BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8562

Length=863
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091567.1|  PREDICTED: eukaryotic translation initiation...    201   2e-56   Sesamum indicum [beniseed]
emb|CDP10861.1|  unnamed protein product                                201   2e-56   Coffea canephora [robusta coffee]
gb|KDP44253.1|  hypothetical protein JCGZ_05720                         196   5e-55   Jatropha curcas
ref|XP_012065068.1|  PREDICTED: eukaryotic translation initiation...    196   1e-54   Jatropha curcas
ref|XP_011037397.1|  PREDICTED: eukaryotic translation initiation...    194   7e-54   Populus euphratica
ref|XP_009763010.1|  PREDICTED: eukaryotic translation initiation...    194   1e-53   Nicotiana sylvestris
ref|XP_004244753.1|  PREDICTED: eukaryotic translation initiation...    194   1e-53   Solanum lycopersicum
ref|XP_009763011.1|  PREDICTED: eukaryotic translation initiation...    193   1e-53   Nicotiana sylvestris
ref|XP_009763012.1|  PREDICTED: eukaryotic translation initiation...    193   1e-53   Nicotiana sylvestris
ref|XP_007222982.1|  hypothetical protein PRUPE_ppa004316mg             192   2e-53   Prunus persica
ref|XP_006376433.1|  hypothetical protein POPTR_0013s13000g             192   3e-53   
ref|XP_010912787.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    192   3e-53   
gb|KDO64034.1|  hypothetical protein CISIN_1g013871mg                   187   4e-53   Citrus sinensis [apfelsine]
ref|XP_002530577.1|  Eukaryotic translation initiation factor 3 s...    193   5e-53   
ref|XP_007050960.1|  Eukaryotic translation initiation factor eIF...    191   6e-53   
ref|XP_006355778.1|  PREDICTED: eukaryotic translation initiation...    191   7e-53   Solanum tuberosum [potatoes]
gb|AFK44772.1|  unknown                                                 183   7e-53   Lotus japonicus
ref|XP_002276161.1|  PREDICTED: eukaryotic translation initiation...    191   8e-53   Vitis vinifera
ref|XP_008339356.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    191   9e-53   
ref|XP_010268199.1|  PREDICTED: eukaryotic translation initiation...    188   1e-52   Nelumbo nucifera [Indian lotus]
emb|CAN83983.1|  hypothetical protein VITISV_001098                     191   1e-52   Vitis vinifera
gb|KDO64032.1|  hypothetical protein CISIN_1g013871mg                   188   3e-52   Citrus sinensis [apfelsine]
ref|XP_010268198.1|  PREDICTED: eukaryotic translation initiation...    189   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008222503.1|  PREDICTED: eukaryotic translation initiation...    189   4e-52   Prunus mume [ume]
ref|XP_007050959.1|  Eukaryotic translation initiation factor eIF...    190   4e-52   
ref|XP_010094120.1|  hypothetical protein L484_018138                   187   1e-51   
ref|XP_006478620.1|  PREDICTED: eukaryotic translation initiation...    187   2e-51   Citrus sinensis [apfelsine]
ref|XP_006442822.1|  hypothetical protein CICLE_v10019752mg             187   2e-51   Citrus clementina [clementine]
ref|XP_009758480.1|  PREDICTED: eukaryotic translation initiation...    178   3e-51   Nicotiana sylvestris
gb|EYU40971.1|  hypothetical protein MIMGU_mgv1a005360mg                186   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_009615607.1|  PREDICTED: eukaryotic translation initiation...    187   3e-51   Nicotiana tomentosiformis
ref|XP_006442821.1|  hypothetical protein CICLE_v10019752mg             186   9e-51   
ref|XP_008454042.1|  PREDICTED: eukaryotic translation initiation...    183   7e-50   Cucumis melo [Oriental melon]
ref|XP_011653038.1|  PREDICTED: eukaryotic translation initiation...    183   8e-50   Cucumis sativus [cucumbers]
ref|XP_004309726.1|  PREDICTED: eukaryotic translation initiation...    182   1e-49   Fragaria vesca subsp. vesca
ref|XP_004505162.1|  PREDICTED: eukaryotic translation initiation...    181   3e-49   Cicer arietinum [garbanzo]
