  277

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
             +    G     F Q V  +  PNFC  C + GH
Sbjct  278  EVMDPTG---RFFQQPVLYDWKPNFCEKCMKIGH  308



>ref|XP_008783980.1| PREDICTED: uncharacterized protein LOC103703060 [Phoenix dactylifera]
Length=215

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T+VW++LP LP+  +    +  +    GR +   + +  R R   A+ ++EID    +  
Sbjct  124  TVVWVRLPGLPLEYWYNASILEMVAAAGRPLTLDAVSSERRRVGYARAKVEIDASLPLVP  183

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGH  465
               +++G+    + FWQ    E LP+ C  C+R GH
Sbjct  184  GTLVQWGK----NRFWQAFVYEDLPSLCYLCARTGH  215



>gb|KFK32715.1| hypothetical protein AALP_AA6G279100 [Arabis alpina]
Length=620

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 70/164 (43%), Gaps = 19/164 (12%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W  L  +P  L     LSR+ E IG   E    T   TR N A V++EIDV K +   I
Sbjct  292  LWAHLKGIPFDLIHDAGLSRVAELIGYPKEMDDFTKNLTRVNEAHVKVEIDVTKPLPSVI  351

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKN  387
             IE  E G +D    +VE   +P     C   GHL+ NC +              LT K 
Sbjct  352  EIE-RENGRVDIV--EVEYPWVPPSYSNCKEIGHLIRNCHK--------------LTPKW  394

Query  386  VPMTPGVIRKEDGQTPNVDDSGQ-GTEKVEADISFKDNEMKSPN  258
            VP T     K + Q+P VD +   G + VE     K+     P+
Sbjct  395  VPKTTATDPKRN-QSPPVDTASPVGDQTVENTCPAKNKSTDQPD  437



>ref|XP_009767582.1| PREDICTED: uncharacterized protein LOC104218716 [Nicotiana sylvestris]
Length=257

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 50/104 (48%), Gaps = 2/104 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            ++VW+  P LP + F    L  I   +G+ +    AT  RTRP+ A+V+  +D+      
Sbjct  119  SVVWISFPDLPANFFAKKSLMSIASAVGKPLAVDKATQDRTRPSTARVKALLDLLAKHPK  178

Query  572  RIWIEFGEGGGLD--GFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            R+ I   +   +     +Q +  + LP +C   +  GH V +C+
Sbjct  179  RVRINIVDKNSMKVVEHYQDIVHDNLPKYCTCFNHQGHDVKSCR  222



>ref|XP_010689853.1| PREDICTED: uncharacterized protein LOC104903510 [Beta vulgaris 
subsp. vulgaris]
Length=228

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 60/152 (39%), Gaps = 26/152 (17%)
 Frame = -2

Query  740  LQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWI  561
            +++P L I  FD + L +I   IG+++     T    R    ++ IE+D+ K +  + W 
Sbjct  30   VRIPQLSIEYFDKEFLLKIGNKIGKVMRIDQHTTNAERGQFTRLSIELDLSKPLLSKFW-  88

Query  560  EFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCKNVP  381
                   L G   K++ E L   C  C + GH+  NC                 T  + P
Sbjct  89   -------LKGRIWKIQYEGLRLICFNCGKIGHMAENC-----------------TLHHEP  124

Query  380  MTPGVIRKEDGQTPNVDDSGQGTEKVEADISF  285
              P  IR  DGQ    D     T K E +  F
Sbjct  125  NPPDEIRG-DGQPHRGDAKENDTAKPETEHDF  155



>ref|XP_009790478.1| PREDICTED: uncharacterized protein LOC104237944 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009790479.1| PREDICTED: uncharacterized protein LOC104237944 isoform X2 [Nicotiana 
sylvestris]
Length=681

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
             +VW+ LP  P + F    L  I   +G+ +    AT +RTRP+ A+V++ ID+      
Sbjct  140  AVVWISLPGFPPNFFAKRSLLSIASAVGKPLAVDKATQQRTRPSAARVKVIIDLLDKHPK  199

Query  572  RIWIEFGE--GGGLDGFWQKVEVERLPNFCVACSRFGH  465
            ++ ++  +   G     +Q++  + LP +C  C   GH
Sbjct  200  KVKLQIVDRATGKYVVHYQEIVYDNLPKYCNCCKHQGH  237



>ref|XP_003613513.1| hypothetical protein MTR_5g037520 [Medicago truncatula]
Length=531

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 13/92 (14%)
 Frame = -2

Query  722  PIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRIWIEFGEGG  543
            PI LF+      I   +G  +    AT +RT  + A+V IE+D+   + DRI +   E  
Sbjct  268  PITLFE------IARALGNPLTLDEATKKRTFGHFARVLIEVDLNSHLHDRILV---ERN  318

Query  542  GLDGFWQKVEVERLPNFCVACSRFGHLVGNCK  447
            G D F+  VE E   NFC +C  FGH + NCK
Sbjct  319  GFD-FYVDVEYE---NFCNSCKIFGHSIKNCK  346



>ref|XP_006381942.1| hypothetical protein POPTR_0006s21930g, partial [Populus trichocarpa]
 gb|ERP59739.1| hypothetical protein POPTR_0006s21930g, partial [Populus trichocarpa]
Length=348

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 25/143 (17%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
             W++ P LP+  +    LS++   IG+ + +   T    R + A+V IE+D+ +++ + +
Sbjct  127  TWVRFPNLPLRCWTPLCLSKLASVIGKPIHYDDPTTNMIRLSYARVLIEVDLLRALPNSV  186

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC---------------------  450
             +    G  L    Q+V  E LP FC  C+ +GH    C                     
Sbjct  187  NVVLPNGSPLA---QQVLYESLPRFCKLCNVWGHNATACRKSSSKRKKKASRPSESARFC  243

