BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8569

Length=831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362029.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    277   2e-84   
ref|XP_009606961.1|  PREDICTED: SUMO-activating enzyme subunit 2        275   1e-83   Nicotiana tomentosiformis
ref|XP_010315319.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    269   1e-81   Solanum lycopersicum
ref|XP_004230873.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    268   4e-81   Solanum lycopersicum
ref|XP_009765006.1|  PREDICTED: SUMO-activating enzyme subunit 2        268   5e-81   Nicotiana sylvestris
gb|EYU37827.1|  hypothetical protein MIMGU_mgv1a002832mg                266   3e-80   Erythranthe guttata [common monkey flower]
ref|XP_010645393.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    258   3e-78   Vitis vinifera
ref|XP_011088448.1|  PREDICTED: SUMO-activating enzyme subunit 2        259   2e-77   Sesamum indicum [beniseed]
emb|CAJ19271.1|  SUMO activating enzyme 2                               244   2e-77   Solanum commersonii
ref|XP_002283529.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    258   2e-77   Vitis vinifera
emb|CBI37697.3|  unnamed protein product                                258   3e-77   Vitis vinifera
ref|XP_011047920.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    248   1e-73   Populus euphratica
ref|XP_011047909.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    248   2e-73   Populus euphratica
ref|XP_011047900.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...    248   2e-73   Populus euphratica
emb|CDO97017.1|  unnamed protein product                                246   1e-72   Coffea canephora [robusta coffee]
ref|XP_008382303.1|  PREDICTED: SUMO-activating enzyme subunit 2        241   7e-71   Malus domestica [apple tree]
ref|XP_010251621.1|  PREDICTED: SUMO-activating enzyme subunit 2        241   2e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008236951.1|  PREDICTED: SUMO-activating enzyme subunit 2        239   4e-70   Prunus mume [ume]
gb|KCW64019.1|  hypothetical protein EUGRSUZ_G016992                    238   5e-70   Eucalyptus grandis [rose gum]
ref|XP_009372987.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    238   9e-70   Pyrus x bretschneideri [bai li]
ref|XP_011037465.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    238   1e-69   Populus euphratica
ref|XP_002313776.1|  hypothetical protein POPTR_0009s12300g             239   1e-69   
ref|XP_010066186.1|  PREDICTED: SUMO-activating enzyme subunit 2        238   1e-69   Eucalyptus grandis [rose gum]
ref|XP_011037464.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    238   2e-69   Populus euphratica
ref|XP_004289650.1|  PREDICTED: SUMO-activating enzyme subunit 2        238   2e-69   Fragaria vesca subsp. vesca
ref|XP_007199741.1|  hypothetical protein PRUPE_ppa002704mg             235   1e-68   Prunus persica
ref|XP_004150065.1|  PREDICTED: SUMO-activating enzyme subunit 2        233   8e-68   Cucumis sativus [cucumbers]
gb|KDO49455.1|  hypothetical protein CISIN_1g006294mg                   231   5e-67   Citrus sinensis [apfelsine]
gb|KDO49456.1|  hypothetical protein CISIN_1g006294mg                   230   1e-66   Citrus sinensis [apfelsine]
ref|XP_006487357.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    230   1e-66   Citrus sinensis [apfelsine]
ref|XP_008460981.1|  PREDICTED: SUMO-activating enzyme subunit 2        230   1e-66   Cucumis melo [Oriental melon]
gb|KEH19101.1|  SUMO1 activating enzyme subunit 2                       229   2e-66   Medicago truncatula
ref|XP_002306122.2|  hypothetical protein POPTR_0004s166302g            227   8e-66   
ref|XP_003541605.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    226   4e-65   Glycine max [soybeans]
ref|XP_009347844.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    223   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_003540521.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    223   3e-64   Glycine max [soybeans]
ref|XP_009347843.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    222   1e-63   Pyrus x bretschneideri [bai li]
gb|KHN19464.1|  SUMO-activating enzyme subunit 2                        221   2e-63   Glycine soja [wild soybean]
ref|XP_004510996.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    219   1e-62   Cicer arietinum [garbanzo]
gb|KHG16253.1|  SUMO-activating enzyme subunit 2 -like protein          219   2e-62   Gossypium arboreum [tree cotton]
ref|XP_007042097.1|  SUMO-activating enzyme 2 isoform 1                 219   2e-62   Theobroma cacao [chocolate]
ref|XP_007133804.1|  hypothetical protein PHAVU_011G210500g             218   2e-62   Phaseolus vulgaris [French bean]
ref|XP_008357172.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    218   6e-62   Malus domestica [apple tree]
gb|KJB32552.1|  hypothetical protein B456_005G246300                    217   1e-61   Gossypium raimondii
gb|KJB32553.1|  hypothetical protein B456_005G246300                    217   1e-61   Gossypium raimondii
gb|KHG12220.1|  SUMO-activating enzyme subunit 2 -like protein          216   2e-61   Gossypium arboreum [tree cotton]
gb|KJB47535.1|  hypothetical protein B456_008G030900                    215   3e-61   Gossypium raimondii
gb|KJB47538.1|  hypothetical protein B456_008G030900                    214   4e-61   Gossypium raimondii
ref|XP_010942467.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    215   5e-61   Elaeis guineensis
gb|KJB47537.1|  hypothetical protein B456_008G030900                    215   6e-61   Gossypium raimondii
ref|XP_012067212.1|  PREDICTED: SUMO-activating enzyme subunit 2        208   2e-58   Jatropha curcas
ref|XP_010429058.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    207   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008777003.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    205   4e-58   Phoenix dactylifera
ref|XP_010690827.1|  PREDICTED: SUMO-activating enzyme subunit 2        206   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008777005.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    205   2e-57   
ref|XP_008777001.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    202   7e-57   
ref|XP_002512954.1|  ubiquitin-activating enzyme E1b, putative          203   1e-56   Ricinus communis
ref|XP_008797039.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    201   1e-56   
ref|XP_008797038.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    201   2e-56   
ref|XP_008797037.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    201   5e-56   Phoenix dactylifera
ref|XP_010938778.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    200   1e-55   Elaeis guineensis
ref|XP_010938777.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    199   2e-55   
ref|XP_010938776.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    200   2e-55   Elaeis guineensis
ref|XP_006838625.1|  PREDICTED: SUMO-activating enzyme subunit 2        199   3e-55   Amborella trichopoda
gb|EPS74543.1|  hypothetical protein M569_00206                         198   4e-55   Genlisea aurea
ref|XP_009399955.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    198   1e-54   
ref|XP_009140282.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    196   3e-54   Brassica rapa
emb|CDY15890.1|  BnaA04g12210D                                          196   3e-54   Brassica napus [oilseed rape]
ref|XP_006293831.1|  hypothetical protein CARUB_v10022825mg             196   3e-54   Capsella rubella
ref|XP_009412808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    193   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA41263.1|  TPA: hypothetical protein ZEAMMB73_736183              182   2e-52   
emb|CDX99589.1|  BnaC04g33460D                                          191   4e-52   
ref|XP_010416892.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    190   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010531451.1|  PREDICTED: SUMO-activating enzyme subunit 2        190   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010472141.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    189   1e-51   
ref|XP_010107832.1|  SUMO-activating enzyme subunit 2                   189   1e-51   
ref|XP_010236228.1|  PREDICTED: SUMO-activating enzyme subunit 2        189   2e-51   Brachypodium distachyon [annual false brome]
gb|KFK32895.1|  hypothetical protein AALP_AA6G302000                    188   2e-51   Arabis alpina [alpine rockcress]
gb|EMS58354.1|  SUMO-activating enzyme subunit 2                        188   3e-51   Triticum urartu
gb|EMT21367.1|  SUMO-activating enzyme subunit 2                        188   3e-51   
ref|XP_006404595.1|  hypothetical protein EUTSA_v10000089mg             188   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006657898.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    187   6e-51   
ref|NP_179742.2|  SUMO-activating enzyme subunit 2                      187   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189570.1|  SUMO-activating enzyme subunit 2                   187   1e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82033.1|  BnaC08g35680D                                          186   2e-50   
ref|XP_009117402.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    184   1e-49   Brassica rapa
emb|CDY13814.1|  BnaA09g43160D                                          183   2e-49   Brassica napus [oilseed rape]
ref|XP_008670523.1|  PREDICTED: SUMO-activating enzyme subunit 2        182   7e-49   
gb|KCW64020.1|  hypothetical protein EUGRSUZ_G016992                    178   4e-48   Eucalyptus grandis [rose gum]
ref|XP_006423380.1|  hypothetical protein CICLE_v100281692mg            173   2e-47   
ref|XP_003627740.1|  SUMO activating enzyme                             167   3e-47   
gb|EEC82353.1|  hypothetical protein OsI_26664                          176   9e-47   Oryza sativa Indica Group [Indian rice]
gb|EEE67493.1|  hypothetical protein OsJ_24922                          176   1e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460940.1|  hypothetical protein SORBIDRAFT_02g037850          175   2e-46   Sorghum bicolor [broomcorn]
ref|XP_004958165.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    172   1e-45   Setaria italica
gb|AAN03851.1|  SUMO activating enzyme 2                                167   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992493.1|  SUMO activating enzyme 2                           163   3e-42   
emb|CAD67688.1|  putative ubiquitin activating enzyme                   159   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973506.1|  SUMO-activating enzyme subunit 2                      160   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002990197.1|  SUMO activating enzyme 2                           159   6e-41   
ref|XP_002878554.1|  sumo-activating enzyme 2                           158   2e-40   
ref|XP_009399956.1|  PREDICTED: SUMO-activating enzyme subunit 2-...    151   3e-38   
ref|XP_001775802.1|  predicted protein                                  137   3e-33   
ref|XP_007042099.1|  SUMO-activating enzyme 2 isoform 3                 130   6e-31   
ref|XP_007042098.1|  SUMO-activating enzyme 2 isoform 2                 129   1e-30   
gb|KJB47539.1|  hypothetical protein B456_008G030900                    127   6e-30   Gossypium raimondii
gb|KDO49457.1|  hypothetical protein CISIN_1g006294mg                   125   4e-29   Citrus sinensis [apfelsine]
gb|KJB32554.1|  hypothetical protein B456_005G246300                    123   2e-28   Gossypium raimondii
ref|XP_001762389.1|  predicted protein                                  122   2e-28   
dbj|BAD95040.1|  ubiquitin activating enzyme like protein               108   2e-25   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA41264.1|  TPA: hypothetical protein ZEAMMB73_736183            97.1    1e-21   
ref|XP_003078790.1|  SUMO activating enzyme 2 (ISS)                   99.8    4e-20   
emb|CEF97583.1|  Molybdenum cofactor biosynthesis, MoeB               99.8    5e-20   Ostreococcus tauri
ref|XP_009519056.1|  hypothetical protein PHYSODRAFT_349758           86.3    2e-15   Phytophthora sojae
ref|XP_001417248.1|  predicted protein                                85.1    4e-15   Ostreococcus lucimarinus CCE9901
ref|XP_002999118.1|  ubiquitin-activating enzyme (E1), putative       83.2    2e-14   Phytophthora infestans T30-4
emb|CBJ28585.1|  putative ubiquitin activating enzyme                 80.9    2e-14   Ectocarpus siliculosus
ref|XP_008869322.1|  hypothetical protein H310_06150                  80.1    1e-13   Aphanomyces invadans
emb|CCI48953.1|  unnamed protein product                              78.6    5e-13   Albugo candida
ref|XP_004359730.1|  sumo-activating enzyme subunit 2                 78.6    6e-13   Cavenderia fasciculata
dbj|GAM22192.1|  hypothetical protein SAMD00019534_053670             78.2    9e-13   Acytostelium subglobosum LB1
gb|ETP47472.1|  hypothetical protein F442_06579                       74.3    1e-11   Phytophthora parasitica P10297
ref|XP_008892081.1|  hypothetical protein PPTG_02637                  74.3    1e-11   Phytophthora parasitica INRA-310
gb|ETI49760.1|  hypothetical protein F443_06536                       74.3    1e-11   Phytophthora parasitica P1569
gb|EFA83622.1|  sumo-activating enzyme subunit 2                      74.3    1e-11   Heterostelium album PN500
emb|CCA14752.1|  ubiquitinactivating enzyme (E1) putative             73.9    2e-11   Albugo laibachii Nc14
ref|XP_009844967.1|  hypothetical protein H257_17773                  72.8    4e-11   Aphanomyces astaci
gb|EWM25223.1|  sumo-activating enzyme subunit 2                      70.5    3e-10   Nannochloropsis gaditana
ref|XP_003285101.1|  hypothetical protein DICPUDRAFT_76062            67.8    2e-09   Dictyostelium purpureum
ref|XP_002178935.1|  sumo-activating enzyme 2                         67.0    4e-09   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002679801.1|  ubiquitin-like 1 activating enzyme E1B           64.3    3e-08   Naegleria gruberi strain NEG-M
ref|XP_002505850.1|  SUMO1 activating enzyme subunit 2                63.9    4e-08   Micromonas commoda
ref|XP_008613648.1|  hypothetical protein SDRG_09489                  63.5    5e-08   Saprolegnia diclina VS20
ref|XP_005856332.1|  hypothetical protein NGA_2085000                 61.2    6e-08   Nannochloropsis gaditana CCMP526
gb|KDO27496.1|  hypothetical protein SPRG_07085                       63.2    7e-08   Saprolegnia parasitica CBS 223.65
ref|XP_007512390.1|  predicted protein                                63.2    7e-08   Bathycoccus prasinos
ref|XP_005713926.1|  unnamed protein product                          62.0    2e-07   Chondrus crispus [carageen]
ref|XP_011431808.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  61.6    2e-07   Crassostrea gigas
ref|XP_003063899.1|  SUMO1 activating enzyme subunit 2                61.6    3e-07   Micromonas pusilla CCMP1545
ref|XP_002949965.1|  hypothetical protein VOLCADRAFT_104505           60.1    9e-07   Volvox carteri f. nagariensis
ref|XP_003706783.1|  PREDICTED: SUMO-activating enzyme subunit 2      59.3    1e-06   Megachile rotundata
ref|XP_637463.1|  sumo-activating enzyme subunit 2                    59.3    1e-06   Dictyostelium discoideum AX4
gb|EPT26082.1|  ThiF family protein                                   57.4    6e-06   Toxoplasma gondii ME49
gb|KFG44348.1|  ThiF family protein                                   57.4    7e-06   Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|KFG28675.1|  ThiF family protein                                   57.4    7e-06   Toxoplasma gondii p89
gb|EPR61099.1|  ThiF family protein                                   57.4    7e-06   Toxoplasma gondii GT1
ref|XP_002364392.1|  ubiquitin-activating enzyme, putative            57.0    8e-06   
ref|XP_002131488.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  56.2    1e-05   Ciona intestinalis [sea vase]
ref|XP_005844208.1|  hypothetical protein CHLNCDRAFT_27175            55.8    2e-05   Chlorella variabilis
ref|XP_005101963.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  55.1    4e-05   
emb|CBY21846.1|  unnamed protein product                              55.1    4e-05   Oikopleura dioica
ref|XP_392715.4|  PREDICTED: SUMO-activating enzyme subunit 2 iso...  54.7    4e-05   Apis mellifera [bee]
ref|XP_006564548.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  54.7    4e-05   Apis mellifera [bee]
ref|XP_003698305.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...  54.7    4e-05   Apis florea [dwarf honeybee]
gb|KDD77029.1|  ThiF family protein                                   54.7    5e-05   Helicosporidium sp. ATCC 50920
ref|XP_001638517.1|  predicted protein                                53.1    1e-04   Nematostella vectensis
ref|XP_009943706.1|  PREDICTED: SUMO-activating enzyme subunit 2      53.1    1e-04   Opisthocomus hoazin [hoatzin]
gb|KFR04614.1|  SUMO-activating enzyme subunit 2                      53.1    1e-04   Opisthocomus hoazin [hoatzin]
ref|XP_011054419.1|  PREDICTED: SUMO-activating enzyme subunit 2      52.8    2e-04   Acromyrmex echinatior
ref|XP_007440000.1|  PREDICTED: SUMO-activating enzyme subunit 2      52.4    2e-04   
ref|XP_008561176.1|  PREDICTED: SUMO-activating enzyme subunit 2      52.4    3e-04   Microplitis demolitor
ref|XP_006613941.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  52.0    4e-04   Apis dorsata [rock honeybee]
ref|XP_004365946.1|  SUMO-activating enzyme subunit 2                 52.0    4e-04   Capsaspora owczarzaki ATCC 30864
ref|XP_006641254.1|  PREDICTED: LOW QUALITY PROTEIN: SUMO-activat...  51.6    4e-04   
ref|XP_012058636.1|  PREDICTED: SUMO-activating enzyme subunit 2      51.6    4e-04   Atta cephalotes
ref|XP_003885142.1|  AFR138Wp, related                                51.6    5e-04   Neospora caninum Liverpool
ref|XP_008885854.1|  ThiF family protein                              51.2    6e-04   
ref|NP_001135121.1|  SUMO-activating enzyme subunit 2                 51.2    6e-04   Salmo salar
gb|KFM09912.1|  SUMO-activating enzyme subunit 2                      50.8    7e-04   Aptenodytes forsteri
ref|XP_009281145.1|  PREDICTED: SUMO-activating enzyme subunit 2      50.8    7e-04   Aptenodytes forsteri
ref|XP_010141224.1|  PREDICTED: SUMO-activating enzyme subunit 2      50.8    7e-04   Buceros rhinoceros silvestris
ref|XP_005229439.1|  PREDICTED: SUMO-activating enzyme subunit 2      50.8    9e-04   
emb|CDQ59515.1|  unnamed protein product                              50.8    0.001   Oncorhynchus mykiss
ref|XP_004176084.1|  PREDICTED: SUMO-activating enzyme subunit 2      50.8    0.001   Taeniopygia guttata



>ref|XP_006362029.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Solanum tuberosum]
Length=652

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 170/227 (75%), Gaps = 19/227 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KLRDFVEKIVKAKLGM+LPLIM+G ALLYEVGDDL+E
Sbjct  429  EPNKSCYVCSETPLTLEINTHRSKLRDFVEKIVKAKLGMSLPLIMHGVALLYEVGDDLEE  488

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C+INIKHREEFDEEK+PDGMVLS
Sbjct  489  DEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKCSINIKHREEFDEEKEPDGMVLS  548

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLCDT  293
            GWTP LA+E     T DNG SSS ASQT PL++ ++D++E IL     ++ GKKRK  D 
Sbjct  549  GWTPALAAEKTK--TSDNGPSSSNASQTVPLESEDNDEIEIILKDPEILAAGKKRKSSDV  606

Query  292  N---------------PDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
            +                 RKVEE DD  +  V +DGN D +KK+RVQ
Sbjct  607  SVAVDSEMFSVTGEMLTKRKVEE-DDSHNDIVMVDGNLDPNKKKRVQ  652



>ref|XP_009606961.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana tomentosiformis]
Length=652

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 167/226 (74%), Gaps = 16/226 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KLRDFVEK+VKAKLGM+LPLIM+G ALLYEVGDDL+E
Sbjct  427  EPNKSCYVCSETPLTLEINTHRSKLRDFVEKVVKAKLGMSLPLIMHGVALLYEVGDDLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANLDKVL EL  PV GGTI+ VEDLQQEL CNINIKHREEFDEEK+PD MVLS
Sbjct  487  DEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKCNINIKHREEFDEEKEPDEMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLCDT  293
            GWTP LA+E   KT+ DNG SSS ASQT  L+  +DD+LE IL     +S G KRKL D 
Sbjct  547  GWTPALATEKKTKTS-DNGPSSSNASQTVQLEPEDDDELEIILKDPEILSAGNKRKLSDI  605

Query  292  N--PDRKVE------------ELDDDGDGFVTLDGNSDGSKKQRVQ  197
            +   D +V             E DD       LDGNSD SKK+RVQ
Sbjct  606  SVTADSEVSRVTGEMQTKSHAEADDTHTDTAMLDGNSDISKKKRVQ  651



>ref|XP_010315319.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Solanum 
lycopersicum]
Length=607

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 168/227 (74%), Gaps = 19/227 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KLRDFV+KIVK KLGM+LPLIM+G ALLYEVGDDL+E
Sbjct  384  EPNKSCYVCSETPLTLEINTHRSKLRDFVDKIVKEKLGMSLPLIMHGVALLYEVGDDLEE  443

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C+INIKHREEFDEEK+PDGMVLS
Sbjct  444  DEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKCSINIKHREEFDEEKEPDGMVLS  503

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLCDT  293
            GWTP LA+E     T DNG SSS ASQT PL++ ++D++E IL     ++ GKKRK  D 
Sbjct  504  GWTPALAAEKTK--TLDNGPSSSNASQTVPLESEDNDEIEIILKDPEILAAGKKRKSSDV  561

Query  292  N---------------PDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
            +                 +KVEE DD  +  V +DG  D +KK+RVQ
Sbjct  562  SVAVDPEIFSVTGAMLTKKKVEE-DDSNNDIVMVDGKLDLNKKKRVQ  607



>ref|XP_004230873.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Solanum 
lycopersicum]
Length=650

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 168/227 (74%), Gaps = 19/227 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KLRDFV+KIVK KLGM+LPLIM+G ALLYEVGDDL+E
Sbjct  427  EPNKSCYVCSETPLTLEINTHRSKLRDFVDKIVKEKLGMSLPLIMHGVALLYEVGDDLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C+INIKHREEFDEEK+PDGMVLS
Sbjct  487  DEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKCSINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLCDT  293
            GWTP LA+E     T DNG SSS ASQT PL++ ++D++E IL     ++ GKKRK  D 
Sbjct  547  GWTPALAAEKTK--TLDNGPSSSNASQTVPLESEDNDEIEIILKDPEILAAGKKRKSSDV  604

Query  292  N---------------PDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
            +                 +KVEE DD  +  V +DG  D +KK+RVQ
Sbjct  605  SVAVDPEIFSVTGAMLTKKKVEE-DDSNNDIVMVDGKLDLNKKKRVQ  650



>ref|XP_009765006.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana sylvestris]
Length=651

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 166/226 (73%), Gaps = 16/226 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KLRDFVEK+VKAKLGM+LPLIM+G ALLYEVGDDL+E
Sbjct  427  EPNKSCYVCSETPLTLEINTHRSKLRDFVEKVVKAKLGMSLPLIMHGVALLYEVGDDLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C+INIKHREEFDEEK+PD MVLS
Sbjct  487  DEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKCSINIKHREEFDEEKEPDEMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLCDT  293
            GWTP LA+E   KT+ DNG SSS ASQ    +  +DD+LE IL     +S G KRKL D 
Sbjct  547  GWTPALAAEKKTKTS-DNGPSSSNASQAVQPEPEDDDELEIILKDPEILSAGNKRKLSDI  605

Query  292  N--PDRKVEEL------------DDDGDGFVTLDGNSDGSKKQRVQ  197
            +   D +V  +            DD     + +DGNSD SKK+RVQ
Sbjct  606  SNTADSEVSRVTGEMQTKSHVEEDDTHTDTIMIDGNSDISKKKRVQ  651



>gb|EYU37827.1| hypothetical protein MIMGU_mgv1a002832mg [Erythranthe guttata]
Length=633

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 166/224 (74%), Gaps = 16/224 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEIN H +KLRD V+KIVKAKLGMNLPLIM+G+ALLYEVGDDL+E
Sbjct  412  EPNKSCYVCSETPLTLEINAHRSKLRDLVDKIVKAKLGMNLPLIMHGSALLYEVGDDLEE  471