ref|XP_008791788.1|  PREDICTED: eukaryotic translation initiation...    181   4e-49   
gb|AFK44469.1|  unknown                                                 181   4e-49   Medicago truncatula
ref|XP_003608061.1|  Eukaryotic translation initiation factor 2A        181   4e-49   Medicago truncatula
ref|XP_003608062.1|  Eukaryotic translation initiation factor 2A        181   5e-49   
ref|XP_008791787.1|  PREDICTED: eukaryotic translation initiation...    181   7e-49   Phoenix dactylifera
ref|XP_010069250.1|  PREDICTED: eukaryotic translation initiation...    180   1e-48   Eucalyptus grandis [rose gum]
ref|XP_009758478.1|  PREDICTED: eukaryotic translation initiation...    171   2e-48   Nicotiana sylvestris
gb|KCW44729.1|  hypothetical protein EUGRSUZ_L01724                     178   2e-48   Eucalyptus grandis [rose gum]
gb|KHG22382.1|  Eukaryotic translation initiation factor 2A             179   3e-48   Gossypium arboreum [tree cotton]
ref|XP_010540054.1|  PREDICTED: eukaryotic translation initiation...    177   4e-48   
gb|KCW57543.1|  hypothetical protein EUGRSUZ_H00311                     180   4e-48   Eucalyptus grandis [rose gum]
ref|XP_010040986.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    178   4e-48   
ref|XP_010540051.1|  PREDICTED: eukaryotic translation initiation...    177   1e-47   Tarenaya hassleriana [spider flower]
gb|KJB27839.1|  hypothetical protein B456_005G012500                    176   2e-47   Gossypium raimondii
gb|KJB27838.1|  hypothetical protein B456_005G012500                    177   3e-47   Gossypium raimondii
ref|XP_003529378.1|  PREDICTED: eukaryotic translation initiation...    176   5e-47   Glycine max [soybeans]
gb|KJB27837.1|  hypothetical protein B456_005G012500                    175   6e-47   Gossypium raimondii
ref|XP_004953030.1|  PREDICTED: eukaryotic translation initiation...    174   2e-46   Setaria italica
ref|XP_003518869.1|  PREDICTED: eukaryotic translation initiation...    174   2e-46   Glycine max [soybeans]
ref|XP_006300463.1|  hypothetical protein CARUB_v10020260mg             171   7e-46   
ref|XP_007156559.1|  hypothetical protein PHAVU_003G296400g             172   8e-46   Phaseolus vulgaris [French bean]
ref|XP_002887475.1|  hypothetical protein ARALYDRAFT_476449             171   1e-45   
ref|XP_010471373.1|  PREDICTED: eukaryotic translation initiation...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009104827.1|  PREDICTED: eukaryotic translation initiation...    171   3e-45   Brassica rapa
ref|XP_006390583.1|  hypothetical protein EUTSA_v10018413mg             171   3e-45   Eutrema salsugineum [saltwater cress]
emb|CDX68240.1|  BnaA07g22800D                                          171   3e-45   
ref|XP_009406438.1|  PREDICTED: eukaryotic translation initiation...    170   4e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC73558.1|  hypothetical protein OsI_07992                          170   4e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_002452417.1|  hypothetical protein SORBIDRAFT_04g025410          169   9e-45   Sorghum bicolor [broomcorn]
ref|XP_003575319.1|  PREDICTED: eukaryotic translation initiation...    169   1e-44   Brachypodium distachyon [annual false brome]
ref|NP_001117592.1|  eukaryotic translation initiation factor eIF...    168   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565058.1|  eukaryotic translation initiation factor eIF2A-...    169   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61003.1|  unknown                                                 168   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416106.1|  PREDICTED: eukaryotic translation initiation...    168   2e-44   
ref|XP_010672409.1|  PREDICTED: eukaryotic translation initiation...    168   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010428226.1|  PREDICTED: eukaryotic translation initiation...    167   8e-44   Camelina sativa [gold-of-pleasure]