Query  449  -KQTEVRLRRREERGTSLTCKNV  384
             ++T +  R+R +  TS T K  
Sbjct  244  SQETPIPGRKRTKLATSSTAKQA  266



>ref|XP_006286623.1| hypothetical protein CARUB_v10002432mg, partial [Capsella rubella]
 gb|EOA19521.1| hypothetical protein CARUB_v10002432mg, partial [Capsella rubella]
Length=450

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 54/104 (52%), Gaps = 8/104 (8%)
 Frame = -2

Query  752  TLVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFD  573
            T VW+++  LP++L+   +LS++   +G+ +     T++  R   A+V +E+++ K +  
Sbjct  161  TPVWVRISSLPVNLYHKVILSKVSGALGKPLRVDMTTLQLNRARFARVCVEVNLKKPLKG  220

Query  572  RIWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
             + +        +G    V  E L   C +C  +GHLV NC ++
Sbjct  221  SVLV--------NGERYAVAYEGLSTICSSCGIYGHLVNNCPRS  256



>ref|XP_010315567.1| PREDICTED: uncharacterized protein LOC104645510 [Solanum lycopersicum]
Length=468

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W   P LP++ +    LSRI   IG  +     T ++TR + A++ IE +V K V ++I
Sbjct  212  LWANFPKLPLNCWGAGSLSRIASAIGVPLFADECTTKQTRISYARMFIEANVTKPVPEKI  271

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRR  420
             I+   G     F Q V +E  P +C  C R GH   +  + E   +RR
Sbjct  272  AIKDPNG---RTFMQDVVMEWKPLYCEKCQRIGHQCQDTTKEEQPKKRR  317



>dbj|BAE79381.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 8/99 (8%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            VW++LP L +  F  D +  I E IG+ +     T+ R +   A+  +EID+ K +   I
Sbjct  189  VWVRLPELSMEYFRDDTIKAILENIGKPLRLDRTTMAREKGRFARAAVEIDLDKPLVSEI  248

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNC  450
            W+         G  QKVE E L   C  C   GH    C
Sbjct  249  WVM--------GDVQKVEYEGLHVVCFGCGVVGHREQAC  279



>ref|XP_003631099.1| hypothetical protein MTR_8g107120 [Medicago truncatula]
Length=631

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 15/134 (11%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++L  LP   +    L  I   +G  +     T  R   + A++ ++ID+ K V+D I
Sbjct  178  LWIRLVELPQEYWCERTLKEIASVVGTPISIDGPTGNRAFGHYARILMDIDLSKRVYDEI  237

Query  566  WIEFGEGGGLDGFWQKVEV--ERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTC  393
             +E       +GF  KVEV  ER P FC  C   GH V NCK   +   +   RG     
Sbjct  238  LVE------REGFAFKVEVQYERRPLFCHHCYVIGHNVTNCKWLNLEAAKVNGRGK----  287

Query  392  KNVPMT---PGVIR  360
            K VP T   P V++
Sbjct  288  KQVPETNIQPHVVK  301



>gb|KDO39313.1| hypothetical protein CISIN_1g037277mg, partial [Citrus sinensis]
Length=199

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 61/137 (45%), Gaps = 9/137 (7%)
 Frame = -2

Query  749  LVWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDR  570
            + W+++  +P+H +   +L  I   +G++++    T    R   A++ +EI + K +  +
Sbjct  20   VAWIRILGMPLHYYHKRILRMIGNVVGKVIKIDYNTESARRGKFARIAVEISLKKPLCSQ  79

Query  569  IWIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTSLTCK  390
             +        LDG  Q +E E LP  C  C  +GH   +C Q+   L+   E   +   +
Sbjct  80   FF--------LDGKLQNIEYENLPIICFNCGIYGHKNDDCPQSNT-LKNLTESCENNVAE  130

Query  389  NVPMTPGVIRKEDGQTP  339
            + P   G  +    + P
Sbjct  131  DNPNGGGEEKSSSSEVP  147



>ref|XP_010685587.1| PREDICTED: uncharacterized protein LOC104899978 [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 6/102 (6%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+H +  D LSRI   +G  +     T    + + A+V IE+DV K V + I
Sbjct  74   IWVKFPNLPLHCWSSDSLSRIGSLLGVPIYADECTSNALQVSFARVLIEMDVTKRVPNEI  133

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQT  441
             +E   G     F QKV  + L  +C  C + GH   NC+ +
Sbjct  134  HVEEPNG---TTFTQKVVYDLLSPYCGKCLKVGH---NCETS  169



>ref|XP_011014909.1| PREDICTED: uncharacterized protein LOC105118625 isoform X1 [Populus 
euphratica]
Length=250

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 52/115 (45%), Gaps = 3/115 (3%)
 Frame = -2

Query  746  VWLQLPLLPIHLFDFDVLSRICEPIGRLVEFGSATIRRTRPNVAKVRIEIDVYKSVFDRI  567
            +W++ P LP+  +    LS+I   +G+L+     T + TR +   V IE+D+   +   I
Sbjct  54   IWVRFPNLPLRCWSHICLSKIASMVGKLIHCDGLTAQMTRVSYTWVLIELDLLSDLPSTI  113

Query  566  WIEFGEGGGLDGFWQKVEVERLPNFCVACSRFGHLVGNCKQTEVRLRRREERGTS  402
             +    G  L    Q++  E LP +C  C   GH      Q  +   ++   GTS
Sbjct  114  TVILPNGNTLV---QQLVYESLPRYCKQCKSLGHSTLTYTQGRIPRNKKRPHGTS  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1455524718375