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANL+KVL EL  PV GGTI+ VEDLQQEL C+INIKHREEFDEEK+PDGM+LS
Sbjct  472  DEVANYAANLEKVLSELPSPVMGGTILTVEDLQQELKCSINIKHREEFDEEKEPDGMILS  531

Query  469  GWTPVLASENNNKT-THDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDT  293
            GWTP LA+E N  T T +NGAS+S  SQ   L   EDDDL+I+PT      GKKRK+ D 
Sbjct  532  GWTPALAAEKNGSTSTTENGASTSGVSQATSLMTEEDDDLQIIPTQPG---GKKRKISDL  588

Query  292  NP-----------DRKVEELDDDGDG-FVTLDGNSDGSKKQRVQ  197
            +            D K++  D DG+   V LD  S G+ K++++
Sbjct  589  SSAATSDFSSVAKDTKIQRKDVDGNNDVVMLDDGSLGNSKKKIE  632



>ref|XP_010645393.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Vitis 
vinifera]
Length=521

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 15/217 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NTH +KLRDFVEKIVKAKLGMN PLIM+G ALLYEVGDDLD+
Sbjct  314  EPNKSCYVCSETPLLLEVNTHRSKLRDFVEKIVKAKLGMNCPLIMHGPALLYEVGDDLDK  373

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M  NYAANL+KVL EL  PV GGT++ VEDLQQE TCNINIKHREEFDEEK+PDGM+LS
Sbjct  374  DMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTCNINIKHREEFDEEKEPDGMLLS  433

Query  469  GWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT     E ++NKT  + G+S+S AS   P++A EDDD+E +PT      GKKRK+ + 
Sbjct  434  GWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDDDIEFVPT------GKKRKVGEI  487

Query  295  ---TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  197
               TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  488  SKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  521



>ref|XP_011088448.1| PREDICTED: SUMO-activating enzyme subunit 2 [Sesamum indicum]
Length=648

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 164/226 (73%), Gaps = 19/226 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KL+D V+KIVKAKLGMNLPLIM+G++LLYEVGDDL+E
Sbjct  427  EPNKSCYVCSETPLTLEINTHGSKLKDLVDKIVKAKLGMNLPLIMHGSSLLYEVGDDLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANL+KVL EL  PV GGTI+ VEDLQQEL C+IN+KHREEFDEEK+PDGMVLS
Sbjct  487  DEVANYAANLEKVLSELPSPVIGGTILTVEDLQQELKCSINVKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC---  299
            GWT  LA E N K + DNGAS+S  S+T  L   +DD+L+I+P   A    KKRKL    
Sbjct  547  GWTQPLAVEKNGKGSTDNGASTSRVSETTSLVMEDDDELQIIPAQIA----KKRKLSDIS  602

Query  298  ------------DTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                        +    RK EE D++ D  +   G+S+ SKK+R Q
Sbjct  603  SAASSDASSFRNEAKFKRKAEEADNNNDVVMLDGGSSENSKKKREQ  648



>emb|CAJ19271.1| SUMO activating enzyme 2 [Solanum commersonii]
Length=172

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINTH +KLRDFVEKIVKAKLGM+LPLIM+G ALLYEVGDDL+E
Sbjct  20   EPNKSCYVCSETPLTLEINTHRSKLRDFVEKIVKAKLGMSLPLIMHGVALLYEVGDDLEE  79

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANLDKVL EL  PV GGTI+ VEDLQQEL C+INIKHREEFDEEK+PDGMVLS
Sbjct  80   DEVANYAANLDKVLSELPSPVTGGTILTVEDLQQELKCSINIKHREEFDEEKEPDGMVLS  139

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAP  380
            GWTP LA+E     T DNG SSS ASQT P
Sbjct  140  GWTPALAAEKTK--TSDNGPSSSNASQTVP  167



>ref|XP_002283529.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Vitis 
vinifera]
Length=634

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 15/217 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NTH +KLRDFVEKIVKAKLGMN PLIM+G ALLYEVGDDLD+
Sbjct  427  EPNKSCYVCSETPLLLEVNTHRSKLRDFVEKIVKAKLGMNCPLIMHGPALLYEVGDDLDK  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M  NYAANL+KVL EL  PV GGT++ VEDLQQE TCNINIKHREEFDEEK+PDGM+LS
Sbjct  487  DMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTCNINIKHREEFDEEKEPDGMLLS  546

Query  469  GWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT     E ++NKT  + G+S+S AS   P++A EDDD+E +PT      GKKRK+ + 
Sbjct  547  GWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDDDIEFVPT------GKKRKVGEI  600

Query  295  ---TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  197
               TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  601  SKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  634



>emb|CBI37697.3| unnamed protein product [Vitis vinifera]
Length=618

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 15/217 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NTH +KLRDFVEKIVKAKLGMN PLIM+G ALLYEVGDDLD+
Sbjct  411  EPNKSCYVCSETPLLLEVNTHRSKLRDFVEKIVKAKLGMNCPLIMHGPALLYEVGDDLDK  470

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M  NYAANL+KVL EL  PV GGT++ VEDLQQE TCNINIKHREEFDEEK+PDGM+LS
Sbjct  471  DMAANYAANLEKVLSELPSPVTGGTMLTVEDLQQEFTCNINIKHREEFDEEKEPDGMLLS  530

Query  469  GWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT     E ++NKT  + G+S+S AS   P++A EDDD+E +PT      GKKRK+ + 
Sbjct  531  GWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDDDIEFVPT------GKKRKVGEI  584

Query  295  ---TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  197
               TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  585  SKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  618



>ref|XP_011047920.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X3 [Populus 
euphratica]
Length=614

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 170/230 (74%), Gaps = 20/230 (9%)
 Frame = -3

Query  829  EPNKSCYVCS-ETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLD  653
            EPNKSC+VCS +TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM G+ALLYEVGDDL+
Sbjct  386  EPNKSCFVCSSQTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMCGSALLYEVGDDLE  445

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVL  473
            E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TCNI IKHREEFDEEK+PDGMVL
Sbjct  446  EDMIANYTANLEKVLSELPSPVIGGKMLTVEDLQQEFTCNIYIKHREEFDEEKEPDGMVL  505

Query  472  SGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            SGWT  L  + ++KT+  NGAS+S +  T P+DA +D +++ +  GTA SPGKKRKL   
Sbjct  506  SGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIEVKEISDGTA-SPGKKRKLPEF  564

Query  301  ---C---------DTNPDRKVEEL--DDDGDGFVTLD-GNSDGSKKQRVQ  197
               C         +T  D+K+++L  DDD D  V LD    D SKKQR+Q
Sbjct  565  SEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHWGKDTSKKQRLQ  614



>ref|XP_011047909.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Populus 
euphratica]
Length=652

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 170/230 (74%), Gaps = 20/230 (9%)
 Frame = -3

Query  829  EPNKSCYVCS-ETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLD  653
            EPNKSC+VCS +TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM G+ALLYEVGDDL+
Sbjct  424  EPNKSCFVCSSQTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMCGSALLYEVGDDLE  483

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVL  473
            E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TCNI IKHREEFDEEK+PDGMVL
Sbjct  484  EDMIANYTANLEKVLSELPSPVIGGKMLTVEDLQQEFTCNIYIKHREEFDEEKEPDGMVL  543

Query  472  SGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            SGWT  L  + ++KT+  NGAS+S +  T P+DA +D +++ +  GTA SPGKKRKL   
Sbjct  544  SGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIEVKEISDGTA-SPGKKRKLPEF  602

Query  301  ---C---------DTNPDRKVEEL--DDDGDGFVTLD-GNSDGSKKQRVQ  197
               C         +T  D+K+++L  DDD D  V LD    D SKKQR+Q
Sbjct  603  SEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHWGKDTSKKQRLQ  652



>ref|XP_011047900.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Populus 
euphratica]
Length=657

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 170/230 (74%), Gaps = 20/230 (9%)
 Frame = -3

Query  829  EPNKSCYVCS-ETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLD  653
            EPNKSC+VCS +TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM G+ALLYEVGDDL+
Sbjct  429  EPNKSCFVCSSQTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMCGSALLYEVGDDLE  488

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVL  473
            E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TCNI IKHREEFDEEK+PDGMVL
Sbjct  489  EDMIANYTANLEKVLSELPSPVIGGKMLTVEDLQQEFTCNIYIKHREEFDEEKEPDGMVL  548

Query  472  SGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            SGWT  L  + ++KT+  NGAS+S +  T P+DA +D +++ +  GTA SPGKKRKL   
Sbjct  549  SGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIEVKEISDGTA-SPGKKRKLPEF  607

Query  301  ---C---------DTNPDRKVEEL--DDDGDGFVTLD-GNSDGSKKQRVQ  197
               C         +T  D+K+++L  DDD D  V LD    D SKKQR+Q
Sbjct  608  SEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHWGKDTSKKQRLQ  657



>emb|CDO97017.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 160/224 (71%), Gaps = 20/224 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPLTLEINT  +KLRDFVEKIVKAKLGM+ P+IM+G ALLYEVGD L+E
Sbjct  427  EPNKSCYVCSETPLTLEINTSRSKLRDFVEKIVKAKLGMSQPMIMHGHALLYEVGDGLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M   YAANL+KVL +L  PV GGT++ VEDLQQELTC INIKHREEFD EK+PDGM+LS
Sbjct  487  DMATTYAANLEKVLAQLPSPVTGGTVIMVEDLQQELTCTINIKHREEFDGEKEPDGMILS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            G T  L  + N++ + +NGAS+S  SQT  ++A EDD+L+ILP  + ++ GKKRKL D  
Sbjct  547  GLTEALV-QKNDEASKENGASTSNVSQTVSVEAEEDDELQILPAVSGLA-GKKRKLPDNA  604

Query  289  ----------------PDRKVEELDDDGDGFVTLDGNSDGSKKQ  206
                            P + ++   +D +  V LDGN +  KK+
Sbjct  605  NSSNSDLSGVIDETKIPRKAIDR--EDSEAVVVLDGNGERKKKR  646



>ref|XP_008382303.1| PREDICTED: SUMO-activating enzyme subunit 2 [Malus domestica]
Length=644

 Score =   241 bits (616),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 160/227 (70%), Gaps = 25/227 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH  KLRD VEKIV+AKLGM+LPLIM+G+ALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTHCTKLRDVVEKIVRAKLGMSLPLIMHGSALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  487  DMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSCKINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GWT   A   ++K +  N  S+S AS +  ++A   DD+E        +PG+KRKL +  
Sbjct  547  GWTQSPAVAQDDKKSTANAGSTSNASSS--MEAERTDDVE-------TTPGRKRKLSEVS  597

Query  295  --TNPD------------RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
               NPD             K+E +DDD +  +  + +S  SKK ++Q
Sbjct  598  EAVNPDIPSVAGSSTRNPEKLELVDDDDELVIFDNWDSVTSKKIKLQ  644



>ref|XP_010251621.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nelumbo nucifera]
Length=647

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 159/226 (70%), Gaps = 20/226 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NTH +KLRDFVEKIVKAKLGMNLPLIM+G+ LLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLLLEVNTHRSKLRDFVEKIVKAKLGMNLPLIMHGSTLLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY++NL+KVL EL  PV GGT++ VEDLQQELTCNINIKHREEFDEEK+PDGM+LS
Sbjct  487  DMVANYSSNLEKVLAELPSPVTGGTVLTVEDLQQELTCNINIKHREEFDEEKEPDGMLLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRK-----  305
            GW      +  N    DN  S+S  SQ   ++  + ++ EI+     +S G KRK     
Sbjct  547  GWVQSPQMKKVNHKQVDNEDSTSIVSQPVHVETEDVNETEIV-----VSTGTKRKSSEIS  601

Query  304  ---------LCDTNPDRKVEELD-DDGDGFVTLDGNSDGSKKQRVQ  197
                        T  ++K EE++ DD D  V LDG+SD  KK+R+Q
Sbjct  602  STSSIASAASVGTRSNQKPEEINDDDDDDLVILDGHSDTLKKKRLQ  647



>ref|XP_008236951.1| PREDICTED: SUMO-activating enzyme subunit 2 [Prunus mume]
Length=642

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 165/229 (72%), Gaps = 31/229 (14%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETPL+LEINTH AKLRDFVEKIVKA LGM+LPLIM+G+ALLYEVGDDLDE
Sbjct  427  EPNRSCYVCSETPLSLEINTHRAKLRDFVEKIVKATLGMSLPLIMHGSALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
            +MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  487  EMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSCQINIKHREEFDEEKEPDGMVLS  546

Query  469  GWT--PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD  296
            GWT  P +  ++N     ++ A++ + S   P++A ++D++E       I P KKR+L +
Sbjct  547  GWTQAPSVVKDDN-----ESIANAGSTSNEPPVEAEKNDEIE-------IPPEKKRRLSE  594

Query  295  T----------------NPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                             NPD K++ LDDD +  +  + +S  +KK+R+Q
Sbjct  595  VSEAVDPDLSSVDGDTRNPD-KLQVLDDDDELMIFDNWDSVPNKKKRMQ  642



>gb|KCW64019.1| hypothetical protein EUGRSUZ_G016992, partial [Eucalyptus grandis]
Length=609

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 158/226 (70%), Gaps = 16/226 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH + LR+FV+KIVKAKLGMNLPLIM+G+ALLYEVGDDL+E
Sbjct  385  EPNKSCYVCSETPLSLEINTHRSTLREFVDKIVKAKLGMNLPLIMHGSALLYEVGDDLEE  444

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANL+KVL EL  PV  GT++ VEDLQQELTCNI+IKHREEFDEEK+PDGMVLS
Sbjct  445  DMVTNYAANLEKVLSELPSPVTSGTLLTVEDLQQELTCNISIKHREEFDEEKEPDGMVLS  504

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GWTP  A E  ++   DNG  +S     A      ++DLEI+P        KKRKL +  
Sbjct  505  GWTPAPAVEKKDENHVDNGVGTSKNITNAE-QVETNEDLEIVPADIETPAEKKRKLSEIS  563

Query  295  -------------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                          N   KV++LDDD D      G+SD SKK+++ 
Sbjct  564  NNDGLGTSRVAAKANNHSKVQDLDDDDDVVFISGGDSDPSKKRKLH  609



>ref|XP_009372987.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Pyrus x bretschneideri]
Length=643

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 159/227 (70%), Gaps = 26/227 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH  KLRD VEKIV+AKLGM+LPLIM+G+ALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTHRTKLRDVVEKIVRAKLGMSLPLIMHGSALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  487  DMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSCKINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GWT   A   ++K +  N  S+S AS  A  +A + DD+E        + G+KRKL +  
Sbjct  547  GWTQSPAVAQDDKKSTANAGSTSNAS--ASTEAEKTDDVE--------TTGRKRKLSEAS  596

Query  295  --TNPD------------RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
               NPD             K+E +DDD +  +  + +S  SKK ++Q
Sbjct  597  EAVNPDIPSVAGSSTRNPEKLELVDDDDELVIFDNWDSVTSKKIKLQ  643



>ref|XP_011037465.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Populus 
euphratica]
Length=605

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 161/225 (72%), Gaps = 18/225 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSC VCS+TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM+  ALLYE+GDDL+E
Sbjct  381  EPNKSCCVCSKTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMHATALLYEIGDDLEE  440

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              + NY ANL+KVL EL PPV  GT++ VEDLQQE TCNI+IKHREEFDEEK+PDGMVLS
Sbjct  441  NEIANYTANLEKVLSELPPPVTDGTVLTVEDLQQEFTCNIHIKHREEFDEEKEPDGMVLS  500

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GWT   + + ++KT+  NGAS+S +  T       D +++ +  GT +SPG KRKL +  
Sbjct  501  GWTQAPSEKKDDKTSIGNGASTSKSLPTKLGITEIDIEVKEISGGT-VSPGTKRKLSEFS  559

Query  295  -------------TNPDRKVEELDDDGDGFVTLD-GNSDGSKKQR  203
                         T  ++K ++ DDDG G V LD  +S+ SKKQR
Sbjct  560  DGSTVDQSSDVDQTRNNKKTQKHDDDG-GLVMLDHWDSNMSKKQR  603



>ref|XP_002313776.1| hypothetical protein POPTR_0009s12300g [Populus trichocarpa]
 gb|EEE87731.1| hypothetical protein POPTR_0009s12300g [Populus trichocarpa]
Length=662

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = -3

Query  829  EPNKSCYVCS-ETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLD  653
            EPNKSC+VCS +TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM G ALLYEVGDDL+
Sbjct  435  EPNKSCFVCSSQTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMCGLALLYEVGDDLE  494

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVL  473
            E M+ NY ANL+KVL EL  PV GG ++ VEDLQQE TCNI IKHREEFDEEK+PDGMVL
Sbjct  495  EDMIANYTANLEKVLSELPSPVTGGKMLTVEDLQQEFTCNIYIKHREEFDEEKEPDGMVL  554

Query  472  SGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL  302
            SGWT     + ++KT+  NGAS+S +  T P+DA +D  ++ +  GTA SPGKKRKL
Sbjct  555  SGWTQAPPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIKVKEISDGTA-SPGKKRKL  610



>ref|XP_010066186.1| PREDICTED: SUMO-activating enzyme subunit 2 [Eucalyptus grandis]
Length=650

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 158/226 (70%), Gaps = 16/226 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH + LR+FV+KIVKAKLGMNLPLIM+G+ALLYEVGDDL+E
Sbjct  426  EPNKSCYVCSETPLSLEINTHRSTLREFVDKIVKAKLGMNLPLIMHGSALLYEVGDDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANL+KVL EL  PV  GT++ VEDLQQELTCNI+IKHREEFDEEK+PDGMVLS
Sbjct  486  DMVTNYAANLEKVLSELPSPVTSGTLLTVEDLQQELTCNISIKHREEFDEEKEPDGMVLS  545

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GWTP  A E  ++   DNG  +S     A      ++DLEI+P        KKRKL +  
Sbjct  546  GWTPAPAVEKKDENHVDNGVGTSKNITNAE-QVETNEDLEIVPADIETPAEKKRKLSEIS  604

Query  295  -------------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                          N   KV++LDDD D      G+SD SKK+++ 
Sbjct  605  NNDGLGTSRVAAKANNHSKVQDLDDDDDVVFISGGDSDPSKKRKLH  650



>ref|XP_011037464.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Populus 
euphratica]
Length=648

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 161/225 (72%), Gaps = 18/225 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSC VCS+TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM+  ALLYE+GDDL+E
Sbjct  424  EPNKSCCVCSKTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMHATALLYEIGDDLEE  483

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              + NY ANL+KVL EL PPV  GT++ VEDLQQE TCNI+IKHREEFDEEK+PDGMVLS
Sbjct  484  NEIANYTANLEKVLSELPPPVTDGTVLTVEDLQQEFTCNIHIKHREEFDEEKEPDGMVLS  543

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GWT   + + ++KT+  NGAS+S +  T       D +++ +  GT +SPG KRKL +  
Sbjct  544  GWTQAPSEKKDDKTSIGNGASTSKSLPTKLGITEIDIEVKEISGGT-VSPGTKRKLSEFS  602

Query  295  -------------TNPDRKVEELDDDGDGFVTLD-GNSDGSKKQR  203
                         T  ++K ++ DDDG G V LD  +S+ SKKQR
Sbjct  603  DGSTVDQSSDVDQTRNNKKTQKHDDDG-GLVMLDHWDSNMSKKQR  646



>ref|XP_004289650.1| PREDICTED: SUMO-activating enzyme subunit 2 [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 10/180 (6%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT  AKLRD VEK+VK KLGMN PLIM+GAALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTSRAKLRDIVEKVVKNKLGMNSPLIMHGAALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M+ NYAANLDKVL E   PV  GT++ +EDLQQEL+CNINIKHREEFDEEK+PDGMVLS
Sbjct  487  AMIRNYAANLDKVLSEFPSPVTSGTMLTIEDLQQELSCNINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWTP  +   ++K ++ N  S+S+AS+   L+A+++++ E        +PGKKRKL + +
Sbjct  547  GWTPATSVVKDDKKSNANAGSTSSASE---LEADKNNEAE-------TAPGKKRKLSEVS  596



>ref|XP_007199741.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
 gb|EMJ00940.1| hypothetical protein PRUPE_ppa002704mg [Prunus persica]
Length=642

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 159/227 (70%), Gaps = 27/227 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETPL+LEINTH AKLRDFVEKIVKA LGM+LPLIM+G+ALLYE+GDDLDE
Sbjct  427  EPNRSCYVCSETPLSLEINTHHAKLRDFVEKIVKAMLGMSLPLIMHGSALLYEIGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
            +MV NYAANLDKVL EL  PV  GT++ +EDLQQEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  487  EMVANYAANLDKVLSELPTPVTSGTMLTIEDLQQELSCQINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDT-  293
            GWT   +   ++K +  N  S+S       ++A ++D++E       I P KKRKL +  
Sbjct  547  GWTQAPSVVKDDKESIANAGSTSNEPS---VEAEKNDEIE-------IPPEKKRKLSEIS  596

Query  292  ---------------NPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                           NPD K++ LDDD +  +  + +S   KK R+Q
Sbjct  597  EAVYPDLSSVDGDTRNPD-KLQVLDDDDELMIFDNWDSVTDKKIRMQ  642



>ref|XP_004150065.1| PREDICTED: SUMO-activating enzyme subunit 2 [Cucumis sativus]
 gb|KGN61828.1| hypothetical protein Csa_2G249830 [Cucumis sativus]
Length=641

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 150/210 (71%), Gaps = 23/210 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH AKLRDFVEKIVKAKLGMN PLIM+GAALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTHHAKLRDFVEKIVKAKLGMNFPLIMHGAALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+KVL EL  PV  GTI++VEDLQQEL+C+INIKHR+EFDEEK+PDGMVLS
Sbjct  487  DMVANYTANLEKVLSELPSPVVSGTILSVEDLQQELSCSINIKHRDEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW      +++   T  NG S+S    +AP DA++ DD ++      ++ G+KRKL    
Sbjct  547  GWQQTPLEKDDCNKTLGNGESTSKTLPSAP-DADKYDDSDM------VASGRKRKL----  595

Query  289  PDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
                        D  V + G ++ SKK  V
Sbjct  596  ------------DEAVNISGEANSSKKPEV  613



>gb|KDO49455.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=622

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 142/183 (78%), Gaps = 9/183 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT  +KLRDFVEKIVKAKLG+N PLIM+G+ LLYEVGDDLDE
Sbjct  395  EPNKSCYVCSETPLSLEINTSRSKLRDFVEKIVKAKLGINFPLIMHGSNLLYEVGDDLDE  454

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANL+KVL +L  PV  GT++ VEDLQQELTCNINIKHREEFDEEK+PDGM+LS
Sbjct  455  VEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTCNINIKHREEFDEEKEPDGMLLS  514

Query  469  GWTPVLASENNNKTTHD-----NGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRK  305
            GWT    ++++ ++ +D     NG  SS A QT P DA +D ++E +   +    GKKRK
Sbjct  515  GWTQAPPAKDDKQSMNDKQSIGNGGDSSNALQTEPADAVKDGEMEEISEPS----GKKRK  570