ref|NP_001159182.1|  hypothetical protein                               166   1e-43   Zea mays [maize]
ref|XP_010428227.1|  PREDICTED: eukaryotic translation initiation...    163   1e-42   
gb|AFW72228.1|  hypothetical protein ZEAMMB73_910567                    154   6e-42   
gb|EMS68178.1|  Eukaryotic translation initiation factor 2A             161   7e-42   Triticum urartu
dbj|BAD19332.1|  putative eukaryotic translation initiation facto...    160   1e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006856004.1|  PREDICTED: eukaryotic translation initiation...    160   2e-41   Amborella trichopoda
ref|XP_006647481.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    157   2e-40   
gb|EPS73953.1|  hypothetical protein M569_00803                         156   3e-40   Genlisea aurea
gb|ABR17269.1|  unknown                                                 148   6e-37   Picea sitchensis
emb|CDY11124.1|  BnaC06g23760D                                          142   8e-35   Brassica napus [oilseed rape]
gb|EMT21080.1|  hypothetical protein F775_32515                         138   9e-34   
gb|AGU42080.1|  eukaryotic translation initiation factor 2A             128   3e-32   Leymus chinensis
ref|XP_009758481.1|  PREDICTED: eukaryotic translation initiation...    120   2e-29   Nicotiana sylvestris
ref|XP_001775689.1|  predicted protein                                  117   2e-26   
gb|AET00399.2|  eukaryotic translation initiation factor eIF2A          105   8e-23   Medicago truncatula
ref|XP_009355429.1|  PREDICTED: eukaryotic translation initiation...    101   9e-23   
ref|XP_003617440.1|  Disrupted meiotic cDNA                             102   1e-21   
ref|XP_002973604.1|  hypothetical protein SELMODRAFT_149237             104   2e-21   Selaginella moellendorffii
ref|XP_004512811.1|  PREDICTED: eukaryotic translation initiation...  93.6    4e-19   
ref|XP_007050961.1|  Eukaryotic translation initiation factor eIF...  92.0    1e-17   
emb|CDY66322.1|  BnaCnng50300D                                        89.0    1e-17   Brassica napus [oilseed rape]
dbj|GAA99129.1|  hypothetical protein E5Q_05819                       90.9    6e-17   Mixia osmundae IAM 14324
gb|KEI39231.1|  hypothetical protein L969DRAFT_48767                  90.9    7e-17   Mixia osmundae IAM 14324
ref|XP_003335452.2|  hypothetical protein PGTG_17305                  90.5    1e-16   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|NP_001047375.2|  Os02g0606100                                     84.7    1e-16   
gb|KJB27836.1|  hypothetical protein B456_005G012500                  88.2    3e-16   Gossypium raimondii
ref|XP_004359476.1|  eukaryotic translation initiation factor 2A      89.0    3e-16   Cavenderia fasciculata
ref|XP_003596987.1|  ATP-dependent RNA helicase dhh1                  87.4    6e-16   
gb|KDE05020.1|  hypothetical protein MVLG_04564                       87.4    8e-16   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_002492155.1|  Eukaryotic initiation factor (eIF) 2A            87.4    9e-16   Komagataella phaffii GS115
ref|XP_002771283.1|  conserved hypothetical protein                   87.4    9e-16   Perkinsus marinus ATCC 50983
ref|XP_002775504.1|  conserved hypothetical protein                   87.4    9e-16   Perkinsus marinus ATCC 50983
ref|XP_007416969.1|  hypothetical protein MELLADRAFT_50613            87.0    1e-15   Melampsora larici-populina 98AG31
gb|KFH69922.1|  hypothetical protein MVEG_04726                       87.0    1e-15   Mortierella verticillata NRRL 6337
emb|CDR47229.1|  RHTO0S14e00848g1_1                                   87.0    1e-15   Rhodotorula toruloides
gb|EMS24744.1|  eukaryotic translation initiation factor 2A           86.7    1e-15   Rhodotorula toruloides NP11