Query  304  LCD  296
            L +
Sbjct  571  LSE  573



>gb|KDO49456.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=652

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 142/183 (78%), Gaps = 9/183 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT  +KLRDFVEKIVKAKLG+N PLIM+G+ LLYEVGDDLDE
Sbjct  425  EPNKSCYVCSETPLSLEINTSRSKLRDFVEKIVKAKLGINFPLIMHGSNLLYEVGDDLDE  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANL+KVL +L  PV  GT++ VEDLQQELTCNINIKHREEFDEEK+PDGM+LS
Sbjct  485  VEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTCNINIKHREEFDEEKEPDGMLLS  544

Query  469  GWTPVLASENNNKTTHD-----NGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRK  305
            GWT    ++++ ++ +D     NG  SS A QT P DA +D ++E +   +    GKKRK
Sbjct  545  GWTQAPPAKDDKQSMNDKQSIGNGGDSSNALQTEPADAVKDGEMEEISEPS----GKKRK  600

Query  304  LCD  296
            L +
Sbjct  601  LSE  603



>ref|XP_006487357.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Citrus sinensis]
Length=651

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 142/183 (78%), Gaps = 9/183 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT  +KLRDFVEKIVKAKLG+N PLIM+G+ LLYEVGDDLDE
Sbjct  426  EPNKSCYVCSETPLSLEINTSRSKLRDFVEKIVKAKLGINFPLIMHGSNLLYEVGDDLDE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V NYAANL+KVL +L  PV  GT++ VEDLQQELTCNINIKHREEFDEEK+PDGM+LS
Sbjct  486  VEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTCNINIKHREEFDEEKEPDGMLLS  545

Query  469  GWTPVLASENNNKTTHD-----NGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRK  305
            GWT    ++++ ++ +D     NG  SS A QT P DA +D ++E +   +    GKKRK
Sbjct  546  GWTQAPPAKDDKQSMNDKQSIGNGGDSSNALQTEPADAVKDGEMEEISEPS----GKKRK  601

Query  304  LCD  296
            L +
Sbjct  602  LSE  604



>ref|XP_008460981.1| PREDICTED: SUMO-activating enzyme subunit 2 [Cucumis melo]
Length=641

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 149/210 (71%), Gaps = 23/210 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH AKLRDFVEKIV AKLGMN PLIM+GAALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTHRAKLRDFVEKIVTAKLGMNFPLIMHGAALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+KVL EL  PV  GTI++VEDLQQEL+C+INIKHR+EF+EEK+PDGMVLS
Sbjct  487  DMVANYTANLEKVLSELPSPVVSGTILSVEDLQQELSCSINIKHRDEFNEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW      +++   T  NG S+S    +AP DA++ DD ++      ++ G+KRKL    
Sbjct  547  GWQQTPLEKDDCSKTLGNGESTSKTLPSAP-DADKYDDSDM------VASGRKRKL----  595

Query  289  PDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
                        D  V + G ++ SKK  V
Sbjct  596  ------------DEAVNISGEANSSKKPEV  613



>gb|KEH19101.1| SUMO1 activating enzyme subunit 2 [Medicago truncatula]
Length=635

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 155/220 (70%), Gaps = 18/220 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSE+P+ LEINT+ +KL+D VEKI+KAKLGM+LPL+MN + LLYE GD +++
Sbjct  423  EPNKSCYVCSESPVLLEINTNRSKLKDVVEKIIKAKLGMSLPLVMNASNLLYEAGD-IED  481

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  Y ANL+KVL EL  PV GGT++ VED QQEL CNINIKHREEFDEEK+PDGMVLS
Sbjct  482  DMVAIYNANLEKVLAELPSPVTGGTMLTVEDFQQELKCNINIKHREEFDEEKEPDGMVLS  541

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            GWT PV A+EN +K+   NGA++S A  T    +  DDD+ I      ISP KKRKL   
Sbjct  542  GWTQPVAAAENEDKSV-SNGANTSDAPITEVEKSENDDDVGI------ISPVKKRKLPDD  594

Query  301  ------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
                   D     K  ++ DD D  V LDGN DG KK+RV
Sbjct  595  SDKSNTADDERHHKKLQVIDDEDDLVMLDGNLDGFKKRRV  634



>ref|XP_002306122.2| hypothetical protein POPTR_0004s166302g, partial [Populus trichocarpa]
 gb|EEE86633.2| hypothetical protein POPTR_0004s166302g, partial [Populus trichocarpa]
Length=589

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSC VCS+TPL+LEINTH +KLRDFVEKIVKAKLGMN PLIM+  ALLYEVGDDL+E
Sbjct  363  EPNKSCCVCSKTPLSLEINTHRSKLRDFVEKIVKAKLGMNSPLIMHATALLYEVGDDLEE  422

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              + NY ANL+KVL EL PPV  GT++ VEDLQQE TCNI+IKHREEFDEEK+PDGMVLS
Sbjct  423  NEIANYTANLEKVLSELPPPVIDGTVLTVEDLQQEFTCNIHIKHREEFDEEKEPDGMVLS  482

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT     + + KT+  NGAS+S +  T       D++++ +  GT +SPG KRKL + +
Sbjct  483  GWTQAPPEKKDGKTSIGNGASTSKSLPTKLGITEIDNEVKEISDGT-VSPGMKRKLSEFS  541

Query  289  PDRKVEELDD  260
                V++  D
Sbjct  542  DGSTVDQSSD  551



>ref|XP_003541605.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
 gb|KHN37632.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=638

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 160/220 (73%), Gaps = 19/220 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT+ +KL+D VEKIVKAKLGMNLPLIM  + LLYE GD +++
Sbjct  427  EPNKSCYVCSETPLSLEINTNRSKLKDLVEKIVKAKLGMNLPLIMCASNLLYEAGD-VED  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  Y ANL+K L EL  PV GGT++ VED+QQE  CNINIKHREEFDEEK+PDGMVLS
Sbjct  486  DMVAIYEANLEKALAELPSPVTGGTMLTVEDMQQEFVCNINIKHREEFDEEKEPDGMVLS  545

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT PV A+EN +K+   NGAS+S A  TA +++ +DD++      T +S  KKRKL D 
Sbjct  546  GWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDDEI------TIVSTLKKRKLPDE  597

Query  295  --------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
                     + ++K  E+ +D D  V LDG+SD  KK+R+
Sbjct  598  SDISNSAAESKNQKQLEVIEDEDDLVMLDGDSDSVKKRRL  637



>ref|XP_009347844.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=571

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 141/187 (75%), Gaps = 15/187 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH  KLRD VEKIV+AKLGM LPLIM+G+ALLYEVGDDLDE
Sbjct  354  EPNKSCYVCSETPLSLEINTHRTKLRDVVEKIVRAKLGMGLPLIMHGSALLYEVGDDLDE  413

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANLDKVL E   PV  GT++ +ED QQEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  414  DMVANYAANLDKVLSEFPTPVTSGTMLTIEDFQQELSCKINIKHREEFDEEKEPDGMVLS  473

Query  469  GWTPVLA-SENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT   A ++++ K+T + G+SS+ +S   P    + DD+E        +P KKRKL D 
Sbjct  474  GWTQAPAVAQDDKKSTANAGSSSNASSSMEP---EKTDDIE-------TTPEKKRKLSDL  523

Query  295  ---TNPD  284
                NPD
Sbjct  524  SESANPD  530



>ref|XP_003540521.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
Length=636

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 159/220 (72%), Gaps = 19/220 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT+ +KL+D VEKIVKAKLGMNLPLIM  + LLYE GD +++
Sbjct  425  EPNKSCYVCSETPLSLEINTNRSKLKDLVEKIVKAKLGMNLPLIMCASNLLYEAGD-VED  483

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M+  Y ANL+K L EL  PV GGT++ VED+QQE  CNINIKHREEFDEEK+PDGMVLS
Sbjct  484  DMIAIYEANLEKALAELPSPVTGGTMLTVEDMQQEFVCNINIKHREEFDEEKEPDGMVLS  543

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDT  293
            GWT PV A+EN +K+   NGAS+S A  TA +++ +DD++      T +S  KKRKL D 
Sbjct  544  GWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDDEI------TIVSALKKRKLPDE  595

Query  292  N---------PDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
            +          ++K  E+ DD D  V LDG+ +  KK+R+
Sbjct  596  SDISNSAAEAKNQKQLEVIDDEDDLVMLDGDLNSVKKRRL  635



>ref|XP_009347843.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=644

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 141/187 (75%), Gaps = 15/187 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH  KLRD VEKIV+AKLGM LPLIM+G+ALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTHRTKLRDVVEKIVRAKLGMGLPLIMHGSALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANLDKVL E   PV  GT++ +ED QQEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  487  DMVANYAANLDKVLSEFPTPVTSGTMLTIEDFQQELSCKINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLA-SENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT   A ++++ K+T + G+SS+ +S   P    + DD+E        +P KKRKL D 
Sbjct  547  GWTQAPAVAQDDKKSTANAGSSSNASSSMEP---EKTDDIE-------TTPEKKRKLSDL  596

Query  295  ---TNPD  284
                NPD
Sbjct  597  SESANPD  603



>gb|KHN19464.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=636

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 158/220 (72%), Gaps = 19/220 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT+ +KL+D  EKIVKAKLGMNLPLIM  + LLYE GD +++
Sbjct  425  EPNKSCYVCSETPLSLEINTNRSKLKDLAEKIVKAKLGMNLPLIMCASNLLYEAGD-VED  483

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M+  Y ANL+K L EL  PV GGT++ VED+QQE  CNINIKHREEFDEEK+PDGMVLS
Sbjct  484  DMIAIYEANLEKALAELPSPVTGGTMLTVEDMQQEFVCNINIKHREEFDEEKEPDGMVLS  543

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDT  293
            GWT PV A+EN +K+   NGAS+S A  TA +++ +DD++      T +S  KKRKL D 
Sbjct  544  GWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDDEI------TIVSTLKKRKLPDE  595

Query  292  N---------PDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
            +          ++K  E+ DD D  V LDG+ +  KK+R+
Sbjct  596  SDISNSAAEAKNQKQLEVIDDEDDLVMLDGDLNSVKKRRL  635



>ref|XP_004510996.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Cicer arietinum]
Length=628

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 156/220 (71%), Gaps = 28/220 (13%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSE+P+ LEINT+ +KL+D VEKI+KAKLGM+LPLIMN + LLYE GD +++
Sbjct  426  EPNKSCYVCSESPILLEINTNRSKLKDVVEKIIKAKLGMSLPLIMNASNLLYEAGD-IED  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  Y ANL+KVL EL  PV GGT++ VED QQEL CNINIKHREEFDEEK+PDGMVLS
Sbjct  485  DMVAIYNANLEKVLAELPSPVTGGTMLTVEDFQQELKCNINIKHREEFDEEKEPDGMVLS  544

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD-  296
            GWT PV A+EN +K+   NGA++S          + +D++ I      +SP KKRKL D 
Sbjct  545  GWTQPVSAAENEDKSV-SNGANTS----------DNNDEIGI------VSPLKKRKLPDD  587

Query  295  ------TNPDRKVEELD--DDGDGFVTLDGNSDGSKKQRV  200
                  T+  R  ++L   DD D  V LDG+ DG KK+RV
Sbjct  588  SDKSNTTDDARHNKQLQVIDDEDDLVMLDGDLDGFKKRRV  627



>gb|KHG16253.1| SUMO-activating enzyme subunit 2 -like protein [Gossypium arboreum]
Length=623

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 137/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN P+IM+GA+++YE+G+DL+E
Sbjct  396  EPNKSCYVCSETPLSLEVNTHHSKLRDFVEKIVKAKLGMNFPVIMSGASIIYEIGEDLEE  455

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL++ L EL  PV  GT++ +EDLQQE +C INIKHREEFDEE++PDGM+LS
Sbjct  456  DMVAIYAANLERALSELPSPVISGTVLTIEDLQQEFSCRINIKHREEFDEEREPDGMLLS  515

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAIS--PGKKRKLCD  296
            GW      +NNNK+   NG S+S+A     +   E  D+EI  T  +     GKKRKL +
Sbjct  516  GWVEAPVDKNNNKSI-GNGESTSSALSMEEIQEGE-KDVEIQGTSESAENVTGKKRKLSE  573

Query  295  TN  290
             +
Sbjct  574  VS  575



>ref|XP_007042097.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
 gb|EOX97928.1| SUMO-activating enzyme 2 isoform 1 [Theobroma cacao]
Length=649

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 136/187 (73%), Gaps = 4/187 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  423  EPNKSCYVCSETPLSLEVNTHRSKLRDFVEKIVKAKLGMNFPLIMQGASILYEVGEDLEE  482

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  GT++ VEDLQQE + NINIKHREEFDEEK+PDGM+LS
Sbjct  483  DMVAIYAANLEKALSELPSPVTSGTVLTVEDLQQEFSRNINIKHREEFDEEKEPDGMLLS  542

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GW      ++ NK   +  ++S+       L+A +D  ++ +   T I+ G KRKL +  
Sbjct  543  GWVEPPVDKDKNKPIGNGESTSNALPAEESLEAKKDVTIQEISEVTEIATGTKRKLSEVS  602

Query  295  --TNPDR  281
              T PD 
Sbjct  603  KGTTPDH  609



>ref|XP_007133804.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
 gb|ESW05798.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
Length=642

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 159/224 (71%), Gaps = 24/224 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT+ +KL+D VEKIVKAKLGMN+PLIM  + LLYE GD +++
Sbjct  428  EPNKSCYVCSETPLSLEINTNRSKLKDLVEKIVKAKLGMNIPLIMCASNLLYEAGD-VED  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M+  Y +NL+KVL EL  PV GGT++ VED+QQE  CNINIKHREEFDEEK+PD MVLS
Sbjct  487  DMIAIYESNLEKVLAELPSPVTGGTMLTVEDMQQEFVCNINIKHREEFDEEKEPDEMVLS  546

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            GW  PV A+EN +K+   NG S+S A+ TA +++ +DD++      T +S  KKRKL   
Sbjct  547  GWIQPVSAAENKDKSV-GNGGSTSDAAVTA-VESEKDDEI------TIVSTLKKRKLPDE  598

Query  301  ----------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  200
                       DT   +++E +DD+ D  V LDG+ D  KK+R+
Sbjct  599  TDISSATTADADTKHQKQLEVIDDE-DDLVMLDGDLDSFKKRRL  641



>ref|XP_008357172.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Malus domestica]
Length=644

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 136/180 (76%), Gaps = 9/180 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH  KLRD VEKIV+A LGM LPLIM+G+ALLYEVGDDLDE
Sbjct  427  EPNKSCYVCSETPLSLEINTHRTKLRDVVEKIVRATLGMGLPLIMHGSALLYEVGDDLDE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYAANLDKVL EL  PV  GT++ +ED  QEL+C INIKHREEFDEEK+PDGMVLS
Sbjct  487  DMVANYAANLDKVLSELPTPVTSGTMLTIEDFLQELSCKINIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT   A   ++K +     + S++S ++ ++  + DD+E        +PGKKRKL + +
Sbjct  547  GWTQAPAVAQDDKKS--TANAGSSSSASSSMEPEKTDDIE-------TTPGKKRKLSEVS  597



>gb|KJB32552.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=632

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 151/225 (67%), Gaps = 15/225 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETP++LE+NT  +KLRDFVEKI+KAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  408  EPNRSCYVCSETPVSLEVNTQRSKLRDFVEKIIKAKLGMNFPLIMQGASILYEVGEDLEE  467

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  G+++ VEDLQQE +C+INIKHREEFDEEK+PDGM+LS
Sbjct  468  DMVAIYAANLEKALSELPSPVTSGSVLTVEDLQQEFSCSINIKHREEFDEEKEPDGMLLS  527

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GW      ++NNK   ++ ++S+       L+  +DD+++          GKKRKL +  
Sbjct  528  GWVEAPVDKDNNKPIGNDESTSNALPSGETLEGEKDDEIQETSEVVEAFTGKKRKLSEVS  587

Query  295  --TNPD-----------RKVEELDDDGDGFVTLDGNSDGSKKQRV  200
              T PD            K  ++DD+ D  +  D     +KK+++
Sbjct  588  EVTAPDPSGPSSINQNKPKKLDIDDEADELIISDDWESLTKKKKL  632



>gb|KJB32553.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=648

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 151/225 (67%), Gaps = 15/225 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETP++LE+NT  +KLRDFVEKI+KAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  424  EPNRSCYVCSETPVSLEVNTQRSKLRDFVEKIIKAKLGMNFPLIMQGASILYEVGEDLEE  483

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  G+++ VEDLQQE +C+INIKHREEFDEEK+PDGM+LS
Sbjct  484  DMVAIYAANLEKALSELPSPVTSGSVLTVEDLQQEFSCSINIKHREEFDEEKEPDGMLLS  543

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GW      ++NNK   ++ ++S+       L+  +DD+++          GKKRKL +  
Sbjct  544  GWVEAPVDKDNNKPIGNDESTSNALPSGETLEGEKDDEIQETSEVVEAFTGKKRKLSEVS  603

Query  295  --TNPD-----------RKVEELDDDGDGFVTLDGNSDGSKKQRV  200
              T PD            K  ++DD+ D  +  D     +KK+++
Sbjct  604  EVTAPDPSGPSSINQNKPKKLDIDDEADELIISDDWESLTKKKKL  648



>gb|KHG12220.1| SUMO-activating enzyme subunit 2 -like protein [Gossypium arboreum]
Length=620

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 135/186 (73%), Gaps = 4/186 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETPL+LE+NT   KLRDFVEKI+KAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  396  EPNRSCYVCSETPLSLEVNTQRCKLRDFVEKIIKAKLGMNFPLIMQGASILYEVGEDLEE  455

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  G+++ VEDLQQE +C+INIKHREEFDEEK+PDGM+LS
Sbjct  456  DMVVIYAANLEKALSELPSPVASGSVLTVEDLQQEFSCSINIKHREEFDEEKEPDGMLLS  515

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GW      ++NNK   ++ ++S+       L+  +DD+++          GKKRKL +  
Sbjct  516  GWVEAPVDKDNNKPIGNDESTSNALPSMETLEGEKDDEIQETSEVVEAFSGKKRKLSEVS  575

Query  295  --TNPD  284
              T PD
Sbjct  576  EVTAPD  581



>gb|KJB47535.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=621

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN P+IM+GA+++YEVG+DL+E
Sbjct  394  EPNKSCYVCSETPLSLEVNTHHSKLRDFVEKIVKAKLGMNFPVIMSGASIIYEVGEDLEE  453

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  GT++ VEDLQQE +C INIKHREEFDEEK+PDGM+LS
Sbjct  454  DMVAIYAANLEKALSELPSPVISGTVLTVEDLQQEFSCRINIKHREEFDEEKEPDGMLLS  513

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAIS--PGKKRKLCD  296
            G       +N+NK    NG S+S+A  T  +   E  D+EI  T  +     GKKRKL +
Sbjct  514  GRVEAPVDKNSNKPI-GNGESTSSALSTEEIQEGE-RDVEIQETSESAENVTGKKRKLSE  571

Query  295  TN  290
             +
Sbjct  572  VS  573



>gb|KJB47538.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=593

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN P+IM+GA+++YEVG+DL+E
Sbjct  366  EPNKSCYVCSETPLSLEVNTHHSKLRDFVEKIVKAKLGMNFPVIMSGASIIYEVGEDLEE  425

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  GT++ VEDLQQE +C INIKHREEFDEEK+PDGM+LS
Sbjct  426  DMVAIYAANLEKALSELPSPVISGTVLTVEDLQQEFSCRINIKHREEFDEEKEPDGMLLS  485

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAIS--PGKKRKLCD  296
            G       +N+NK    NG S+S+A  T  +   E  D+EI  T  +     GKKRKL +
Sbjct  486  GRVEAPVDKNSNKPI-GNGESTSSALSTEEIQEGE-RDVEIQETSESAENVTGKKRKLSE  543

Query  295  TN  290
             +
Sbjct  544  VS  545



>ref|XP_010942467.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Elaeis guineensis]
Length=644

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 154/231 (67%), Gaps = 32/231 (14%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIVK KLGMNLPLIM+G+ L++E GDDL+E
Sbjct  426  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVKNKLGMNLPLIMHGSTLIFEAGDDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA NLDK L EL PPV  GT++ VEDL+QEL+CNINIKHREEFDEEK+PDGMVLS
Sbjct  486  DVAANYALNLDKALAELPPPVTSGTVLTVEDLRQELSCNINIKHREEFDEEKEPDGMVLS  545

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC---  299
            GW  V  +E + +    NG S+STA       A + D++E  P  +    G KRKL    
Sbjct  546  GW--VTPTEKDTRVV-SNGESTSTAQL-----AEKSDEVETAPDRS----GTKRKLSEMS  593

Query  298  -------DTNPDRKV--------EELDDDG--DGFVTLDGNSDGSKKQRVQ  197
                   DT P   +        +E++D+G  D  V LD +   SK++++Q
Sbjct  594  EMMDNIHDTKPCSSLDIGDQLNPQEVEDNGDDDDIVVLDESPGPSKRKKLQ  644



>gb|KJB47537.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=651

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN P+IM+GA+++YEVG+DL+E
Sbjct  424  EPNKSCYVCSETPLSLEVNTHHSKLRDFVEKIVKAKLGMNFPVIMSGASIIYEVGEDLEE  483

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  YAANL+K L EL  PV  GT++ VEDLQQE +C INIKHREEFDEEK+PDGM+LS
Sbjct  484  DMVAIYAANLEKALSELPSPVISGTVLTVEDLQQEFSCRINIKHREEFDEEKEPDGMLLS  543

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAIS--PGKKRKLCD  296
            G       +N+NK    NG S+S+A  T  +   E  D+EI  T  +     GKKRKL +
Sbjct  544  GRVEAPVDKNSNKPI-GNGESTSSALSTEEIQEGE-RDVEIQETSESAENVTGKKRKLSE  601

Query  295  TN  290
             +
Sbjct  602  VS  603



>ref|XP_012067212.1| PREDICTED: SUMO-activating enzyme subunit 2 [Jatropha curcas]
 gb|KDP41752.1| hypothetical protein JCGZ_26770 [Jatropha curcas]
Length=628

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 144/228 (63%), Gaps = 43/228 (19%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSC VCSE+PL LEINT  AKLRDFV+KIVKAKLGMN PLIM+G+ LLYEVGDDL+E
Sbjct  427  EPNKSCCVCSESPLLLEINTLQAKLRDFVDKIVKAKLGMNSPLIMHGSTLLYEVGDDLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             M  NY ANL+KVL EL   + GGT++ VEDLQQE TCNI+IKHREEFDEEK+PDGMVL 
Sbjct  487  DMEANYTANLEKVLFELPSSITGGTMLTVEDLQQEFTCNIHIKHREEFDEEKEPDGMVLF  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANED-----DDLEILPTGTAISPGKKRK  305
            GWT                         APL+  ED     +D+EI   GT IS GKKRK
Sbjct  547  GWT------------------------QAPLEKKEDSKPAGNDVEI-SEGTEIS-GKKRK  580

Query  304  LCD---------TNPDRKVEEL---DDDGDGFVTLDGNSDGSKKQRVQ  197
              D         +N   KV++L   DD+ D  + LD    G  K  +Q
Sbjct  581  QPDMDVSTVSDESNNHNKVQKLNVVDDEDDDLIVLDHRDIGCSKNSLQ  628



>ref|XP_010429058.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=625

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 147/215 (68%), Gaps = 20/215 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V++IV AKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  427  EPNPACYVCSKTPLVLEINTRKSKLRDLVDRIVTAKLGMNLPLIMHGASLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFD+EK+P+GMVLS
Sbjct  487  IMVANYNANLEKPLSELPSPIVNGSILTVEDLQQELSCKINVKHREEFDDEKEPEGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT V A+         NG S+ST++   P D  E        +  + +  KKR+L +  
Sbjct  547  GWTQVPAT---------NGESASTSNNEKPADVTES-------SSGSETASKKRRLSEIE  590

Query  289  PD---RKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  197
            P    ++ E ++ D D  + ++     SKK+ RV+
Sbjct  591  PSNHKKETENVESDDDDIMEVENPMIVSKKKIRVE  625



>ref|XP_008777003.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Phoenix 
dactylifera]
Length=536

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 146/233 (63%), Gaps = 29/233 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKI K KLGMN P+IM+G+ L++E GDDL+E
Sbjct  311  EANKSCYVCSETPLILEINTRTSKLRDFVEKIAKNKLGMNSPMIMHGSTLIFEAGDDLEE  370

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA N+DK L EL  PV  GT++ VEDL+QEL+CNINIKHREEFDEEK+PDG+VL+
Sbjct  371  DVAANYALNIDKALAELPAPVTSGTVLTVEDLRQELSCNINIKHREEFDEEKEPDGLVLA  430

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GW   +A    +     NG S+STA       A   D++ I P      PG KRKL +  
Sbjct  431  GW---IAPTQKDTRLVSNGESTSTAHPAVAEMAENSDEVGIAPA----KPGTKRKLSEMS  483

Query  295  --------------------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                                 NP    ++ DDDGD  V LD N +  KK+R+Q
Sbjct  484  EIIDNVHDITPRSSRDVNDQVNPQEVEDDDDDDGDDIVILDENPETRKKKRLQ  536



>ref|XP_010690827.1| PREDICTED: SUMO-activating enzyme subunit 2 [Beta vulgaris subsp. 
vulgaris]
Length=643

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 143/225 (64%), Gaps = 22/225 (10%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNK+C+VCS+TPLTLE+N    KLRD +EK+V+AKLGMNLP++M G +L+YEVGDDLDE
Sbjct  425  EPNKACFVCSKTPLTLEVNALRTKLRDLIEKVVRAKLGMNLPMVMTGHSLIYEVGDDLDE  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NY ANL+KVL EL  PV GGT + VEDLQQEL+C INIK REEFDEEK+PDGMVL 
Sbjct  485  DEKRNYEANLEKVLSELPSPVTGGTTIVVEDLQQELSCEINIKQREEFDEEKEPDGMVLI  544

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC---  299
            GW+    S   N T   NG S+S  ++   LD  E  + E      A +  KKRK     
Sbjct  545  GWSQAPTSTEKNGTVQ-NGESTSGTAEVMHLDIAEVGEAE------ANTASKKRKSSDPS  597

Query  298  -----------DTNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRV  200
                       D     K   L+DDGD  + L+  NS+ +KK+R+
Sbjct  598  NSSGFHPTSGNDIRSKNKEVILEDDGDDLIVLENLNSEPAKKKRL  642



>ref|XP_008777005.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
Length=655

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 146/233 (63%), Gaps = 29/233 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKI K KLGMN P+IM+G+ L++E GDDL+E
Sbjct  430  EANKSCYVCSETPLILEINTRTSKLRDFVEKIAKNKLGMNSPMIMHGSTLIFEAGDDLEE  489

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA N+DK L EL  PV  GT++ VEDL+QEL+CNINIKHREEFDEEK+PDG+VL+
Sbjct  490  DVAANYALNIDKALAELPAPVTSGTVLTVEDLRQELSCNINIKHREEFDEEKEPDGLVLA  549

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD--  296
            GW   +A    +     NG S+STA       A   D++ I P      PG KRKL +  
Sbjct  550  GW---IAPTQKDTRLVSNGESTSTAHPAVAEMAENSDEVGIAPA----KPGTKRKLSEMS  602

Query  295  --------------------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                                 NP    ++ DDDGD  V LD N +  KK+R+Q
Sbjct  603  EIIDNVHDITPRSSRDVNDQVNPQEVEDDDDDDGDDIVILDENPETRKKKRLQ  655



>ref|XP_008777001.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008777002.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
Length=538

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 147/235 (63%), Gaps = 31/235 (13%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKI K KLGMN P+IM+G+ L++E GDDL+E
Sbjct  311  EANKSCYVCSETPLILEINTRTSKLRDFVEKIAKNKLGMNSPMIMHGSTLIFEAGDDLEE  370

Query  649  KMVENYAANLDKV--LCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
             +  NYA N+DKV  L EL  PV  GT++ VEDL+QEL+CNINIKHREEFDEEK+PDG+V
Sbjct  371  DVAANYALNIDKVMALAELPAPVTSGTVLTVEDLRQELSCNINIKHREEFDEEKEPDGLV  430

Query  475  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD  296
            L+GW   +A    +     NG S+STA       A   D++ I P      PG KRKL +
Sbjct  431  LAGW---IAPTQKDTRLVSNGESTSTAHPAVAEMAENSDEVGIAPA----KPGTKRKLSE  483

Query  295  ----------------------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                                   NP    ++ DDDGD  V LD N +  KK+R+Q
Sbjct  484  MSEIIDNVHDITPRSSRDVNDQVNPQEVEDDDDDDGDDIVILDENPETRKKKRLQ  538



>ref|XP_002512954.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
 gb|EEF49457.1| ubiquitin-activating enzyme E1b, putative [Ricinus communis]
Length=644

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 136/190 (72%), Gaps = 4/190 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSC VCS++PL+LEIN H +KLRDFVEKIVKAKLGMN PLIM+G  LLYEVGDDL+E
Sbjct  427  EPNKSCCVCSKSPLSLEINIHRSKLRDFVEKIVKAKLGMNSPLIMHGPTLLYEVGDDLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL   V GG+++ VEDLQQE TCNI IKHREEFDEEK+PDGMVLS
Sbjct  487  DMVANYNANLEKALSELPSSVTGGSMLTVEDLQQEFTCNIYIKHREEFDEEKEPDGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW      +  +  +  NG S+   S T P +A +D ++E + +   I   KKRK  + +
Sbjct  547  GWIQAPPEKKVDNNSIGNGGST---SNTLPTEAQQDIEIEQI-SEEIIISEKKRKRPEVS  602

Query  289  PDRKVEELDD  260
             D  V+E ++
Sbjct  603  TDTAVDETNN  612



>ref|XP_008797039.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008775123.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Phoenix 
dactylifera]
Length=544

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 149/226 (66%), Gaps = 21/226 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIV  KLGMNLPLIM+G+ L++E GDDL+E
Sbjct  325  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVNNKLGMNLPLIMHGSTLIFEAGDDLEE  384

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA NLDK L EL  PV  GT++ VEDLQQEL+CNINIKHREEFDEEK+PDGM+LS
Sbjct  385  DVAANYALNLDKALAELPAPVTSGTVLTVEDLQQELSCNINIKHREEFDEEKEPDGMLLS  444

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW   +A    +     NG S+S A+Q A  + +++D +    +GT     +  ++ D  
Sbjct  445  GW---VAPTEKDARLVSNGESTS-AAQLA--EKSDEDGIAPARSGTKRKQSEMSEMIDNI  498

Query  289  PDRK---------------VEELDDDGDGFVTLDGNSDGSKKQRVQ  197
             D K               VE+ DDD D  V LD N   SK++++Q
Sbjct  499  DDMKPCSSLDIGDQLNPQEVEDNDDDDDDIVMLDENPGPSKRKKLQ  544



>ref|XP_008797038.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008775122.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Phoenix 
dactylifera]
Length=572

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 149/226 (66%), Gaps = 21/226 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIV  KLGMNLPLIM+G+ L++E GDDL+E
Sbjct  353  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVNNKLGMNLPLIMHGSTLIFEAGDDLEE  412

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA NLDK L EL  PV  GT++ VEDLQQEL+CNINIKHREEFDEEK+PDGM+LS
Sbjct  413  DVAANYALNLDKALAELPAPVTSGTVLTVEDLQQELSCNINIKHREEFDEEKEPDGMLLS  472

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW   +A    +     NG S+S A+Q A  + +++D +    +GT     +  ++ D  
Sbjct  473  GW---VAPTEKDARLVSNGESTS-AAQLA--EKSDEDGIAPARSGTKRKQSEMSEMIDNI  526

Query  289  PDRK---------------VEELDDDGDGFVTLDGNSDGSKKQRVQ  197
             D K               VE+ DDD D  V LD N   SK++++Q
Sbjct  527  DDMKPCSSLDIGDQLNPQEVEDNDDDDDDIVMLDENPGPSKRKKLQ  572



>ref|XP_008797037.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008775121.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Phoenix 
dactylifera]
Length=645

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 151/226 (67%), Gaps = 21/226 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIV  KLGMNLPLIM+G+ L++E GDDL+E
Sbjct  426  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVNNKLGMNLPLIMHGSTLIFEAGDDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA NLDK L EL  PV  GT++ VEDLQQEL+CNINIKHREEFDEEK+PDGM+LS
Sbjct  486  DVAANYALNLDKALAELPAPVTSGTVLTVEDLQQELSCNINIKHREEFDEEKEPDGMLLS  545

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW  V  +E + +    NG S+S A+Q A  + +++D +    +GT     +  ++ D  
Sbjct  546  GW--VAPTEKDARLV-SNGESTS-AAQLA--EKSDEDGIAPARSGTKRKQSEMSEMIDNI  599

Query  289  PDRK---------------VEELDDDGDGFVTLDGNSDGSKKQRVQ  197
             D K               VE+ DDD D  V LD N   SK++++Q
Sbjct  600  DDMKPCSSLDIGDQLNPQEVEDNDDDDDDIVMLDENPGPSKRKKLQ  645



>ref|XP_010938778.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X3 [Elaeis 
guineensis]
Length=618

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 124/180 (69%), Gaps = 7/180 (4%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIVK KLGM+ PLIM+G+ L++E GD L+E
Sbjct  395  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVKNKLGMHSPLIMHGSTLIFEAGDGLEE  454

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +V NYA  LDK L EL  PV  GT++ VEDL QE +CNINIKHREEFDEEK+PDGMVL+
Sbjct  455  DVVANYALILDKALAELPAPVTSGTVLTVEDLHQEFSCNINIKHREEFDEEKEPDGMVLA  514

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW   +A    +     NG S+S A         + DD+EI        PG KRKL + +
Sbjct  515  GW---IAPTQKDARIVSNGESTSAAHPAVTEMVEKSDDVEIARE----KPGTKRKLSEMS  567



>ref|XP_010938777.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Elaeis 
guineensis]
Length=631

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 124/180 (69%), Gaps = 7/180 (4%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIVK KLGM+ PLIM+G+ L++E GD L+E
Sbjct  408  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVKNKLGMHSPLIMHGSTLIFEAGDGLEE  467

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +V NYA  LDK L EL  PV  GT++ VEDL QE +CNINIKHREEFDEEK+PDGMVL+
Sbjct  468  DVVANYALILDKALAELPAPVTSGTVLTVEDLHQEFSCNINIKHREEFDEEKEPDGMVLA  527

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW   +A    +     NG S+S A         + DD+EI        PG KRKL + +
Sbjct  528  GW---IAPTQKDARIVSNGESTSAAHPAVTEMVEKSDDVEIARE----KPGTKRKLSEMS  580



>ref|XP_010938776.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Elaeis 
guineensis]
Length=648

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 124/180 (69%), Gaps = 7/180 (4%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LEINT ++KLRDFVEKIVK KLGM+ PLIM+G+ L++E GD L+E
Sbjct  425  EANKSCYVCSETPLLLEINTRTSKLRDFVEKIVKNKLGMHSPLIMHGSTLIFEAGDGLEE  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +V NYA  LDK L EL  PV  GT++ VEDL QE +CNINIKHREEFDEEK+PDGMVL+
Sbjct  485  DVVANYALILDKALAELPAPVTSGTVLTVEDLHQEFSCNINIKHREEFDEEKEPDGMVLA  544

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GW   +A    +     NG S+S A         + DD+EI        PG KRKL + +
Sbjct  545  GW---IAPTQKDARIVSNGESTSAAHPAVTEMVEKSDDVEIARE----KPGTKRKLSEMS  597



>ref|XP_006838625.1| PREDICTED: SUMO-activating enzyme subunit 2 [Amborella trichopoda]
 gb|ERN01194.1| hypothetical protein AMTR_s00002p00233990 [Amborella trichopoda]
Length=652

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSE PLTLE+NTH  KLR+ VEKIVK KLG+NLP+IM+G+ L++E GDDL+E
Sbjct  426  EPNKSCYVCSEMPLTLEVNTHKTKLREIVEKIVKNKLGVNLPIIMHGSTLIFETGDDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NYA NL+K LC+L  PV  GT++ VED QQE TC+INI HREEFD+EK+P+GMVL 
Sbjct  486  DMVANYALNLEKALCDLPSPVTSGTVLTVEDFQQEFTCSINITHREEFDDEKEPEGMVLL  545

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANE-DDDLEILPTGTA-ISPGKKRKLCD  296
            G TP L  + +   T +   S+S A Q  P   ++ DD++EI+    +    G KRKL +
Sbjct  546  GLTPDLYEKPSKVATTEE--STSMAPQEKPATVSDSDDEIEIVVLEESNRFAGSKRKLVE  603

Query  295  TN  290
            T+
Sbjct  604  TS  605



>gb|EPS74543.1| hypothetical protein M569_00206 [Genlisea aurea]
Length=600

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 132/182 (73%), Gaps = 10/182 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSE PLTLEIN + +KL+D V+K+VKAKLGMNLP+IM+G++LLYE GDDL E
Sbjct  408  EPNKSCYVCSEMPLTLEINPYRSKLKDIVDKVVKAKLGMNLPMIMHGSSLLYEAGDDLAE  467

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              V +Y  NL+K+L EL  PV GGTI+ VEDLQQEL C++NIKHREEFDEEK+PDG++L 
Sbjct  468  DEVAHYETNLEKILSELPCPVIGGTILTVEDLQQELKCSVNIKHREEFDEEKEPDGLILL  527

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT  +A+  + + +H+N     T++         DDD+ I+ +       KKRKL D +
Sbjct  528  GWTQPVAAPVDEQPSHENNGVKMTSA---------DDDV-IVASPQPGGKKKKRKLSDES  577

Query  289  PD  284
             D
Sbjct  578  GD  579



>ref|XP_009399955.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 146/229 (64%), Gaps = 27/229 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LE+NT ++ LRDFV+KIVK KLGM+ PLIM GA L++E GDDL+E
Sbjct  426  EANKSCYVCSETPLLLEVNTQTSTLRDFVDKIVKNKLGMSFPLIMQGAILIFEGGDDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA NLDKVL  L  PV  G+++ VEDLQQEL+C+INIKHREEFDEEK+PD MVL 
Sbjct  486  DIAANYALNLDKVLTALPAPVTSGSMLTVEDLQQELSCHINIKHREEFDEEKEPDRMVLL  545

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT    +         NG +++ A   +P   N+ +++E+    TA     KRKL +  
Sbjct  546  GWT----TPEKESQGVSNGENTAAAIPASPEAINKSEEVEV----TAEISRTKRKLSEMT  597

Query  289  ---------PD---------RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                     PD         ++VE+ D D D  + LD N + SKK+R+Q
Sbjct  598  EVQEIFQILPDTDANNSMDPQEVEDNDYDND-LIVLDENPEASKKRRLQ  645



>ref|XP_009140282.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=627

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 151/214 (71%), Gaps = 20/214 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCS+TPL LEINT  +KLRD V+KIVKAKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  429  EPNPSCYVCSKTPLVLEINTQKSKLRDLVDKIVKAKLGMNLPLIMHGASLLYEVGDDLDD  488

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  489  IMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  548

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT   A+         NG S+ST++  + +D  E        +G  I+  KKRKL +T 
Sbjct  549  GWTQSPAT---------NGESASTSNNESAVDVTESS------SGPEIA-SKKRKLSETQ  592

Query  289  PD---RKVEELD-DDGDGFVTLDGNSDGSKKQRV  200
            P+   R+ E ++ +D D  V ++     SKK+RV
Sbjct  593  PENHKRETENVESEDDDDLVEIENPMTVSKKKRV  626



>emb|CDY15890.1| BnaA04g12210D [Brassica napus]
Length=627

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 151/214 (71%), Gaps = 20/214 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCS+TPL LEINT  +KLRD V+KIVKAKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  429  EPNPSCYVCSKTPLVLEINTQKSKLRDLVDKIVKAKLGMNLPLIMHGASLLYEVGDDLDD  488

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  489  IMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  548

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT   A+         NG S+ST++  + +D  E        +G  I+  KKRKL +T 
Sbjct  549  GWTQSPAT---------NGESASTSNNESAVDVTESS------SGPEIA-SKKRKLSETQ  592

Query  289  PD---RKVEELD-DDGDGFVTLDGNSDGSKKQRV  200
            P+   R+ E ++ +D D  V ++     SKK+RV
Sbjct  593  PENHKRETENVESEDDDDLVEIENPMTVSKKKRV  626



>ref|XP_006293831.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
 gb|EOA26729.1| hypothetical protein CARUB_v10022825mg [Capsella rubella]
Length=624

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 19/214 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCSETPL LEINT  +KLRD V++IVKAKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  427  EPNPACYVCSETPLGLEINTRKSKLRDLVDRIVKAKLGMNLPLIMHGASLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+KVL EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  487  IMVANYNANLEKVLSELPSPIVNGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWTP  A+         NG S+ST++   P+D  E        +  + +  KKR+L +  
Sbjct  547  GWTPSPAT---------NGESASTSNNEIPVDVTES-------SSGSETASKKRRLSEIE  590

Query  289  P---DRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
            P    ++ E ++ + D  + ++     SKK RV+
Sbjct  591  PCNHKKETENVESEDDDIMEIENPMIVSKKIRVE  624



>ref|XP_009412808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412809.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412810.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 127/178 (71%), Gaps = 8/178 (4%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LE+NT ++ LRDFV++IVK KLGM+ PLIM GA L++EVGDDL+E
Sbjct  425  EANKSCYVCSETPLLLEVNTRTSTLRDFVDRIVKNKLGMSFPLIMQGATLIFEVGDDLEE  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             +  NYA NLDKVL EL  PV+ GT++ VEDLQQEL+C+INIKHREEFDE+K+PD MVL 
Sbjct  485  DVAANYALNLDKVLVELPTPVSSGTMLTVEDLQQELSCHINIKHREEFDEDKEPDKMVLL  544

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD  296
            GWT   A E  ++    NG S+S A   A     + ++ E+     A   G KRKL +
Sbjct  545  GWT---AREKESQVV-SNGNSTSAAVPAAAEATMKSEEAEV----NAEISGTKRKLSE  594



>tpg|DAA41263.1| TPA: hypothetical protein ZEAMMB73_736183 [Zea mays]
Length=236

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 146/232 (63%), Gaps = 37/232 (16%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EP+KSCYVCSETPL LE+NT + KLR+ +EK++K KLGMNLPLIM GA L++E G+DL+E
Sbjct  21   EPSKSCYVCSETPLVLEVNTKTTKLREVIEKVIKGKLGMNLPLIMVGATLVFEDGEDLEE  80

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              + NYA NL+KVL EL  PV  GT+V VEDL QEL C+INIKHR+EFDEEK+PD MVL 
Sbjct  81   DEIANYALNLEKVLAELPAPVLNGTMVTVEDLHQELKCSINIKHRDEFDEEKEPDRMVLV  140

Query  469  GWT-PVLASENNNKTTHDNGASSS--TASQTAPLDANEDDDLEILPTGTAISPGKKRKL-  302
            GW+ PV      +K T  NG + S  ++S T  +D   +D         + + G KRKL 
Sbjct  141  GWSGPV------DKQTTSNGETKSVPSSSNTEDVDGTAED--------ISATSGMKRKLN  186

Query  301  -----------------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                              D++  + VE  DD+ DG +  D +   SKK+R+Q
Sbjct  187  EILETKENFDALENLSGVDSSSAQVVE--DDNDDGLLMFDEDPRQSKKKRLQ  236



>emb|CDX99589.1| BnaC04g33460D [Brassica napus]
Length=629

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 151/214 (71%), Gaps = 20/214 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCS+TPL LEINT  +KLRD V+KIVKAKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  431  EPNPSCYVCSKTPLVLEINTQKSKLRDLVDKIVKAKLGMNLPLIMHGASLLYEVGDDLDD  490

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY +NL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  491  IMVANYNSNLEKSLSELPSPVINGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  550

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT   A++         G S+ST++  + ++  E        +G  I+  KKRKL +T 
Sbjct  551  GWTQSPATK---------GESASTSNNESAVEVTESS------SGPEIA-SKKRKLSETQ  594

Query  289  PD---RKVEELD-DDGDGFVTLDGNSDGSKKQRV  200
            P+   R+ E ++ +D D  + ++     SKK+RV
Sbjct  595  PENHKRETENVESEDDDDLMEIENPMTVSKKKRV  628



>ref|XP_010416892.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=624

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 146/214 (68%), Gaps = 19/214 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V++IV AKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  427  EPNPACYVCSKTPLVLEINTRKSKLRDLVDRIVTAKLGMNLPLIMHGASLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  487  IMVANYNANLEKPLSELPSPIVNGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT V A+         NG S+ST++   P D  E        +  + +  KKR+L +  
Sbjct  547  GWTQVPAT---------NGESASTSNNEKPADVTES-------SSGSETASKKRRLSEIE  590

Query  289  PD---RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
            P    ++ E ++ D D  + ++     SKK RV+
Sbjct  591  PSNHKKETENVESDDDDIMEVENPMIVSKKIRVE  624



>ref|XP_010531451.1| PREDICTED: SUMO-activating enzyme subunit 2 [Tarenaya hassleriana]
Length=647

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 150/227 (66%), Gaps = 26/227 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCS+TPLTLEINT  +KLRD VEKIV+AK+GMNLPLIM+G +LLYEVGDDLDE
Sbjct  431  EPNPSCYVCSKTPLTLEINTQKSKLRDLVEKIVRAKIGMNLPLIMHGTSLLYEVGDDLDE  490

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+KVL EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVL 
Sbjct  491  AMVANYNANLEKVLSELPSPIVSGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLY  550

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC---  299
            GW+   A+         NG SSST++   P   N  +  E   +   I+ GKKRKL    
Sbjct  551  GWSESPAA---------NGESSSTSTARPPDSENAIEAPE-SSSRPEIATGKKRKLTEET  600

Query  298  --DTNPDRKVEE----------LD-DDGDGFVTLDGNSDGSKKQRVQ  197
              +TN  +K  E          +D DD D  V  D +   SKK+R Q
Sbjct  601  EMETNNQKKPPENNTSFSMEKGIDIDDEDIVVVEDPDIVVSKKKRAQ  647



>ref|XP_010472141.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Camelina sativa]
Length=628

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 145/211 (69%), Gaps = 19/211 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V++IV AKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  430  EPNPACYVCSKTPLVLEINTRKSKLRDLVDRIVTAKLGMNLPLIMHGASLLYEVGDDLDD  489

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  490  IMVANYNANLEKPLSELPSPIVNGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  549