emb|CDH60138.1|  eukaryotic translation initiation factor 2a          86.3    2e-15   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEP07516.1|  hypothetical protein                                 86.3    2e-15   Parasitella parasitica
ref|XP_666669.1|  hypothetical protein                                86.3    2e-15   Cryptosporidium hominis TU502
ref|XP_628276.1|  eIF-3A like translation initiation factor that ...  86.3    2e-15   Cryptosporidium parvum Iowa II
gb|EFA83818.1|  eukaryotic translation initiation factor 2A           85.9    2e-15   Heterostelium album PN500
emb|CDS03260.1|  hypothetical protein LRAMOSA00662                    85.9    3e-15   Lichtheimia ramosa
ref|XP_003021920.1|  hypothetical protein TRV_03950                   85.9    3e-15   Trichophyton verrucosum HKI 0517
ref|XP_003014681.1|  hypothetical protein ARB_07243                   85.5    3e-15   Trichophyton benhamiae CBS 112371
gb|EZG03550.1|  hypothetical protein H106_06998                       85.5    4e-15   Trichophyton rubrum CBS 735.88
gb|EZF70534.1|  hypothetical protein H105_07173                       85.5    4e-15   Trichophyton soudanense CBS 452.61
ref|XP_003237774.1|  eukaryotic translation initiation factor 2A      85.5    4e-15   Trichophyton rubrum CBS 118892
gb|EZF30182.1|  hypothetical protein H101_06175                       85.1    4e-15   Trichophyton interdigitale H6
ref|XP_625143.2|  PREDICTED: eukaryotic translation initiation fa...  85.1    5e-15   Apis mellifera [bee]
ref|XP_457760.2|  DEHA2C01826p                                        85.1    5e-15   Debaryomyces hansenii CBS767
ref|NP_001153415.1|  eukaryotic translation initiation factor 2A      84.7    5e-15   Nasonia vitripennis
ref|XP_002787751.1|  hypothetical protein Pmar_PMAR012528             85.1    5e-15   Perkinsus marinus ATCC 50983
ref|XP_008212385.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  84.7    5e-15   
ref|XP_003696259.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  84.7    5e-15   
gb|EZF30181.1|  hypothetical protein H101_06175                       85.1    5e-15   Trichophyton interdigitale H6
gb|EGE00539.1|  eukaryotic translation initiation factor 2A           85.1    5e-15   Trichophyton tonsurans CBS 112818
ref|XP_002141246.1|  hypothetical protein                             84.7    5e-15   Cryptosporidium muris RN66
ref|XP_001616596.1|  hypothetical protein                             85.1    6e-15   Plasmodium vivax
gb|KIL68462.1|  hypothetical protein M378DRAFT_8534                   84.7    6e-15   Amanita muscaria Koide BX008
gb|KIY91464.1|  Eukaryotic translation initiation factor 2A           80.5    6e-15   Monoraphidium neglectum
ref|XP_001840028.2|  eukaryotic translation initiation factor 2A      84.7    7e-15   Coprinopsis cinerea okayama7#130
gb|KIP07516.1|  hypothetical protein PHLGIDRAFT_105620                84.7    7e-15   Phlebiopsis gigantea 11061_1 CR5-6
emb|CDO66847.1|  eukaryotic translation initiation factor eIF2A, ...  84.7    7e-15   Plasmodium reichenowi
gb|ETW16172.1|  hypothetical protein PFFVO_05003                      84.3    8e-15   Plasmodium falciparum Vietnam Oak-Knoll (FVO)
ref|XP_001348534.1|  eIF2A                                            84.3    8e-15   Plasmodium falciparum 3D7
gb|EUR62824.1|  hypothetical protein PFBG_05429                       84.3    9e-15   Plasmodium falciparum 7G8
ref|XP_003707307.1|  PREDICTED: eukaryotic translation initiation...  84.0    9e-15   Megachile rotundata
ref|XP_638688.1|  eukaryotic translation initiation factor 2A         84.0    1e-14   Dictyostelium discoideum AX4
ref|XP_003173016.1|  eukaryotic translation initiation factor 2A      84.0    1e-14   Nannizzia gypsea CBS 118893
ref|XP_002952956.1|  eukaryotic translation initiation factor         84.0    1e-14   Volvox carteri f. nagariensis
ref|XP_009268229.1|  Eukaryotic translation initiation factor 2A      83.6    1e-14   Wallemia ichthyophaga EXF-994