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT V A+         NG S+ST++   P+D  E        +  + +  KKR+L +  
Sbjct  550  GWTQVPAT---------NGESASTSNNEKPVDVTES-------SSGSETASKKRRLSEIE  593

Query  289  PD---RKVEELDDDGDGFVTLDGNSDGSKKQ  206
            P    ++ E ++ D D  + ++     SKK+
Sbjct  594  PSNHKKETENVESDDDDIMEVENPMIASKKK  624



>ref|XP_010107832.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
 gb|EXC17232.1| SUMO-activating enzyme subunit 2 [Morus notabilis]
Length=601

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 11/173 (6%)
 Frame = -3

Query  799  ETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEKMVENYAANL  620
            +TPL+LEINT+ AKLRD +EK+VK+KLGM+ P IM+G  +LYE GDDLDE ++ +YAA  
Sbjct  396  KTPLSLEINTNRAKLRDIIEKVVKSKLGMSSPSIMHGTEILYETGDDLDEDLLASYAAKA  455

Query  619  DKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLSGWTPVLAS-E  443
            DKVL EL  PV GGT++ V DL QEL CNINIKHREEFDEEK+PDG+VLSGWT   +S E
Sbjct  456  DKVLSELNCPVVGGTMLTVNDLYQELRCNINIKHREEFDEEKEPDGIVLSGWTQAPSSVE  515

Query  442  NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTNPD  284
            NN   + DN  S+S  S    ++A ++D++EI+       PGKKRKL + + D
Sbjct  516  NNGTKSVDNAGSTSEGST---MEAEKNDEIEIV-------PGKKRKLSEVSED  558



>ref|XP_010236228.1| PREDICTED: SUMO-activating enzyme subunit 2 [Brachypodium distachyon]
Length=623

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 142/225 (63%), Gaps = 37/225 (16%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETPL L++NT + KLR+ ++KI+K+KLGMNLPL+M G+ L++E GD L+E
Sbjct  422  EPNESCYVCSETPLLLDVNTKTTKLREVIDKIIKSKLGMNLPLVMIGSTLVFEDGDGLEE  481

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NYA NL+KVL EL  PV  GT + VED QQEL+C+INIKHREEFDEEK+PDGMVLS
Sbjct  482  DEAANYALNLEKVLAELPAPVINGTKLTVEDFQQELSCSINIKHREEFDEEKEPDGMVLS  541

Query  469  GWT-PVLASENNNKTTHDNG----ASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRK  305
            GW+ PV       K    NG    ASSS+A  T   DA+ +             PG KRK
Sbjct  542  GWSAPV------EKQVTSNGGKLAASSSSAHDTVG-DASAN-------------PGTKRK  581

Query  304  L---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
            L         CD +   +V E DDD    + LD +    KK+R Q
Sbjct  582  LDEVLESKENCDASSSAQVIEDDDDT---IMLDEDPTLLKKKRSQ  623



>gb|KFK32895.1| hypothetical protein AALP_AA6G302000 [Arabis alpina]
Length=624

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 148/212 (70%), Gaps = 19/212 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V++IVKAKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  427  EPNPACYVCSKTPLVLEINTQKSKLRDLVDRIVKAKLGMNLPLIMHGASLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+ MVLS
Sbjct  487  IMVANYNANLEKYLSELPSPVVNGSILTVEDLQQELSCKINVKHREEFDEEKEPEEMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT   A+         NG ++ST++    +D  E   +  +PT       KKR+L +  
Sbjct  547  GWTQSPAT---------NGDNASTSNNENAIDVTESSSVAEIPT-------KKRRLSEFQ  590

Query  289  PD---RKVEELDDDGDGFVTLDGNSDGSKKQR  203
            P+   +++E+++ + D  + ++     SKK++
Sbjct  591  PENHKKEIEKVESEDDDLMEIENPMVMSKKKK  622



>gb|EMS58354.1| SUMO-activating enzyme subunit 2 [Triticum urartu]
Length=639

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 145/221 (66%), Gaps = 26/221 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCSETPL L++NT   KL++ ++KI+K+KLGMNLPL+M G+ L++E GD L+E
Sbjct  435  EPNTSCYVCSETPLLLDVNTKVTKLKEVIDKIIKSKLGMNLPLVMIGSTLVFEDGDGLEE  494

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NYA NL+KVL EL  PV  GT + VED QQEL+C+INIKHREEFDEEK+PDGMVLS
Sbjct  495  DEAANYALNLEKVLAELPAPVINGTKLTVEDFQQELSCSINIKHREEFDEEKEPDGMVLS  554

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            GW+ PV    N+N    +N +++S++S  A  D  ED      P+     PG KRKL   
Sbjct  555  GWSAPVEKQINSNG---ENKSAASSSSAHATDDTVED------PS----KPGMKRKLDEL  601

Query  301  ------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                  CD +   +V E DDD      LDGN    KK+R+Q
Sbjct  602  LETKENCDASSSAQVVEDDDDC---TMLDGNPALIKKKRLQ  639



>gb|EMT21367.1| SUMO-activating enzyme subunit 2 [Aegilops tauschii]
Length=629

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 145/221 (66%), Gaps = 26/221 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCSETPL L++NT   KL++ ++KI+K+KLGMNLPL+M G+ L++E GD L+E
Sbjct  425  EPNPSCYVCSETPLLLDVNTKVTKLKEVIDKIIKSKLGMNLPLVMIGSTLVFEDGDGLEE  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NYA NL+KVL EL  PV  GT + VED QQEL+C+INIKHREEFDEEK+PDGMVLS
Sbjct  485  DEAANYALNLEKVLAELPAPVINGTKLTVEDFQQELSCSINIKHREEFDEEKEPDGMVLS  544

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            GW+ PV    N+N    +N +++S++S  A  D  ED      P+     PG KRKL   
Sbjct  545  GWSAPVEKQINSNG---ENKSAASSSSARATDDTVED------PS----KPGMKRKLDEL  591

Query  301  ------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                  CD +   +V E DDD      LDGN    KK+R+Q
Sbjct  592  LETKENCDASSSAQVVEDDDDC---TMLDGNPALIKKKRLQ  629



>ref|XP_006404595.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
 gb|ESQ46048.1| hypothetical protein EUTSA_v10000089mg [Eutrema salsugineum]
Length=626

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 147/213 (69%), Gaps = 20/213 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN SCYVCS+TPL LEINT  +KLRD V+KIVKAKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  427  EPNPSCYVCSKTPLVLEINTQKSKLRDLVDKIVKAKLGMNLPLIMHGASLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C INIKHREEFDEEK+P+GMVLS
Sbjct  487  IMVANYNANLEKHLSELPSPVVNGSILTVEDLQQELSCKINIKHREEFDEEKEPEGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCDTN  290
            GWT   A+         NG S+ST++    +DA +        +G  I   KKR+L +T 
Sbjct  547  GWTQSPAT---------NGESASTSNNENAIDATDSS------SGPEIVT-KKRRLSETK  590

Query  289  PDRKVEELD----DDGDGFVTLDGNSDGSKKQR  203
            P+   +E +    ++ D  V ++     SKK++
Sbjct  591  PENHKKEAENVESEEDDDLVEIENPMMVSKKKK  623



>ref|XP_006657898.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Oryza brachyantha]
Length=613

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 141/221 (64%), Gaps = 23/221 (10%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NT + KLR+ ++KI+K+KLGMNLPL+M G+ L++E GD L+E
Sbjct  406  EPNKSCYVCSETPLLLEVNTKTTKLREVIDKIIKSKLGMNLPLVMIGSTLVFEDGDGLEE  465

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NYA NL+K+L EL  PV  GT + VED QQE +C+INIKHR+EFD EK+PDGMVLS
Sbjct  466  DEAANYALNLEKILAELPAPVINGTKITVEDFQQEFSCSINIKHRDEFDAEKEPDGMVLS  525

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL---  302
            GW+ PV       K    NG + S AS +        D  + +    +  PG KRKL   
Sbjct  526  GWSAPV------EKQVTSNGGNQSVASSSG------TDYPDGIVEDMSTKPGMKRKLDEI  573

Query  301  ------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                  CD +   +V E DDD D  V LD +   +KK+R+Q
Sbjct  574  LESKENCDASSSAQVVE-DDDDDDIVMLDEDPKLAKKKRLQ  613



>ref|NP_179742.2| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 dbj|BAC42380.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|ACI31306.1| At2g21470 [Arabidopsis thaliana]
 gb|AEC07181.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=625

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 145/212 (68%), Gaps = 21/212 (10%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCSETPL LEINT  +KLRD V+KIVK KLGMNLPLIM+G +LLYEVGDDLD+
Sbjct  427  EPNPACYVCSETPLVLEINTRKSKLRDLVDKIVKTKLGMNLPLIMHGNSLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  487  IMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPG-KKRKLCDT  293
            GWTP  A+         NG S+ST++   P+D  E        + +   P  KKR+L +T
Sbjct  547  GWTPSPAT---------NGESASTSNNENPVDVTE--------SSSGSEPASKKRRLSET  589

Query  292  ---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ  206
               N  ++ E ++ + D  + ++     SKK+
Sbjct  590  EASNHKKETENVESEDDDIMEVENPMMVSKKK  621



>ref|NP_001189570.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 gb|AEC07183.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=628

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 145/212 (68%), Gaps = 21/212 (10%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCSETPL LEINT  +KLRD V+KIVK KLGMNLPLIM+G +LLYEVGDDLD+
Sbjct  430  EPNPACYVCSETPLVLEINTRKSKLRDLVDKIVKTKLGMNLPLIMHGNSLLYEVGDDLDD  489

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  490  IMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  549

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPG-KKRKLCDT  293
            GWTP  A+         NG S+ST++   P+D  E        + +   P  KKR+L +T
Sbjct  550  GWTPSPAT---------NGESASTSNNENPVDVTE--------SSSGSEPASKKRRLSET  592

Query  292  ---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ  206
               N  ++ E ++ + D  + ++     SKK+
Sbjct  593  EASNHKKETENVESEDDDIMEVENPMMVSKKK  624



>emb|CDX82033.1| BnaC08g35680D [Brassica napus]
Length=628

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 149/215 (69%), Gaps = 23/215 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V+KIV AKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  428  EPNPACYVCSKTPLVLEINTQKSKLRDLVDKIVTAKLGMNLPLIMHGASLLYEVGDDLDD  487

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  488  IMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  547

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISP---GKKRKLC  299
            GWT   A+         NG S+ST        +N++++  +  T ++  P    KKR+L 
Sbjct  548  GWTQSPAT---------NGESAST--------SNDENEKAVDVTESSSGPEMASKKRRLS  590

Query  298  DTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  203
            +T P+   +K E ++ D D  + ++     SKK++
Sbjct  591  ETQPENDKKKTENVESDDDELMEIENPVMVSKKKK  625



>ref|XP_009117402.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Brassica rapa]
Length=630

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 148/215 (69%), Gaps = 23/215 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V+KIV AKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  430  EPNPACYVCSKTPLVLEINTQKSKLRDLVDKIVTAKLGMNLPLIMHGASLLYEVGDDLDD  489

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  490  IMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  549

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISP---GKKRKLC  299
            GWT   A+         NG S+ST        +N +++  +  T ++  P    KKR+L 
Sbjct  550  GWTQSPAT---------NGESAST--------SNNENEKAVDVTESSSGPEMASKKRRLS  592

Query  298  DTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  203
            +T P+   ++ E ++ D D  + ++     SKK++
Sbjct  593  ETQPENDKKETENVESDDDEIMEIENPVMVSKKKK  627



>emb|CDY13814.1| BnaA09g43160D [Brassica napus]
Length=630

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 148/215 (69%), Gaps = 23/215 (11%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LE+NT  +KLRD V+KIV AKLGMNLPLIM+GA+LLYEVGDDLD+
Sbjct  430  EPNPACYVCSKTPLVLEVNTQKSKLRDLVDKIVTAKLGMNLPLIMHGASLLYEVGDDLDD  489

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  PV  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  490  IMVANYNANLEKSLSELPSPVINGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  549

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISP---GKKRKLC  299
            GWT   A+         NG S+ST        +N +++  +  T ++  P    KKR+L 
Sbjct  550  GWTQSPAT---------NGESAST--------SNNENEKAVDVTESSSGPEMASKKRRLS  592

Query  298  DTNPD---RKVEELDDDGDGFVTLDGNSDGSKKQR  203
            +T P+   ++ E ++ D D  + ++     SKK++
Sbjct  593  ETQPENDKKETENVESDDDEIMEIENPVMVSKKKK  627



>ref|XP_008670523.1| PREDICTED: SUMO-activating enzyme subunit 2 [Zea mays]
Length=671

 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 146/232 (63%), Gaps = 37/232 (16%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EP+KSCYVCSETPL LE+NT + KLR+ +EK++K KLGMNLPLIM GA L++E G+DL+E
Sbjct  456  EPSKSCYVCSETPLVLEVNTKTTKLREVIEKVIKGKLGMNLPLIMVGATLVFEDGEDLEE  515

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              + NYA NL+KVL EL  PV  GT+V VEDL QEL C+INIKHR+EFDEEK+PD MVL 
Sbjct  516  DEIANYALNLEKVLAELPAPVLNGTMVTVEDLHQELKCSINIKHRDEFDEEKEPDRMVLV  575

Query  469  GWT-PVLASENNNKTTHDNGASSS--TASQTAPLDANEDDDLEILPTGTAISPGKKRKL-  302
            GW+ PV      +K T  NG + S  ++S T  +D   +D         + + G KRKL 
Sbjct  576  GWSGPV------DKQTTSNGETKSVPSSSNTEDVDGTAED--------ISATSGMKRKLN  621

Query  301  -----------------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  197
                              D++  + VE  DD+ DG +  D +   SKK+R+Q
Sbjct  622  EILETKENFDALENLSGVDSSSAQVVE--DDNDDGLLMFDEDPRQSKKKRLQ  671



>gb|KCW64020.1| hypothetical protein EUGRSUZ_G016992, partial [Eucalyptus grandis]
Length=521

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINTH + LR+FV+KIVKAKLGMNLPLIM+G+ALLYEVGDDL+E
Sbjct  385  EPNKSCYVCSETPLSLEINTHRSTLREFVDKIVKAKLGMNLPLIMHGSALLYEVGDDLEE  444

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR  515
             MV NYAANL+KVL EL  PV  GT++ VEDLQQELTCNI+IKHR
Sbjct  445  DMVTNYAANLEKVLSELPSPVTSGTLLTVEDLQQELTCNISIKHR  489



>ref|XP_006423380.1| hypothetical protein CICLE_v100281692mg, partial [Citrus clementina]
 gb|ESR36620.1| hypothetical protein CICLE_v100281692mg, partial [Citrus clementina]
Length=360

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT  +KLRDFVEKIVKAKLG+N PLIM+G+ LLYEVGDDLDE
Sbjct  249  EPNKSCYVCSETPLSLEINTSRSKLRDFVEKIVKAKLGINFPLIMHGSNLLYEVGDDLDE  308

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR  515
              V NYAANL+KVL +L  PV  GT++ VEDLQQELTCNINIKHR
Sbjct  309  VEVANYAANLEKVLSQLPSPVTNGTMLTVEDLQQELTCNINIKHR  353



>ref|XP_003627740.1| SUMO activating enzyme [Medicago truncatula]
Length=175

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 120/182 (66%), Gaps = 18/182 (10%)
 Frame = -3

Query  715  MNLPLIMNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTC  536
            M+LPL+MN + LLYE GD +++ MV  Y ANL+KVL EL  PV GGT++ VED QQEL C
Sbjct  1    MSLPLVMNASNLLYEAGD-IEDDMVAIYNANLEKVLAELPSPVTGGTMLTVEDFQQELKC  59

Query  535  NINIKHREEFDEEKDPDGMVLSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDD  359
            NINIKHREEFDEEK+PDGMVLSGWT PV A+EN +K+   NGA++S A  T    +  DD
Sbjct  60   NINIKHREEFDEEKEPDGMVLSGWTQPVAAAENEDKSVS-NGANTSDAPITEVEKSENDD  118

Query  358  DLEILPTGTAISPGKKRKL---------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  206
            D+ I      ISP KKRKL          D     K  ++ DD D  V LDGN DG KK+
Sbjct  119  DVGI------ISPVKKRKLPDDSDKSNTADDERHHKKLQVIDDEDDLVMLDGNLDGFKKR  172

Query  205  RV  200
            RV
Sbjct  173  RV  174



>gb|EEC82353.1| hypothetical protein OsI_26664 [Oryza sativa Indica Group]
Length=634

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 123/177 (69%), Gaps = 13/177 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NT + KLR+ +EKI+K+KLGMNLPL+M G+ L++E G+ L+E
Sbjct  427  EPNKSCYVCSETPLLLEVNTKTTKLREVIEKIIKSKLGMNLPLVMIGSTLVFEDGEGLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NYA NL+KVL EL  PV   T + VED QQEL+C+INIKHR+EFDEEK+PDGMVLS
Sbjct  487  DEAANYALNLEKVLAELPAPVVNDTKLTVEDFQQELSCSINIKHRDEFDEEKEPDGMVLS  546

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL  302
            GW+ PV       K    NG + S AS +    A  D  +E + T     PG KRKL
Sbjct  547  GWSAPV------EKQVTSNGGNQSVASSSGADYA--DGIVEDIST----KPGMKRKL  591



>gb|EEE67493.1| hypothetical protein OsJ_24922 [Oryza sativa Japonica Group]
Length=634

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 123/177 (69%), Gaps = 13/177 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NT + KLR+ +EKI+K+KLGMNLPL+M G+ L++E G+ L+E
Sbjct  427  EPNKSCYVCSETPLLLEVNTKTTKLREVIEKIIKSKLGMNLPLVMIGSTLVFEDGEGLEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
                NYA NL+KVL EL  PV   T + VED QQEL+C+INIKHR+EFDEEK+PDGMVLS
Sbjct  487  DEAANYALNLEKVLAELPAPVVNDTKLTVEDFQQELSCSINIKHRDEFDEEKEPDGMVLS  546

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL  302
            GW+ PV       K    NG + S AS +    A  D  +E + T     PG KRKL
Sbjct  547  GWSAPV------EKQVTSNGGNQSVASSSGADYA--DGIVEDIST----KPGMKRKL  591



>ref|XP_002460940.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
 gb|EER97461.1| hypothetical protein SORBIDRAFT_02g037850 [Sorghum bicolor]
Length=641

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 124/177 (70%), Gaps = 13/177 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EP+KSCYVCSETP+ LE+NT + KLR+ +EK++K+KLGMNLPLIM GA L++E G+DL+E
Sbjct  426  EPSKSCYVCSETPVVLEVNTKTTKLREVIEKVIKSKLGMNLPLIMVGATLVFEDGEDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
              + NYA NL+KVL EL  PV  GT + VED  QEL C+INIKHR+EFDEEK+PDGMVL+
Sbjct  486  DEIANYALNLEKVLAELPAPVLNGTTLTVEDFHQELKCSINIKHRDEFDEEKEPDGMVLA  545

Query  469  GWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL  302
            GW+ PV    +   T++    S  ++S T  +D   +D         +  PG KRKL
Sbjct  546  GWSGPV----DKQITSNGENRSVPSSSNTEDVDGTAED--------ISAKPGMKRKL  590



>ref|XP_004958165.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Setaria italica]
Length=638

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL LE+NT + KLR+ ++K++K+KLGMNLPL+M GA L++E G+ L+ 
Sbjct  425  EPNKSCYVCSETPLVLEVNTKTTKLREVIDKVIKSKLGMNLPLVMVGATLVFEDGEGLEP  484

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
               ENYA NLDKVL EL  PV   T + VED QQEL C+INIK R+EFD+EK+PDGMVL+
Sbjct  485  DEAENYALNLDKVLAELPAPVVNDTKLTVEDFQQELKCSINIKQRDEFDKEKEPDGMVLA  544

Query  469  GWT  461
            GWT
Sbjct  545  GWT  547



>gb|AAN03851.1| SUMO activating enzyme 2 [Arabidopsis thaliana]
Length=599

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 141/216 (65%), Gaps = 30/216 (14%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCSETPL LEINT  +KLRD V+KIVK KLGMNLPLIM+G +LLYEVGDDLD+
Sbjct  409  EPNPACYVCSETPLVLEINTRKSKLRDLVDKIVKTKLGMNLPLIMHGNSLLYEVGDDLDD  468

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV          L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDEEK+P+GMVLS
Sbjct  469  IMV--------AYLSELPSPILNGSILTVEDLQQELSCKINVKHREEFDEEKEPEGMVLS  520

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPG-KKRKLCDT  293
            GWTP  A+         NG S+ST++   P+D  E        + +   P  KKR+L +T
Sbjct  521  GWTPSPAT---------NGESASTSNNENPVDVTE--------SSSGSEPASKKRRLSET  563

Query  292  ---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  197
               N  ++ E ++ + D  + ++     SKK+ RV+
Sbjct  564  EASNHKKETENVESEDDDIMEVENPMMVSKKKIRVE  599



>ref|XP_002992493.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ06431.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS TPL LE+NT   KL+D +++I++ KLG++ P+IM+G +LL+E GDDL +
Sbjct  412  EPNPNCYVCSNTPLILEVNTGHTKLKDVIDRILRTKLGVSSPVIMHGTSLLFETGDDLGK  471

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
            + ++ Y +N +KVL EL  PV  G +++VEDLQQE  C+I+I+HR+ FDEEK+PDGMVL 
Sbjct  472  EEIQLYTSNSEKVLAELPTPVTNGGVLSVEDLQQEFKCSIHIRHRDNFDEEKEPDGMVLI  531

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEIL--------PTGTAISPGK  314
            GW+  +A +  +K           A+  A  +  +DDD+ ++        P   ++  GK
Sbjct  532  GWSSSVAEQEKDK-------GKPIAAPAASAEVIDDDDITLIEPAAKKRKPEDDSVPLGK  584

Query  313  KRKLCD  296
            K+K+ +
Sbjct  585  KQKVLE  590



>emb|CAD67688.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
Length=657

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCSETPL LEINT  +KLRD V+KIVK KLGMNLPLIM+G +LLYEVGDDLD+
Sbjct  384  EPNPACYVCSETPLVLEINTRKSKLRDLVDKIVKTKLGMNLPLIMHGNSLLYEVGDDLDD  443

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHR  F E  +P  ++ S
Sbjct  444  IMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHR-FFSEILNP--VLNS  500

Query  469  GWTPVLASENNNKTTH  422
             W  ++      K  H
Sbjct  501  VWFLIILPSTFPKLFH  516



>ref|NP_973506.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
 sp|Q9SJT1.1|SAE2_ARATH RecName: Full=SUMO-activating enzyme subunit 2; AltName: Full=Protein 
EMBRYO DEFECTIVE 2764; AltName: Full=Ubiquitin-like 
1-activating enzyme E1B [Arabidopsis thaliana]
 gb|AAD23691.1| putative ubiquitin activating enzyme [Arabidopsis thaliana]
 gb|AEC07182.1| SUMO-activating enzyme subunit 2 [Arabidopsis thaliana]
Length=700

 Score =   160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 99/136 (73%), Gaps = 3/136 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCSETPL LEINT  +KLRD V+KIVK KLGMNLPLIM+G +LLYEVGDDLD+
Sbjct  427  EPNPACYVCSETPLVLEINTRKSKLRDLVDKIVKTKLGMNLPLIMHGNSLLYEVGDDLDD  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHR  F E  +P  ++ S
Sbjct  487  IMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHR-FFSEILNP--VLNS  543

Query  469  GWTPVLASENNNKTTH  422
             W  ++      K  H
Sbjct  544  VWFLIILPSTFPKLFH  559



>ref|XP_002990197.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
 gb|EFJ08757.1| SUMO activating enzyme 2 [Selaginella moellendorffii]
Length=590

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS TPL LE+NT   KL+D +++I++ KLG++ P+IM+G +LL+E GDDL +
Sbjct  412  EPNPNCYVCSNTPLILEVNTVHTKLKDVIDRILRTKLGVSSPVIMHGTSLLFETGDDLGK  471

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
            + ++ Y +N +KVL EL  PV  G +++VEDLQQE  C+I+I+HR+ FDEEK+PDGMVL 
Sbjct  472  EEIQLYTSNSEKVLAELPTPVTNGGVLSVEDLQQEFKCSIHIRHRDNFDEEKEPDGMVLI  531

Query  469  GWTPVLASENNNK  431
            GW+  +A +  +K
Sbjct  532  GWSSSVAEQEKDK  544



>ref|XP_002878554.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54813.1| sumo-activating enzyme 2 [Arabidopsis lyrata subsp. lyrata]
Length=678

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +CYVCS+TPL LEINT  +KLRD V++IVKAKLGMNLPLIM+G +LLYEVGDDLD+
Sbjct  416  EPNPACYVCSKTPLVLEINTRKSKLRDLVDRIVKAKLGMNLPLIMHGNSLLYEVGDDLDD  475

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR  515
             MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHR
Sbjct  476  IMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHR  520



>ref|XP_009399956.1| PREDICTED: SUMO-activating enzyme subunit 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=555

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E NKSCYVCSETPL LE+NT ++ LRDFV+KIVK KLGM+ PLIM GA L++E GDDL+E
Sbjct  426  EANKSCYVCSETPLLLEVNTQTSTLRDFVDKIVKNKLGMSFPLIMQGAILIFEGGDDLEE  485

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR  515
             +  NYA NLDKVL  L  PV  G+++ VEDLQQEL+C+INIKHR
Sbjct  486  DIAANYALNLDKVLTALPAPVTSGSMLTVEDLQQELSCHINIKHR  530



>ref|XP_001775802.1| predicted protein [Physcomitrella patens]
 gb|EDQ59341.1| predicted protein, partial [Physcomitrella patens]
Length=618

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 15/183 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN  CYVCSETPL LE+NT +A +R+ V+K+VK KLG+  P+IM  + LL+E GDD++E
Sbjct  427  EPNPRCYVCSETPLVLELNTATATMREVVKKVVKRKLGVTDPVIMQSSTLLHEAGDDIEE  486

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
             MV  Y   LDK   +   P+  G ++ +ED  Q+  C++++KHRE FD+EK+P+GMVLS
Sbjct  487  DMVAYYTTLLDKKFQDYPTPITTGVVLTIEDYHQDFRCSLHVKHRETFDQEKEPEGMVLS  546

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDAN------EDDDLEILPTG-TAISPGKK  311
            G    LAS N  +T     A+ ST++  A L A       EDDD+ ++     A + G K
Sbjct  547  G---DLASLNTTET-----AAESTSTLNASLKAENGHTEVEDDDVVMVELAPKAATAGTK  598

Query  310  RKL  302
            R++
Sbjct  599  RRI  601



>ref|XP_007042099.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
 gb|EOX97930.1| SUMO-activating enzyme 2 isoform 3 [Theobroma cacao]
Length=578

 Score =   130 bits (326),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  423  EPNKSCYVCSETPLSLEVNTHRSKLRDFVEKIVKAKLGMNFPLIMQGASILYEVGEDLEE  482

Query  649  KMVENYAANLDKVLCEL  599
             MV  YAANL+K+L  L
Sbjct  483  DMVAIYAANLEKLLVGL  499


 Score = 32.3 bits (72),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -1

Query  561  RIFSRSLPAISTLNIGKSLMRRRIPMAWFYRDGLQFWRVKTTIRQHMTTGQVRLLLPKLP  382
            RIFSRS  AIS  +IGK+LMRRR  M  F  DGL    ++T I          +L  +  
Sbjct  504  RIFSRSSHAISISSIGKNLMRRRNLMECFSLDGLNLLLIRTRISLLEMVKVHPMLYQQRR  563

Query  381  LWMPTRMTTWKFFQ  340
            +W P R   ++ FQ
Sbjct  564  VWRPRRTLQFRKFQ  577



>ref|XP_007042098.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
 gb|EOX97929.1| SUMO-activating enzyme 2 isoform 2 [Theobroma cacao]
Length=525

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  423  EPNKSCYVCSETPLSLEVNTHRSKLRDFVEKIVKAKLGMNFPLIMQGASILYEVGEDLEE  482

Query  649  KMVENYAANLDKVL  608
             MV  YAANL+KV 
Sbjct  483  DMVAIYAANLEKVF  496



>gb|KJB47539.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
 gb|KJB47541.1| hypothetical protein B456_008G030900 [Gossypium raimondii]
Length=539

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LE+NTH +KLRDFVEKIVKAKLGMN P+IM+GA+++YEVG+DL+E
Sbjct  424  EPNKSCYVCSETPLSLEVNTHHSKLRDFVEKIVKAKLGMNFPVIMSGASIIYEVGEDLEE  483

Query  649  KMVENYAANLDKV  611
             MV  YAANL+KV
Sbjct  484  DMVAIYAANLEKV  496



>gb|KDO49457.1| hypothetical protein CISIN_1g006294mg [Citrus sinensis]
Length=563

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPNKSCYVCSETPL+LEINT  +KLRDFVEKIVKAKLG+N PLIM+G+ LLYEVGDDLDE
Sbjct  425  EPNKSCYVCSETPLSLEINTSRSKLRDFVEKIVKAKLGINFPLIMHGSNLLYEVGDDLDE  484

Query  649  KMVENYAANLDKV  611
              V NYAANL+KV
Sbjct  485  VEVANYAANLEKV  497



>gb|KJB32554.1| hypothetical protein B456_005G246300 [Gossypium raimondii]
Length=523

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN+SCYVCSETP++LE+NT  +KLRDFVEKI+KAKLGMN PLIM GA++LYEVG+DL+E
Sbjct  424  EPNRSCYVCSETPVSLEVNTQRSKLRDFVEKIIKAKLGMNFPLIMQGASILYEVGEDLEE  483

Query  649  KMVENYAANLDKV  611
             MV  YAANL+KV
Sbjct  484  DMVAIYAANLEKV  496



>ref|XP_001762389.1| predicted protein [Physcomitrella patens]
 gb|EDQ72856.1| predicted protein [Physcomitrella patens]
Length=524

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN  CYVCSETPL LE+NT +A +R+ +EK+VK KLG+  P+IM GA LL+E G+D++E
Sbjct  410  EPNPRCYVCSETPLVLELNTATATMREVIEKVVKRKLGVTDPVIMQGATLLHEAGEDIEE  469

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREE  509
             MV  Y A LDK   +   P+  G ++ VED  Q+  C++++KHRE 
Sbjct  470  DMVAYYRALLDKKFVDYPTPITTGVVLTVEDYHQDFRCSLHVKHRER  516



>dbj|BAD95040.1| ubiquitin activating enzyme like protein [Arabidopsis thaliana]
Length=149

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 105/166 (63%), Gaps = 22/166 (13%)
 Frame = -3

Query  679  LYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDE  500
            LYEVGDDLD+ MV NY ANL+K L EL  P+  G+I+ VEDLQQEL+C IN+KHREEFDE
Sbjct  1    LYEVGDDLDDIMVANYNANLEKYLSELPSPILNGSILTVEDLQQELSCKINVKHREEFDE  60

Query  499  EKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISP  320
            EK+P+GMVLSGWTP  A+         NG S+ST++   P+D  E        + +   P
Sbjct  61   EKEPEGMVLSGWTPSPAT---------NGESASTSNNENPVDVTE--------SSSGSEP  103

Query  319  G-KKRKLCDT---NPDRKVEELDDDGDGFVTLDGNSDGSKKQ-RVQ  197
              +KR+L +T   N  ++ E ++ + D  + ++     SKK+ RV+
Sbjct  104  ASRKRRLSETEASNHKKETENVESEDDDIMEVENPMMVSKKKIRVE  149



>tpg|DAA41264.1| TPA: hypothetical protein ZEAMMB73_736183 [Zea mays]
Length=94

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EP+KSCYVCSETPL LE+NT + KLR+ +EK++K KLGMNLPLIM GA L++E G+DL+E
Sbjct  21   EPSKSCYVCSETPLVLEVNTKTTKLREVIEKVIKGKLGMNLPLIMVGATLVFEDGEDLEE  80

Query  649  KMVENYAANLDKVL  608
              + NYA NL+KVL
Sbjct  81   DEIANYALNLEKVL  94



>ref|XP_003078790.1| SUMO activating enzyme 2 (ISS), partial [Ostreococcus tauri]
Length=540

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  C VCS   + L  NT+     D ++K++K +L ++ P +M G++ ++E GDDLDE
Sbjct  362  DPNPKCSVCSNARVELVCNTNKFTKGDLIKKVLKGRLSVHAPSVMFGSSQIHETGDDLDE  421

Query  649  KMVENYAANLDKVLCELRP--PVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
              VE+Y A LDK      P   V  GTI+ V+D  QE T  + + HREE+DEE DPDG +
Sbjct  422  DEVEHYEA-LDKRTLSALPGGGVVNGTILAVDDFSQEFTFELMVTHREEWDEENDPDGFI  480

Query  475  LSG  467
            + G
Sbjct  481  IRG  483



>emb|CEF97583.1| Molybdenum cofactor biosynthesis, MoeB [Ostreococcus tauri]
Length=582

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 3/123 (2%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  C VCS   + L  NT+     D ++K++K +L ++ P +M G++ ++E GDDLDE
Sbjct  404  DPNPKCSVCSNARVELVCNTNKFTKGDLIKKVLKGRLSVHAPSVMFGSSQIHETGDDLDE  463

Query  649  KMVENYAANLDKVLCELRP--PVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
              VE+Y A LDK      P   V  GTI+ V+D  QE T  + + HREE+DEE DPDG +
Sbjct  464  DEVEHYEA-LDKRTLSALPGGGVVNGTILAVDDFSQEFTFELMVTHREEWDEENDPDGFI  522

Query  475  LSG  467
            + G
Sbjct  523  IRG  525



>ref|XP_009519056.1| hypothetical protein PHYSODRAFT_349758 [Phytophthora sojae]
 gb|EGZ23768.1| hypothetical protein PHYSODRAFT_349758 [Phytophthora sojae]
Length=626

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 71/114 (62%), Gaps = 7/114 (6%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  CYVCS+  + L ++T+   LRD VE+++K KLG+N P I  GA  +YE G+D +E
Sbjct  435  KPNPQCYVCSKHTVELAVDTNRMLLRDLVEQVLKKKLGVNEPTISIGANTIYEEGEDAEE  494

Query  649  KMVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHR--EEFDEE  497
             +    A NL+K L +L    ++  T V+VED  Q+  CNI + HR  +EF EE
Sbjct  495  SL----AVNLEKKLADLPGKGIHHETTVSVEDFSQDFRCNIRVLHRDAKEFGEE  544



>ref|XP_001417248.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95541.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=518

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  C VC    + L  +T      D V++++K K  +N P +  G  LL+E G+DLDE
Sbjct  397  DPNPKCAVCGNARVELVCDTTKFTKGDLVKRVLKGKFSVNEPTVQFGGNLLHETGEDLDE  456

Query  649  KMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHREEFDEEKDPDGM  479
              VE+YA+   + L +L  P  G   GTI+ +ED  Q+    + + HRE++D+EK+PDG 
Sbjct  457  DEVEHYASLDPRTLDKL--PGGGVVNGTILLIEDYSQDFKFELMVTHREDWDDEKEPDGF  514

Query  478  VLSG  467
            ++ G
Sbjct  515  IVRG  518



>ref|XP_002999118.1| ubiquitin-activating enzyme (E1), putative [Phytophthora infestans 
T30-4]
 gb|EEY69264.1| ubiquitin-activating enzyme (E1), putative [Phytophthora infestans 
T30-4]
Length=624

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 7/114 (6%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  CYVCS+  + L ++T+   LRD V+K++K KLG+N P I  GA  +YE G+D + 
Sbjct  435  KPNPQCYVCSKHTVELAVDTNCMLLRDLVDKVLKKKLGVNEPTISIGANTIYEEGEDAEM  494

Query  649  KMVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHR--EEFDEE  497
             +    A NL+K L +L    +   T V+VED  Q+  CNI + HR  EEF E+
Sbjct  495  SL----AVNLEKKLVDLPGKGIRHDTTVSVEDFSQDFRCNIRVLHRDEEEFGED  544



>emb|CBJ28585.1| putative ubiquitin activating enzyme [Ectocarpus siliculosus]
Length=297

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 10/116 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +P KSC+VC+ + L L ++T +  L D VE+++K +LG+N P +  GA  LYE GD  D+
Sbjct  155  KPAKSCFVCNTSTLELCLDTETLTLADLVERVLKQRLGVNEPTVGLGATTLYEEGDGADD  214

Query  649  KMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHREEFDEEKD  491
            ++V     NL K+L +L  P  G    T V VED  Q+LT  +NI H+  FDEE++
Sbjct  215  RLV----VNLTKLLKDL--PGGGIKDDTAVEVEDFSQDLTVKLNIFHK-TFDEEEE  263



>ref|XP_008869322.1| hypothetical protein H310_06150 [Aphanomyces invadans]
 gb|ETW02717.1| hypothetical protein H310_06150 [Aphanomyces invadans]
Length=569

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
             PN  C+VCS   + L +N H   L+ FV+ ++K K+G+N P I  G+  +YE G D +E
Sbjct  413  HPNPKCFVCSRQLVDLGLNVHKTTLQQFVDNVLKKKMGVNEPTISIGSNTIYEEGVDAEE  472

Query  649  KMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHREEFDE  500
             +     ANL K L EL  P  G   GT+V VED  Q+ TC+I+I H    DE
Sbjct  473  SL----TANLAKKLTEL--PGGGIVQGTVVIVEDFSQDFTCSISIHHVATKDE  519



>emb|CCI48953.1| unnamed protein product [Albugo candida]
Length=579

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 84/177 (47%), Gaps = 36/177 (20%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            PN SC  CS+    L I+T    LR F+ +++K KLGMN P I  GA+ +YE G+  +  
Sbjct  437  PNTSCLACSQHVTDLAIDTERTTLRQFISRVLKGKLGMNEPTISIGASTIYEEGECAEAS  496

Query  646  MVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLS  470
            +    + +LDKVL  L    +   TIV +ED  Q+  C +++ H  EFDEE     ++  
Sbjct  497  L----SVHLDKVLSALPGSGIRHDTIVLIEDFSQDFQCQLHVSHC-EFDEETAEHFII--  549

Query  469  GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTG-TAISPGKKRKL  302
                                   T  +T P      + +EI+PT  T  SP K+R+L
Sbjct  550  ----------------------GTCKKTCP-----PETVEIVPTASTDESPHKRRRL  579



>ref|XP_004359730.1| sumo-activating enzyme subunit 2 [Dictyostelium fasciculatum]
 gb|EGG21879.1| sumo-activating enzyme subunit 2 [Dictyostelium fasciculatum]
Length=639

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 72/115 (63%), Gaps = 10/115 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PNKSCYVCS+T +TL+I+T++  +   V +++K  L  + P+IM G +++YE GDDLD+
Sbjct  451  QPNKSCYVCSQTVVTLKIDTNTTTIGKLVNEVLKKGLAFHEPMIMKGQSMIYEGGDDLDK  510

Query  649  KMVENYAANLDKVLCELRPPVNGG----TIVNVEDLQQELTCNINIKHREEFDEE  497
            + ++       + + E +P +  G     I+ V D  Q++  +I I H ++F+++
Sbjct  511  EELDA------RKMVEQKPMITFGLSDNAIIEVHDYLQDIKVSILISHCDKFEDQ  559



>dbj|GAM22192.1| hypothetical protein SAMD00019534_053670, partial [Acytostelium 
subglobosum LB1]
Length=636

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 96/189 (51%), Gaps = 10/189 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGD-DLD  653
            +P   CYVCS+  +TL+INT    L   V  ++K  L  + P++  GA+LLYE GD DL 
Sbjct  443  KPKADCYVCSQKFITLKINTLKTTLAQLVNDVLKKALSFHDPMLTVGASLLYEGGDEDLT  502

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFD-EEKDPDGMV  476
            ++ +E       K++ E + P N  TI+NVED  Q    +I I H E F+ EEK  D   
Sbjct  503  KEEIEARNKLEQKIIAEYKMPDN--TILNVEDYLQNFKVSILISHCETFESEEKWFD---  557

Query  475  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD  296
            +SG  PV   E   +TT     +++       +D    DD+EI+ +     P  K  + +
Sbjct  558  ISGKQPVPGEEKAVQTTTTTTTTTTAKVGDQKIDL---DDVEIIESIDVAPPSTKEPVTE  614

Query  295  TNPDRKVEE  269
            T   ++ E+
Sbjct  615  TRTHKRKEQ  623



>gb|ETP47472.1| hypothetical protein F442_06579 [Phytophthora parasitica P10297]
Length=627

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  CYVCS+  + L ++T+   LR  VE ++K KLG+N P I  G   +YE G+D + 
Sbjct  438  KPNPQCYVCSKHTVELAVDTNRMLLRGLVELVLKKKLGVNEPTISIGPNTIYEEGEDAET  497

Query  649  KMVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHRE  512
             +    A NL+K L +L    +   T V++ED  Q+  CNI + HR+
Sbjct  498  SL----AVNLEKKLVDLPGKGIRHDTTVSIEDFSQDFRCNIRVFHRD  540



>ref|XP_008892081.1| hypothetical protein PPTG_02637 [Phytophthora parasitica INRA-310]
 gb|ETN22861.1| hypothetical protein PPTG_02637 [Phytophthora parasitica INRA-310]
Length=624

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  CYVCS+  + L ++T+   LR  VE ++K KLG+N P I  G   +YE G+D + 
Sbjct  435  KPNPQCYVCSKHTVELAVDTNRMLLRGLVELVLKKKLGVNEPTISIGPNTIYEEGEDAET  494

Query  649  KMVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHRE  512
             +    A NL+K L +L    +   T V++ED  Q+  CNI + HR+
Sbjct  495  SL----AVNLEKKLVDLPGKGIRHDTTVSIEDFSQDFRCNIRVFHRD  537



>gb|ETI49760.1| hypothetical protein F443_06536 [Phytophthora parasitica P1569]
 gb|ETK89645.1| hypothetical protein L915_06403 [Phytophthora parasitica]
 gb|ETL43047.1| hypothetical protein L916_06349 [Phytophthora parasitica]
 gb|ETL96222.1| hypothetical protein L917_06215 [Phytophthora parasitica]
 gb|ETM49391.1| hypothetical protein L914_06330 [Phytophthora parasitica]
 gb|ETO78472.1| hypothetical protein F444_06600 [Phytophthora parasitica P1976]
 gb|ETP19532.1| hypothetical protein F441_06540 [Phytophthora parasitica CJ01A1]
Length=624

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  CYVCS+  + L ++T+   LR  VE ++K KLG+N P I  G   +YE G+D + 
Sbjct  435  KPNPQCYVCSKHTVELAVDTNRMLLRGLVELVLKKKLGVNEPTISIGPNTIYEEGEDAET  494

Query  649  KMVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHRE  512
             +    A NL+K L +L    +   T V++ED  Q+  CNI + HR+
Sbjct  495  SL----AVNLEKKLVDLPGKGIRHDTTVSIEDFSQDFRCNIRVFHRD  537



>gb|EFA83622.1| sumo-activating enzyme subunit 2 [Polysphondylium pallidum PN500]
Length=627

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 3/112 (3%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGD-DLD  653
            +P   CYVCS+  +TL+INT +  L   +  ++K  L  + P++  GA+LLYE GD DL 
Sbjct  436  KPKSDCYVCSQNFITLKINTKTTTLSQLLNDVLKKNLSFHDPILTVGASLLYEGGDEDLS  495

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEE  497
            ++ +E       K++ + + P N  TI+NVED  Q    +I I H E FDE+
Sbjct  496  KEEIEERNKLEQKIIADYKMPDN--TILNVEDYLQNFKVSILIIHCETFDED  545



>emb|CCA14752.1| ubiquitinactivating enzyme (E1) putative [Albugo laibachii Nc14]
Length=584

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 66/111 (59%), Gaps = 6/111 (5%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            P+ +C  C++    L I+T    LR+F+ +++K KLGMN P I  GA+ +YE G+  +E 
Sbjct  436  PSSTCLACNQHMTELAIDTERTTLREFIGQVLKGKLGMNEPTISIGASTIYEEGECAEES  495

Query  646  MVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHREEFDEE  497
            +     A+LDKVL  L    ++  TIV +ED  Q+  C +++ H  EFD++
Sbjct  496  L----CAHLDKVLSALPGSGIHDDTIVLIEDFSQDFQCRLHVSHC-EFDDQ  541



>ref|XP_009844967.1| hypothetical protein H257_17773 [Aphanomyces astaci]
 gb|ETV65479.1| hypothetical protein H257_17773 [Aphanomyces astaci]
Length=572

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 65/106 (61%), Gaps = 5/106 (5%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            PN +C+VCS   + + +N HS  L+ FV+ ++K K+G++ P I  G+  +YE GDD +E 
Sbjct  417  PNPTCFVCSRQVVDVGLNVHSTTLQQFVDHVLKKKMGVHEPTISMGSHTIYEEGDDAEES  476

Query  646  MVENYAANLDKVLCEL-RPPVNGGTIVNVEDLQQELTCNINIKHRE  512
            +    AANL K L +L    V  G +V VED  Q+ TC+I+I H E
Sbjct  477  L----AANLTKKLPDLPGGGVGHGAVVIVEDFSQDFTCSISIHHVE  518



>gb|EWM25223.1| sumo-activating enzyme subunit 2 [Nannochloropsis gaditana]
Length=692

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 70/131 (53%), Gaps = 16/131 (12%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLI-MNGAALLYEVGDDLDE  650
            PN +C+VC+ + L + ++T ++ L   VEK++K  L    P I + G +++YE G+D DE
Sbjct  441  PNPACFVCNRSSLDVVLDTEASTLSFLVEKVLKGSLSFAQPTITLRGTSIIYEEGEDADE  500

Query  649  KMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHRE-------EFDE  500
             M      NL   L  L  P  G    + V V+D+ Q+LT ++++ H+        E D 
Sbjct  501  TMARR---NLPLALASL--PAGGIRDQSTVEVDDVSQDLTLHLHVYHKRWEGGPEGEGDA  555

Query  499  EKDPDGMVLSG  467
            E  P+G +L G
Sbjct  556  EAPPEGFLLGG  566



>ref|XP_003285101.1| hypothetical protein DICPUDRAFT_76062 [Dictyostelium purpureum]
 gb|EGC38344.1| hypothetical protein DICPUDRAFT_76062 [Dictyostelium purpureum]
Length=655

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGD-DLD  653
            EPN  C+VC+   +T ++NT    +  FV +I+K  L +N P++  G  L+YE GD DLD
Sbjct  429  EPNPKCFVCNRNFITCKLNTDKVTVGKFVNEILKKSLAVNEPILTVGNDLIYEGGDQDLD  488

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEF  506
            ++ +       +K++ + R  VNG  ++ +ED  Q+    +NI H  EF
Sbjct  489  KEEIAQRKKIEEKIMGQYR-LVNGSQVI-IEDYNQDFKVTMNIVHTNEF  535



>ref|XP_002178935.1| sumo-activating enzyme 2 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49633.1| sumo-activating enzyme 2 [Phaeodactylum tricornutum CCAP 1055/1]
Length=643

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 63/113 (56%), Gaps = 8/113 (7%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            +PN  C+VC    + L +N ++  L+D ++K++K  LG   P I     +++E G D D 
Sbjct  447  KPNPRCFVCRNATVPLALNVNNWTLQDLLQKLIKKDLGFEEPTITLDGDIVWEEGSDADS  506

Query  649  KMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHREEFDE  500
               E +A NL K+L +L  P  G   GT++ +ED  Q+LT ++ + H+  ++ 
Sbjct  507  ---EAFAVNLPKLLPQL--PCGGIQHGTVLRIEDFSQDLTVDVAVTHQTVWER  554



>ref|XP_002679801.1| ubiquitin-like 1 activating enzyme E1B [Naegleria gruberi]
 gb|EFC47057.1| ubiquitin-like 1 activating enzyme E1B [Naegleria gruberi]
Length=632

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = -3

Query  823  NKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEKM  644
            N +CYVCS   +T+  N     L+ FVE I+K+KL +  P I+    L+YE G+DL+E  
Sbjct  429  NSNCYVCSSNSVTVVANCDKMSLQKFVEDILKSKLALVEPSILANDDLIYECGEDLEENQ  488

Query  643  VENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEE  497
            +E+      K L EL   +   T + VED  Q++T  + IK+  + + E
Sbjct  489  IESIQKRQQKTLKEL--GIVDNTELLVEDFSQDITWKVFIKNNTKIEVE  535



>ref|XP_002505850.1| SUMO1 activating enzyme subunit 2 [Micromonas sp. RCC299]
 gb|ACO67108.1| SUMO1 activating enzyme subunit 2 [Micromonas sp. RCC299]
Length=644

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 5/107 (5%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            PNKSC VC    + L  +  S  L   +++++K KLGMN P +     +LYE  D LD+ 
Sbjct  448  PNKSCVVCGAARVELVCDVESMTLGRLIDEVLKKKLGMNAPEVNAPETILYEQDDGLDDD  507

Query  646  MVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHR  515
             +E YA N    L  L  P  G    T + V D  Q+   ++ + HR
Sbjct  508  EIEQYAKNCKSTLANL--PAGGVRHNTALRVSDFTQKFEFDLIVTHR  552



>ref|XP_008613648.1| hypothetical protein SDRG_09489 [Saprolegnia diclina VS20]
 gb|EQC32962.1| hypothetical protein SDRG_09489 [Saprolegnia diclina VS20]
Length=587

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            PN  C+VCS   L L +   +  L   VE ++K ++GMN P +  GA  +YE GDD +E 
Sbjct  412  PNPKCFVCSRQVLDLALMLKTTTLEQLVEHVLKKRMGMNAPTVSIGANTIYEEGDDAEES  471

Query  646  MVENYAANLDKVLCELRPP---VNGGTIVNVEDLQQELTCNINIK  521
            +  N    LD++      P   V+  T++ VED  Q+   ++ IK
Sbjct  472  LRVNLPKRLDEL------PGGGVHHDTVLTVEDFSQDFNSSLCIK  510



>ref|XP_005856332.1| hypothetical protein NGA_2085000, partial [Nannochloropsis gaditana 
CCMP526]
 gb|EKU20028.1| hypothetical protein NGA_2085000, partial [Nannochloropsis gaditana 
CCMP526]
Length=197

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 9/109 (8%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLI-MNGAALLYEVGDDLDE  650
            PN +C+VC+ + L + ++T ++ L   VEK++K  L    P I + G  ++YE G+D DE
Sbjct  25   PNPACFVCNRSSLDVVLDTEASTLSFLVEKVLKGSLSFAQPTITLRGTNIIYEEGEDADE  84

Query  649  KMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKHRE  512
             M      NL   L  L  P  G    + V V+D+ Q+LT  +++ H+ 
Sbjct  85   TMARR---NLPLALASL--PAGGIRDQSTVEVDDVSQDLTLQLHVYHKR  128



>gb|KDO27496.1| hypothetical protein SPRG_07085 [Saprolegnia parasitica CBS 223.65]
Length=585

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 7/104 (7%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            PN  C+VCS   L L +   +  L+  V+ ++K ++GMN P +  GA  +YE G+D +E 
Sbjct  413  PNPKCFVCSRQVLDLALMLKTTTLQQLVDHVLKKRMGMNAPTVSIGANTIYEEGEDAEES  472

Query  646  MVENYAANLDKVLCELRP--PVNGGTIVNVEDLQQELTCNINIK  521
            +  N A  LD++     P   V+  T++ VED  Q+   ++ IK
Sbjct  473  LRVNLAKRLDEL-----PGGGVHHDTVLTVEDFSQDFNSSLCIK  511



>ref|XP_007512390.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16990.1| predicted protein [Bathycoccus prasinos]
Length=631

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 4/148 (3%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            E N  C VC+     L  +     L D + K++K KL  N P ++ G  +L+E G+DLD+
Sbjct  445  EQNPKCVVCANARAELCCDISKTTLADVISKVLKKKLNTNEPTVLKGDDMLHEEGEDLDD  504

Query  649  KMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR--EEFDEEKDPDGMV  476
              VENYA    + L +L   +  G I+ V+D  QEL  ++ + H+  EEFDE+  P+G  
Sbjct  505  DEVENYAIIGKRTLQDL--GLESGGILCVDDNSQELKFDLVVVHQNLEEFDEDAFPEGFE  562

Query  475  LSGWTPVLASENNNKTTHDNGASSSTAS  392
            L G TP +A     +   D  A+   AS
Sbjct  563  LRGETPKVAEGAEKEKDEDGAATDGEAS  590



>ref|XP_005713926.1| unnamed protein product [Chondrus crispus]
 emb|CDF34107.1| unnamed protein product [Chondrus crispus]
Length=704

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 91/211 (43%), Gaps = 26/211 (12%)
 Frame = -3

Query  823  NKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAA----LLYEVGDDL  656
            N+ C+VCS+  L L ++    KLR  V  +++ ++ +  P +   A      LYE G  L
Sbjct  483  NEKCFVCSKGHLQLILDLEKTKLRTVVNTVLQKRMCVLQPTVNLTAGEYHNTLYECGVGL  542

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
            +   +E Y  NL+K L ELR  V  G+ + V DL Q L+C +++ H     E+K      
Sbjct  543  EADEIEEYEQNLEKSLQELR--VTDGSELVVSDLAQNLSCTVHVSHASGLYEDK------  594

Query  475  LSGWTPV-LASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC  299
             + W    L  +        NG  S         D+ ED D E L        G     C
Sbjct  595  -AEWERFRLEGKIQEAEVDTNGVRSED-------DSTEDVDDECLEVPVQEMEGS----C  642

Query  298  DTNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  206
               P+  V  + D+ +  VT +G   G KK+
Sbjct  643  AAAPNTSV-AIADEANVTVTAEGEDRGGKKR  672



>ref|XP_011431808.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Crassostrea 
gigas]
 gb|EKC24155.1| SUMO-activating enzyme subunit 2 [Crassostrea gigas]
Length=615

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 89/187 (48%), Gaps = 26/187 (14%)
 Frame = -3

Query  829  EPNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVG  665
            +P+  CYVCS  P +T+ +NT    ++   +KI+K+ LGM  P +      G  L+    
Sbjct  430  KPSPKCYVCSSKPEVTVVLNTEKMTIKTLEDKILKSALGMVAPDVEIDDGKGTILISSEE  489

Query  664  DDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPD  485
             +++E        N DK L E    V  G+I+  +D  Q     I I H+++ +E+K+ D
Sbjct  490  GEMEE--------NNDKFLSEFH--VGNGSILKCDDFLQSYELKIIIAHKDKLEEDKEFD  539

Query  484  GMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRK  305
              V+   + + A     + T+ NG+++S           E+DDL I+     I  G KRK
Sbjct  540  --VVGDLSELHAKPLVEQPTNQNGSTTS--------HQEEEDDLMIVDEVEVIKSGTKRK  589

Query  304  LCDTNPD  284
              D  PD
Sbjct  590  -ADQEPD  595



>ref|XP_003063899.1| SUMO1 activating enzyme subunit 2 [Micromonas pusilla CCMP1545]
 gb|EEH52272.1| SUMO1 activating enzyme subunit 2 [Micromonas pusilla CCMP1545]
Length=623

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 9/125 (7%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEV--GDDLD  653
            PN  C+VC    + L  +     L   ++ ++  K+GM  P I +   +L+E   GD LD
Sbjct  430  PNPKCHVCGAARVELRCDATRMTLGSLIDDVLLKKIGMIAPEIQHPRTILHEHDDGDSLD  489

Query  652  EKMVENYAANLDKVLCELRPPVNG---GTIVNVEDLQQELTCNINIKH--REEFDEEKDP  488
            E  VE Y  N    L +L  P  G   G +++V D  Q+    + + H  REE+D+E+ P
Sbjct  490  EDEVETYRKNRSTRLVDL--PAGGVKSGDVLSVTDFSQKFEFELLVTHVPREEWDDEEHP  547

Query  487  DGMVL  473
            +G  L
Sbjct  548  EGFEL  552



>ref|XP_002949965.1| hypothetical protein VOLCADRAFT_104505 [Volvox carteri f. nagariensis]
 gb|EFJ49068.1| hypothetical protein VOLCADRAFT_104505 [Volvox carteri f. nagariensis]
Length=779

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -3

Query  766  SAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPV  587
            +A L   +  ++K +L +N P +++G   LYE G+ L++  VE Y A L + L EL  P 
Sbjct  514  TATLSSLLSGVIKKRLAVNTPNLLSGG-FLYEEGEGLEQDEVEAYTALLPRTLAEL--PG  570

Query  586  NG---GTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMVLSG  467
             G   G+I+ V+D  Q    ++ + H  +  EE  P+G +L G
Sbjct  571  GGLRHGSILTVQDQSQHFGVDVIVVHTADLREEDAPEGYLLEG  613



>ref|XP_003706783.1| PREDICTED: SUMO-activating enzyme subunit 2 [Megachile rotundata]
Length=672

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 88/178 (49%), Gaps = 19/178 (11%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP-LIMNGAALLYEVGDDLD  653
            PN  CYVC+  P   L I+T  A +++  E ++K +L M  P +I++G      VG  + 
Sbjct  438  PNPKCYVCAPMPQAVLAIDTFKATIKELEEVVLKNRLNMIAPDVIIDG------VGTVVI  491

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKD-PDGMV  476
                     N +K+L +L   +  GTI+ V+D QQ  +  + + HRE  + + D PD + 
Sbjct  492  SSEEGETEENNNKLLEQLG--IKDGTILKVDDFQQNYSLTVTVVHRERPNVKDDNPDFL-  548

Query  475  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL  302
                  VLA E + K   DN +    ++    +D + DD++ I+ T T     KKRK+
Sbjct  549  ------VLADEKDLKPKEDNDSVVKPSTSNGQVDLS-DDNVMIIETETPSDTIKKRKM  599



>ref|XP_637463.1| sumo-activating enzyme subunit 2 [Dictyostelium discoideum AX4]
 sp|Q54L40.1|SAE2_DICDI RecName: Full=SUMO-activating enzyme subunit 2; AltName: Full=Ubiquitin-like 
1-activating enzyme E1B [Dictyostelium discoideum]
 gb|EAL63957.1| sumo-activating enzyme subunit 2 [Dictyostelium discoideum AX4]
Length=661

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  829  EP-NKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGD-DL  656
            EP N  C+VC+ + +   +NT    +  F++ ++K  L +N P++  G  ++YE GD DL
Sbjct  430  EPQNPKCFVCNRSFIICRLNTEKTTISQFIDHVLKKSLAVNEPILTVGNDIIYEGGDQDL  489

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEE  497
             ++ +E  +    K L   R  +   T + VED  Q+    I I+H  +FDE+
Sbjct  490  SKEEIEQRSKIEKKTLATHR--LTNDTSLVVEDYNQDFQITITIQHTTDFDED  540



>gb|EPT26082.1| ThiF family protein [Toxoplasma gondii ME49]
 gb|ESS34878.1| ThiF family protein [Toxoplasma gondii VEG]
Length=845

 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 77/163 (47%), Gaps = 9/163 (6%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSA-KLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E+ + SA  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  602  PRASCFLCQQQTVTIELASLSAWNIETFVERIVKGELGLAHPYLDSESRNLYDV-DEVDE  660

Query  649  K----MVENYAANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPD  485
            +      E  A+ L + L      +  GTI+   D  + +  CN+ I  R E  E+   D
Sbjct  661  QREDGTGEGEASPLKQPLTNF--GIVSGTILTATDFSRGDFQCNLLILERSELGEKNKDD  718

Query  484  GMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  356
              +        AS    K T  +    +TA Q     A   +D
Sbjct  719  PHIFRLVRESGASSTAEKETQVSQGDKATAEQKTQEPAARKED  761



>gb|KFG44348.1| ThiF family protein [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=845

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 77/163 (47%), Gaps = 9/163 (6%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSA-KLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E+ + SA  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  602  PRASCFLCQQQTVTIELASLSAWNIETFVERIVKGELGLAHPYLDSESRNLYDV-DEVDE  660

Query  649  K----MVENYAANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPD  485
            +      E  A+ L + L      +  GTI+   D  + +  CN+ I  R E  E+   D
Sbjct  661  QREDGTGEGEASPLKQPLTNF--GIVSGTILTATDFSRGDFQCNLLILERSELGEKNKDD  718

Query  484  GMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  356
              +        AS    K T  +    +TA Q     A   +D
Sbjct  719  PHIFRLVRESGASSTAEKETQVSQGDKATAEQKTQEPAARKED  761



>gb|KFG28675.1| ThiF family protein [Toxoplasma gondii p89]
Length=845

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 77/163 (47%), Gaps = 9/163 (6%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSA-KLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E+ + SA  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  602  PRASCFLCQQQTVTIELASLSAWNIETFVERIVKGELGLAHPYLDSESRNLYDV-DEVDE  660

Query  649  K----MVENYAANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPD  485
            +      E  A+ L + L      +  GTI+   D  + +  CN+ I  R E  E+   D
Sbjct  661  QREDGTGEGEASPLKQPLTNF--GIVSGTILTATDFSRGDFQCNLLILERSELGEKNKDD  718

Query  484  GMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  356
              +        AS    K T  +    +TA Q     A   +D
Sbjct  719  PHIFRLVRESGASSTAEKETQVSQGDKATAEQKTQEPAARKED  761



>gb|EPR61099.1| ThiF family protein [Toxoplasma gondii GT1]
Length=845

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 77/163 (47%), Gaps = 9/163 (6%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSA-KLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E+ + SA  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  602  PRASCFLCQQQTVTIELASLSAWNIETFVERIVKGELGLAHPYLDSESRNLYDV-DEVDE  660

Query  649  K----MVENYAANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPD  485
            +      E  A+ L + L      +  GTI+   D  + +  CN+ I  R E  E+   D
Sbjct  661  QREDGTGEGEASPLKQPLTNF--GIVSGTILTATDFSRGDFQCNLLILERSELGEKNKDD  718

Query  484  GMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  356
              +        AS    K T  +    +TA Q     A   +D
Sbjct  719  PHIFRLVRESGASSTAEKETQVSQGDKATAEQKTQEPAARKED  761



>ref|XP_002364392.1| ubiquitin-activating enzyme, putative [Toxoplasma gondii ME49]
Length=730

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 77/163 (47%), Gaps = 9/163 (6%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSA-KLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E+ + SA  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  487  PRASCFLCQQQTVTIELASLSAWNIETFVERIVKGELGLAHPYLDSESRNLYDV-DEVDE  545

Query  649  K----MVENYAANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPD  485
            +      E  A+ L + L      +  GTI+   D  + +  CN+ I  R E  E+   D
Sbjct  546  QREDGTGEGEASPLKQPLTNF--GIVSGTILTATDFSRGDFQCNLLILERSELGEKNKDD  603

Query  484  GMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDD  356
              +        AS    K T  +    +TA Q     A   +D
Sbjct  604  PHIFRLVRESGASSTAEKETQVSQGDKATAEQKTQEPAARKED  646



>ref|XP_002131488.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Ciona intestinalis]
Length=630

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 84/184 (46%), Gaps = 21/184 (11%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP--LIMNGAALLYEVGDDL  656
            P + CYVC+E P +TL++NT +     F +KI+K+ LGM  P   I++G   +  +  + 
Sbjct  431  PKRGCYVCAEKPEITLKLNTKTLTCEQFRDKILKSHLGMLAPDVEILDGRGTIL-ISSEE  489

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
            DE+  ++    LD         +  G+ +  +D  Q     +NI H     EE  PD M+
Sbjct  490  DEEENQSLGQTLDSF------NITHGSRLRADDFLQNYDIVVNILH-----EENLPDDMI  538

Query  475  L--SGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL  302
               S     + +    +TT +N    ++  Q   ++  ED D    P+ +     +KRK 
Sbjct  539  FQVSETKGTIGASAEKETTPENNTEENSVVQEDKIEIIEDAD----PSASQDEIPRKRKR  594

Query  301  CDTN  290
              TN
Sbjct  595  SSTN  598



>ref|XP_005844208.1| hypothetical protein CHLNCDRAFT_27175 [Chlorella variabilis]
 gb|EFN52106.1| hypothetical protein CHLNCDRAFT_27175 [Chlorella variabilis]
Length=638

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 68/135 (50%), Gaps = 16/135 (12%)
 Frame = -3

Query  829  EPNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            EPN +C VC      L I+T+   L+  V+++   ++G  + L     + L    D +  
Sbjct  445  EPNVACMVCGTAQAELAIDTNKMTLQQLVDRVRGGQIGFKVKL----DSFL----DPITT  496

Query  649  KMVENYAANLDKVLCELRPPVNGG-----TIVNVEDLQQELTCNINIKHREEFDEEKDPD  485
            +  +++    D +L  L   + GG     +I++++D +Q     + +KHRE+++ ++ P+
Sbjct  497  RQQQHWK---DTLLRRLLAQLPGGGVVHNSILDIDDQEQCFKAQLIVKHREDWNSDQHPE  553

Query  484  GMVLSGWTPVLASEN  440
            G VLSG  P   +E 
Sbjct  554  GFVLSGGLPTAQAEQ  568



>ref|XP_005101963.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Aplysia californica]
Length=608

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (47%), Gaps = 20/162 (12%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN  CYVCS  P  T+ +N  +  +R   +KI+K  L M  P +      G  ++     
Sbjct  402  PNPKCYVCSSKPECTVVLNETTVTVRTLQDKILKGHLNMIAPDVEIDDGKGTIIISSEEG  461

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
            + +E        N DK L E    +   T +  +D  Q  +  +N+ H E+ D+EK+ + 
Sbjct  462  ETEE--------NNDKFLSEF--AIGHNTRLKCDDFLQNYSLIVNVAHVEKLDDEKEFEV  511

Query  481  MV-LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDD  359
            +  LS + P    + + +   DNG ++ T S TAP   +EDD
Sbjct  512  VGDLSEFCP----KEDGEGASDNGHANETVSSTAPASKDEDD  549



>emb|CBY21846.1| unnamed protein product [Oikopleura dioica]
Length=593

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 24/125 (19%)
 Frame = -3

Query  829  EPNKSCYVCSETP-LTLEINTHSAK-------------LRDFVEKIVKAKLGMNLPLI-M  695
            E N +C VC+E P +T+ ++T   K             L+D  EKI + KL MN P +  
Sbjct  408  ERNPTCVVCAEKPTVTIMLDTKKVKDISNIFIQLKKFTLKDLREKICQKKLSMNEPDVEK  467

Query  694  NGAALLYEVGDDLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR  515
            +G  +L    DDLDE +       L K L E+   V  G+I+  ED QQE    I+++H 
Sbjct  468  DGNIILSSDEDDLDEVL-------LAKTLSEV--GVGHGSILTAEDFQQEFKLTIHVEHV  518

Query  514  EEFDE  500
            EE  E
Sbjct  519  EELPE  523



>ref|XP_392715.4| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Apis 
mellifera]
Length=666

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 99/204 (49%), Gaps = 27/204 (13%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM---NGAALLYEVGDD  659
            PN  CYVC+  P + L I+T    +++ +E ++K++L M  P +M    G+ ++     +
Sbjct  438  PNPKCYVCAPMPEVILAIDTSKTTIKELLEIVLKSRLNMIAPDVMIDGTGSVVISSEEGE  497

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKD-PDG  482
             +E        N DK+L EL   +  GTI+ V+D QQ  +  I I +RE    + D PD 
Sbjct  498  TEE--------NNDKLLEELG--IKDGTILKVDDFQQNYSLTITIIYRERPSLKGDSPDF  547

Query  481  MVLSGWTPVLASENNN--KTTHDNGASSSTA-------SQTAPLDANEDDDLEILPTGTA  329
            ++L+    +   E+N+  K +  NG   S+        ++T  LD  +      L     
Sbjct  548  LILADEKDLKPKEDNDLIKPSTSNGQVESSKENVMIVETETVSLDTVKKRKTNSLE--EI  605

Query  328  ISPGKKRKLCDTNPDRKVEELDDD  257
            +SP KKRK+   N D  +  +++D
Sbjct  606  VSP-KKRKMEVHNVDDDISIIEND  628



>ref|XP_006564548.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Apis 
mellifera]
Length=671

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 99/204 (49%), Gaps = 27/204 (13%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM---NGAALLYEVGDD  659
            PN  CYVC+  P + L I+T    +++ +E ++K++L M  P +M    G+ ++     +
Sbjct  443  PNPKCYVCAPMPEVILAIDTSKTTIKELLEIVLKSRLNMIAPDVMIDGTGSVVISSEEGE  502

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKD-PDG  482
             +E        N DK+L EL   +  GTI+ V+D QQ  +  I I +RE    + D PD 
Sbjct  503  TEE--------NNDKLLEELG--IKDGTILKVDDFQQNYSLTITIIYRERPSLKGDSPDF  552

Query  481  MVLSGWTPVLASENNN--KTTHDNGASSSTA-------SQTAPLDANEDDDLEILPTGTA  329
            ++L+    +   E+N+  K +  NG   S+        ++T  LD  +      L     
Sbjct  553  LILADEKDLKPKEDNDLIKPSTSNGQVESSKENVMIVETETVSLDTVKKRKTNSLE--EI  610

Query  328  ISPGKKRKLCDTNPDRKVEELDDD  257
            +SP KKRK+   N D  +  +++D
Sbjct  611  VSP-KKRKMEVHNVDDDISIIEND  633



>ref|XP_003698305.1| PREDICTED: LOW QUALITY PROTEIN: SUMO-activating enzyme subunit 
2-like [Apis florea]
Length=666

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 15/124 (12%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM---NGAALLYEVGDD  659
            PN  CYVC+ TP   L I+T    +++ +E ++K +L M  P +M    G+ ++     +
Sbjct  438  PNPKCYVCAPTPEAILAIDTSKTTIKELLEIVLKNRLNMIAPDVMIDGTGSVVISSEEGE  497

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKD-PDG  482
             +E        N DK+L EL   +  GTI+ V+D QQ  +  I I +RE    + D PD 
Sbjct  498  TEE--------NNDKLLEELG--IKDGTILKVDDFQQNYSLTITIVYRERPSLKGDSPDF  547

Query  481  MVLS  470
            ++L+
Sbjct  548  LILA  551



>gb|KDD77029.1| ThiF family protein [Helicosporidium sp. ATCC 50920]
Length=660

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 3/111 (3%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDEK  647
            PN +C VC +  L L ++     + D VEK++K++L M  P I      LYE G+ L+  
Sbjct  457  PNPTCAVCGKAMLELRVDPDVFTVGDLVEKVLKSQLAMLSPTI-EAEDFLYEEGEGLEAD  515

Query  646  MVENYAANLDKVLCELRPPVNGG-TIVNVEDLQQELTCNINIKHREEFDEE  497
             V  Y   L K L E+ P  N    ++ + D QQ+L+  + +   E F  E
Sbjct  516  EVAFYKLCLRKTLREV-PGTNAAYRVLELSDQQQQLSARMYVHLEEGFRSE  565



>ref|XP_001638517.1| predicted protein [Nematostella vectensis]
 gb|EDO46454.1| predicted protein [Nematostella vectensis]
Length=624

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 94/215 (44%), Gaps = 44/215 (20%)
 Frame = -3

Query  829  EPNKSCYVCSETP--LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDL  656
            EPN  CYVC+  P  +T+ +NT +  ++   EK++K + GM  P +        E+ D  
Sbjct  437  EPNPKCYVCASKPEVVTVFVNTETMTIQALEEKVLKERFGMIAPDV--------EIDDGK  488

Query  655  DEKMVENYAA----NLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHR------EEF  506
               ++ +       NL K L E    +  G+ +  +D  Q     INIKHR      +EF
Sbjct  489  GTIIISSEQGETEDNLPKALAEFN--IINGSRLKADDFLQNYELVINIKHRTDLETDQEF  546

Query  505  DEEKDPDGMVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAI  326
            + E D       G  PV  S  N      NG    TASQ         D+L ++   T  
Sbjct  547  EVEGDIPEPGSPGPAPVEPS--NEPGLPSNG---DTASQ---------DELMVVENAT--  590

Query  325  SPGKKRKLCDTN---PD--RKVEELDDDGDGFVTL  236
             P +KRKL + +   P+  ++V    DD DG + L
Sbjct  591  -PSRKRKLDENSRIAPEQTKRVRVEPDDDDGVIVL  624



>ref|XP_009943706.1| PREDICTED: SUMO-activating enzyme subunit 2 [Opisthocomus hoazin]
Length=596

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 96/226 (42%), Gaps = 50/226 (22%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN SCYVC+  P +T+++N H   +    +KIVK K  M  P +      G  L+     
Sbjct  393  PNPSCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIDDGKGTILISS---  449

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
              +E   E   AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD + 
Sbjct  450  --EEGETE---ANNHRKLSDF--GIRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEF  500

Query  481  MVLS------GWTPVLASENNNKTTHDNGASSSTASQTAP--------------LDANED  362
             V+       G  P   +  N     D+GA  ST+  TAP                +N D
Sbjct  501  EVVGDAPEKVGPKPSEPTAKNITNGSDDGAQPSTS--TAPDQDDLLIVDSDDEGTSSNVD  558

Query  361  DDLEILPTGTAISPGKKRKLCD---TNPDRKVEELDDDGDGFVTLD  233
            DD+E        +  +KRKL D    +  R   EL ++ D  + LD
Sbjct  559  DDME--------NKSRKRKLEDKERVSTKRVRTELTEEQDEIIALD  596



>gb|KFR04614.1| SUMO-activating enzyme subunit 2, partial [Opisthocomus hoazin]
Length=592

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 96/226 (42%), Gaps = 50/226 (22%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN SCYVC+  P +T+++N H   +    +KIVK K  M  P +      G  L+     
Sbjct  389  PNPSCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIDDGKGTILISS---  445

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
              +E   E   AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD + 
Sbjct  446  --EEGETE---ANNHRKLSDF--GIRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEF  496

Query  481  MVLS------GWTPVLASENNNKTTHDNGASSSTASQTAP--------------LDANED  362
             V+       G  P   +  N     D+GA  ST+  TAP                +N D
Sbjct  497  EVVGDAPEKVGPKPSEPTAKNITNGSDDGAQPSTS--TAPDQDDLLIVDSDDEGTSSNVD  554

Query  361  DDLEILPTGTAISPGKKRKLCD---TNPDRKVEELDDDGDGFVTLD  233
            DD+E        +  +KRKL D    +  R   EL ++ D  + LD
Sbjct  555  DDME--------NKSRKRKLEDKERVSTKRVRTELTEEQDEIIALD  592



>ref|XP_011054419.1| PREDICTED: SUMO-activating enzyme subunit 2 [Acromyrmex echinatior]
 gb|EGI65454.1| SUMO-activating enzyme subunit 2 [Acromyrmex echinatior]
Length=654

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 15/124 (12%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM---NGAALLYEVGDD  659
            PN  CYVC+ TP  TL ++T S  +++  E ++K +L M  P +M    G+ ++      
Sbjct  438  PNPQCYVCAPTPQATLAVDTSSMTIKELEELVLKNRLNMIAPDVMIDGTGSVVISS----  493

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKD-PDG  482
             +E   E    N DK L EL   +  GTI+ V+D QQ  +  + I +RE+ D + D P  
Sbjct  494  -EEGETE---GNNDKKLEEL--GIRNGTILKVDDFQQNYSLTVYIVYREKPDPKDDSPQF  547

Query  481  MVLS  470
            ++L+
Sbjct  548  LILA  551



>ref|XP_007440000.1| PREDICTED: SUMO-activating enzyme subunit 2 [Python bivittatus]
Length=541

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 94/217 (43%), Gaps = 33/217 (15%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP--LIMNGAALLYEVGDDL  656
            PN +CYVC+  P +T+++N H   +    +KIVK K  M  P   I +G   +    ++ 
Sbjct  339  PNPNCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFNMVAPDVQIEDGKGTILISSEEG  398

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEF--DEEKDPDG  482
            + +      AN  K L E    +  GT +  +D  Q+ T  IN+ H E+   D E +  G
Sbjct  399  ETE------ANNHKKLSEF--GIRNGTRLQADDFLQDYTLLINVLHSEDLAKDLEFEVVG  450

Query  481  MVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGK----  314
              + G         N     D+GA  ST++      A ++DD ++L   T   P K    
Sbjct  451  DEIIGPKSSEQPTRNITNGSDDGAQPSTST------AQDEDDEDVLIVETEEDPSKNADD  504

Query  313  ------KRKLCD---TNPDRKVEEL-DDDGDGFVTLD  233
                  KRKL D   T   R   EL DD  D  + LD
Sbjct  505  TEAKNRKRKLDDKEYTGAKRMRSELPDDKQDDVIALD  541



>ref|XP_008561176.1| PREDICTED: SUMO-activating enzyme subunit 2 [Microplitis demolitor]
Length=669

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 18/167 (11%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMN---GAALLYEVGDD  659
            PN  CYVC+ TP   L I+T    + +  + ++K +L M  P +M    G  ++     +
Sbjct  438  PNPKCYVCAPTPTAVLAIDTAKMTIAELNDLVLKDRLNMIAPDVMIDGLGRIIISSEEGE  497

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFD-EEKDPDG  482
             +E        N DK+L EL   V  G+I+ V+D QQ  +  +NI HR++     + PD 
Sbjct  498  TEE--------NNDKILEELG--VKNGSILKVDDFQQNYSLTVNIVHRDKPTVRGESPDF  547

Query  481  MVLSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILP  341
            +V++     L  +   +T  DN   S++  +    D  ++D LEI+P
Sbjct  548  LVVADEQD-LKPKEEEQTKKDNQTPSTSNGKIT--DVEDNDLLEIVP  591



>ref|XP_006613941.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Apis dorsata]
Length=666

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (52%), Gaps = 15/124 (12%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM---NGAALLYEVGDD  659
            PN  CYVC+  P   L I+T    +++ +E ++K +L M  P +M    G+ ++     +
Sbjct  438  PNPKCYVCAPMPEAILAIDTSKTTIKELLEIVLKNRLNMIAPDVMIDGTGSVVISSEEGE  497

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKD-PDG  482
             +E        N DK+L EL   +  GTI+ V+D QQ  +  I I +RE    + D PD 
Sbjct  498  TEE--------NNDKLLEELG--IKDGTILKVDDFQQNYSLTITIIYRERPSLKGDSPDF  547

Query  481  MVLS  470
            ++L+
Sbjct  548  LILA  551



>ref|XP_004365946.1| SUMO-activating enzyme subunit 2 [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE89639.1| SUMO-activating enzyme subunit 2 [Capsaspora owczarzaki ATCC 
30864]
Length=654

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (51%), Gaps = 10/112 (9%)
 Frame = -3

Query  829  EPNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLD  653
            +PN +C+VC+  P +T+ +NT++  L  F E ++K +LGM  P +M G  +L  +  +  
Sbjct  466  KPNPNCHVCAAKPRVTVHVNTNTMTLGQFDEVVLKGRLGMIAPDMMEGNRIL--LSSEPG  523

Query  652  EKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEE  497
            E  + N      K L  L   +   T V VED  Q     I + HRE F+ +
Sbjct  524  ETDINN-----PKALSSL--GIVHDTSVFVEDFHQSYELTIRVLHREAFEAD  568



>ref|XP_006641254.1| PREDICTED: LOW QUALITY PROTEIN: SUMO-activating enzyme subunit 
2-like [Lepisosteus oculatus]
Length=650

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 92/195 (47%), Gaps = 37/195 (19%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP--LIMNGAALLYEVGDDL  656
            PN +CYVC+  P +T++++ H   +    +KI+K K GM  P   I +G   +    ++ 
Sbjct  444  PNANCYVCASKPEVTVKLSVHKVTVLSLQDKILKEKFGMVAPDVQIEDGKGTILISSEEG  503

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
            + +       N +K L E    +  G+ + V+D  QE T  +NI H E  D EKD +  V
Sbjct  504  ETE------GNNNKCLSEFG--IRNGSRLQVDDFLQEYTLLVNILHCE--DLEKDVEFEV  553

Query  475  LSGWTP-----VLASE--NNNKTTHDNGASSSTASQTAPLDANEDDDLEIL-----PTGT  332
            + G TP       A+E  NN     D+GA  ST+       A E DD+ I+     P+ +
Sbjct  554  V-GDTPEKPPQSSAAEPGNNMANGSDDGAQPSTSK------APEQDDVLIVDSDEEPSSS  606

Query  331  AI-----SPGKKRKL  302
            A        G KRKL
Sbjct  607  AADVHAEGGGHKRKL  621



>ref|XP_012058636.1| PREDICTED: SUMO-activating enzyme subunit 2 [Atta cephalotes]
Length=655

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 66/125 (53%), Gaps = 16/125 (13%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM---NGAALLYEVGDD  659
            PN  CYVC+ TP  TL ++T S  +++  E ++K +L M  P +M    G+ ++      
Sbjct  438  PNPQCYVCAPTPQATLAVDTSSMTIKELEELVLKNRLNMIAPDVMIDGTGSVVISS----  493

Query  658  LDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFD--EEKDPD  485
             +E   E    N DK L EL   +  GTI+ V+D QQ  +  + I +RE+ D  ++  P 
Sbjct  494  -EEGETE---GNNDKKLEEL--GIRNGTILKVDDFQQNYSLTVYIVYREKPDPKDQDSPQ  547

Query  484  GMVLS  470
             ++L+
Sbjct  548  FLILA  552



>ref|XP_003885142.1| AFR138Wp, related [Neospora caninum Liverpool]
 emb|CBZ55114.1| AFR138Wp, related [Neospora caninum Liverpool]
Length=851

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/215 (24%), Positives = 94/215 (44%), Gaps = 31/215 (14%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLE-INTHSAKLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E I+  +  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  609  PKASCFLCQQQTVTIELISLKAWNIETFVERIVKGELGLAHPYVDSESRNLYDV-DEVDE  667

Query  649  KMV---ENYAANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPDG  482
            +     E+ A+ L + L      +  G+I+   D  + +  CN+ +  R E  E+   D 
Sbjct  668  QRQNGEEDDASPLKQPLANF--GIVSGSILTATDFSRGDFQCNLLLLERPELGEKDKDDP  725

Query  481  MVL-------SGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAIS  323
                      + WT    +E   +    +GA +   +Q  P    +   +++   G    
Sbjct  726  HTFRVVRESGASWT----AEKETEALPADGAKTHPETQEEPAREADQGGIDVAGHGGGNG  781

Query  322  PGKK------------RKLCDTNPDRKVEELDDDG  254
              K+            R+      D ++  LDDDG
Sbjct  782  RAKRPRNETREAASSGRQHLGNATDAEIVVLDDDG  816



>ref|XP_008885854.1| ThiF family protein [Hammondia hammondi]
 gb|KEP63560.1| ThiF family protein [Hammondia hammondi]
Length=846

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 71/143 (50%), Gaps = 14/143 (10%)
 Frame = -3

Query  826  PNKSCYVCSETPLTLEINTHSA-KLRDFVEKIVKAKLGMNLPLIMNGAALLYEVGDDLDE  650
            P  SC++C +  +T+E+ + SA  +  FVE+IVK +LG+  P + + +  LY+V D++DE
Sbjct  601  PKASCFLCQQQTVTIELASLSAWNIETFVERIVKGELGLAHPYLDSESRNLYDV-DEVDE  659

Query  649  KMVENY----AANLDKVLCELRPPVNGGTIVNVEDLQQ-ELTCNINIKHREEFDEEKDPD  485
            +  +      A+ L + L      +  GTI+   D  + +  CN+ I  R E   +   D
Sbjct  660  QRKDGTDKGEASPLKQPLANF--GIVSGTILTATDFSRGDFQCNLLILERSELGGKNKDD  717

Query  484  GMVLSGWTPVLASENNNKTTHDN  416
              V       L  E+   +T +N
Sbjct  718  PHVFR-----LVRESGAPSTAEN  735



>ref|NP_001135121.1| SUMO-activating enzyme subunit 2 [Salmo salar]
 gb|ACI33764.1| SUMO-activating enzyme subunit 2 [Salmo salar]
 gb|ACI34122.1| SUMO-activating enzyme subunit 2 [Salmo salar]
Length=644

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 91/197 (46%), Gaps = 32/197 (16%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP--LIMNGAALLYEVGDDL  656
            P+ +CYVC+  P +T+++N H   +    +KI+K K GM  P   I +G   +    ++ 
Sbjct  432  PSANCYVCASKPEVTVKLNVHKTLVLALQDKILKEKFGMVAPDVQIEDGKGTILISSEEG  491

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
            + +      AN  K L +    +  G+ + V+D  Q+ T  +N+ H E  D EKD +  V
Sbjct  492  ETE------ANNSKFLSDFG--IRHGSRLQVDDFLQDYTLLVNVMHCE--DLEKDVEFEV  541

Query  475  LS-----GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEIL------PTGTA  329
            +        TP  A E+ N    +  ++  + S  AP    E DD+ I+      P+ + 
Sbjct  542  VGDAPDKAPTPPSAQEDKNVANGNKDSAEPSTSSKAP---AEQDDVLIVDSDEEEPSSST  598

Query  328  I-----SPGKKRKLCDT  293
            +     S G KRKL D 
Sbjct  599  MDVRMESGGHKRKLHDA  615



>gb|KFM09912.1| SUMO-activating enzyme subunit 2, partial [Aptenodytes forsteri]
Length=592

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 96/226 (42%), Gaps = 50/226 (22%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN +CYVC+  P +T+++N H   +    +KIVK K  M  P +      G  L+     
Sbjct  389  PNPNCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIDDGKGTILISS---  445

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
              +E   E   AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD + 
Sbjct  446  --EEGETE---ANNHRKLSDF--GIRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEF  496

Query  481  MVLS------GWTPVLASENNNKTTHDNGASSSTASQTAP--------------LDANED  362
             V+       G  P   +  N     D+GA  ST+  TAP                +N D
Sbjct  497  EVVGDTPEKVGPKPSEPTSKNITNGSDDGAQPSTS--TAPDQDDLLIVDSEDEGTSSNVD  554

Query  361  DDLEILPTGTAISPGKKRKLCDT---NPDRKVEELDDDGDGFVTLD  233
            DD+E        +  +KRKL DT   +  R   E  ++ D  + LD
Sbjct  555  DDME--------NKSRKRKLEDTECVSTKRVRTEQTEEQDEIIALD  592



>ref|XP_009281145.1| PREDICTED: SUMO-activating enzyme subunit 2 [Aptenodytes forsteri]
Length=596

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 96/226 (42%), Gaps = 50/226 (22%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN +CYVC+  P +T+++N H   +    +KIVK K  M  P +      G  L+     
Sbjct  393  PNPNCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIDDGKGTILISS---  449

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
              +E   E   AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD + 
Sbjct  450  --EEGETE---ANNHRKLSDF--GIRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEF  500

Query  481  MVLS------GWTPVLASENNNKTTHDNGASSSTASQTAP--------------LDANED  362
             V+       G  P   +  N     D+GA  ST+  TAP                +N D
Sbjct  501  EVVGDTPEKVGPKPSEPTSKNITNGSDDGAQPSTS--TAPDQDDLLIVDSEDEGTSSNVD  558

Query  361  DDLEILPTGTAISPGKKRKLCDT---NPDRKVEELDDDGDGFVTLD  233
            DD+E        +  +KRKL DT   +  R   E  ++ D  + LD
Sbjct  559  DDME--------NKSRKRKLEDTECVSTKRVRTEQTEEQDEIIALD  596



>ref|XP_010141224.1| PREDICTED: SUMO-activating enzyme subunit 2, partial [Buceros 
rhinoceros silvestris]
 gb|KFO93977.1| SUMO-activating enzyme subunit 2, partial [Buceros rhinoceros 
silvestris]
Length=591

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 96/220 (44%), Gaps = 39/220 (18%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN +CYVC+  P +T+++N H   +    +KIVK K  M  P +      G  L+     
Sbjct  389  PNPNCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIDDGKGTILISS---  445

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
              +E   E   AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD + 
Sbjct  446  --EEGETE---ANNHRKLSDFG--IRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEF  496

Query  481  MVLS------GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAIS-  323
             V+       G  P   +  N     D+GA  ST+  TAP   ++DD L I   G   S 
Sbjct  497  EVVGDSPEKVGPKPSEPTPKNITNGSDDGAQPSTS--TAP---DQDDVLIIDSDGEGTSG  551

Query  322  -------PGKKRKLCD---TNPDRKVEELDDDGDGFVTLD  233
                     +KRKL D   T+  R   E  ++ D  + LD
Sbjct  552  NADDVENKSRKRKLEDKECTSTKRVCTEQVEEQDEIIALD  591



>ref|XP_005229439.1| PREDICTED: SUMO-activating enzyme subunit 2 [Falco peregrinus]
 ref|XP_005446200.1| PREDICTED: SUMO-activating enzyme subunit 2 [Falco cherrug]
Length=598

 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 94/226 (42%), Gaps = 50/226 (22%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLPLIM----NGAALLYEVGD  662
            PN +CYVC+  P +T+++N H   +    +KIVK K  M  P +      G  L+     
Sbjct  395  PNPNCYVCASKPEVTVKLNVHKVTVLTLQDKIVKEKFAMVAPDVQIDDGKGTILISS---  451

Query  661  DLDEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDG  482
              +E   E   AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD + 
Sbjct  452  --EEGETE---ANNHRKLSDF--GIRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEF  502

Query  481  MVLS------GWTPVLASENNNKTTHDNGASSSTASQTAP--------------LDANED  362
             V+       G  P   +  N     D+GA  ST+  TAP                +N D
Sbjct  503  EVVGDSPEKVGPKPSEPASKNITNGSDDGAQPSTS--TAPDQDDLLIVDSEDEGTSSNVD  560

Query  361  DDLEILPTGTAISPGKKRKLCD---TNPDRKVEELDDDGDGFVTLD  233
            DD+EI          +KRKL D       R   E  ++ D  + LD
Sbjct  561  DDMEI--------KSRKRKLEDKECVGTKRVRTEQTEEQDEIIALD  598



>emb|CDQ59515.1| unnamed protein product [Oncorhynchus mykiss]
Length=644

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 91/197 (46%), Gaps = 32/197 (16%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP--LIMNGAALLYEVGDDL  656
            P+ +CYVC+  P +T+++N H   +    +KI+K K GM  P   I +G   +    ++ 
Sbjct  432  PSANCYVCASKPEVTVKLNVHKTLVLALQDKILKEKFGMVAPDVQIEDGKGTILISSEEG  491

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
            + +      AN  K L +    +  G+ + V+D  Q+ T  +N+ H E  D EKD +  V
Sbjct  492  ETE------ANNSKFLSDFG--IRHGSRLQVDDFLQDYTLLVNVIHCE--DLEKDVEFEV  541

Query  475  LS-----GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEIL------PTGTA  329
            +        TP  A E+ N    +  ++  + S  AP    E DD+ I+      P+ + 
Sbjct  542  VGDAPDKAPTPPSAQEDKNVANGNKDSAEPSTSSKAP---AEQDDVLIVDSDEEEPSSST  598

Query  328  I-----SPGKKRKLCDT  293
            +     S G KRKL D 
Sbjct  599  MDVRMESGGHKRKLHDA  615



>ref|XP_004176084.1| PREDICTED: SUMO-activating enzyme subunit 2 [Taeniopygia guttata]
Length=721

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 63/226 (28%), Positives = 103/226 (46%), Gaps = 38/226 (17%)
 Frame = -3

Query  826  PNKSCYVCSETP-LTLEINTHSAKLRDFVEKIVKAKLGMNLP--LIMNGAALLYEVGDDL  656
            PN +CYVC+  P +T+++NTH   +    +KI+K K  M  P   I +G   +    ++ 
Sbjct  482  PNPNCYVCASKPEVTVKLNTHKVTVLTLQDKILKEKFAMVAPDVQIEDGKGTILISSEEG  541

Query  655  DEKMVENYAANLDKVLCELRPPVNGGTIVNVEDLQQELTCNINIKHREEFDEEKDPDGMV  476
            + +      AN  + L +    +  GT +  +D  Q+ T  IN+ H E  D EKD +  V
Sbjct  542  ETE------ANNHRKLSDF--GIRNGTRLQADDFLQDYTLLINVLHSE--DLEKDVEFEV  591

Query  475  LS------GWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPT---GTAI-  326
            +       G  P   +  N     D+GA  ST+  TAP    E +D+ I+ +   GT+  
Sbjct  592  VGDTPERIGPKPSEPTSRNISNGSDDGAQPSTS--TAP----EQEDVVIVDSEDEGTSSN  645

Query  325  -----SPGKKRKL---CD-TNPDRKVEELDDDGDGFVTLDGNSDGS  215
                 S  +KRKL   C+     R   E + D D  + ++   +G+
Sbjct  646  AEDVESRSRKRKLEKGCECAGAKRSRAEQEQDQDDLMIVESEDEGA  691



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1793589148520