ref|XP_006675197.1|  hypothetical protein BATDEDRAFT_18651            83.6    1e-14   Batrachochytrium dendrobatidis JAM81
ref|XP_006611440.1|  PREDICTED: eukaryotic translation initiation...  83.6    2e-14   Apis dorsata [rock honeybee]
gb|KJP88971.1|  hypothetical protein AK88_01263                       83.6    2e-14   Plasmodium fragile
ref|XP_006957322.1|  translation initiation factor eIF-2A             83.2    2e-14   Wallemia mellicola CBS 633.66
ref|XP_011085364.1|  PREDICTED: uncharacterized protein LOC105167374  77.8    2e-14   Sesamum indicum [beniseed]
gb|KHJ32293.1|  putative eukaryotic translation initiation factor...  83.6    2e-14   Erysiphe necator
ref|XP_003286563.1|  hypothetical protein DICPUDRAFT_31095            83.2    2e-14   Dictyostelium purpureum
gb|EXX52633.1|  hypothetical protein RirG_251340                      82.8    2e-14   Rhizophagus irregularis DAOM 197198w
gb|ESA18036.1|  hypothetical protein GLOINDRAFT_145685                82.8    2e-14   
ref|XP_001418583.1|  predicted protein                                82.8    2e-14   Ostreococcus lucimarinus CCE9901
gb|EXX52631.1|  hypothetical protein RirG_251340                      82.8    2e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_009689476.1|  uncharacterized protein TOT_010000636            82.8    2e-14   Theileria orientalis strain Shintoku
ref|XP_007875224.1|  hypothetical protein PNEG_03161                  82.8    3e-14   Pneumocystis murina B123
ref|XP_007508443.1|  eukaryotic translation initiation factor 2A      82.8    3e-14   Bathycoccus prasinos
ref|XP_005646475.1|  eIF2A-domain-containing protein                  82.8    3e-14   Coccomyxa subellipsoidea C-169
ref|XP_008816961.1|  hypothetical protein C922_03147                  82.4    3e-14   Plasmodium inui San Antonio 1
ref|XP_002843081.1|  eukaryotic translation initiation factor 2A      82.4    4e-14   Microsporum canis CBS 113480
gb|EPB92920.1|  hypothetical protein HMPREF1544_00359                 82.4    4e-14   Mucor circinelloides f. circinelloides 1006PhL
gb|KDQ59846.1|  hypothetical protein JAAARDRAFT_126728                82.4    4e-14   Jaapia argillacea MUCL 33604
emb|CCJ28474.1|  unnamed protein product                              82.0    4e-14   Pneumocystis jirovecii
ref|XP_001802462.1|  hypothetical protein SNOG_12236                  82.0    5e-14   Parastagonospora nodorum SN15
ref|XP_003080114.1|  Translation initiation factor 3, subunit b (...  81.6    5e-14   Ostreococcus tauri
ref|XP_006458732.1|  hypothetical protein AGABI2DRAFT_200574          82.0    5e-14   Agaricus bisporus var. bisporus H97
ref|XP_007326307.1|  hypothetical protein AGABI1DRAFT_69517           82.0    5e-14   Agaricus bisporus var. burnettii JB137-S8
gb|KIM87305.1|  hypothetical protein PILCRDRAFT_814794                82.0    5e-14   Piloderma croceum F 1598
gb|KIM54327.1|  hypothetical protein SCLCIDRAFT_1222132               81.6    6e-14   Scleroderma citrinum Foug A
dbj|GAM28955.1|  hypothetical protein SAMD00019534_121310             81.6    6e-14   Acytostelium subglobosum LB1
dbj|GAN02148.1|  translation initiation factor eIF-2A                 81.6    6e-14   Mucor ambiguus
gb|KIO20385.1|  hypothetical protein M407DRAFT_29964                  81.6    7e-14   Tulasnella calospora MUT 4182
ref|XP_003395436.1|  PREDICTED: eukaryotic translation initiation...  81.3    7e-14   
ref|XP_007849394.1|  eukaryotic translation initiation factor 2a      81.6    7e-14   
ref|XP_004224282.1|  hypothetical protein PCYB_132100                 81.3    7e-14   Plasmodium cynomolgi strain B
gb|KIJ10832.1|  hypothetical protein PAXINDRAFT_172050                81.6    7e-14   Paxillus involutus ATCC 200175
gb|KKA24824.1|  Eukaryotic translation initiation factor subunit ...  81.6    7e-14   Rasamsonia emersonii CBS 393.64
gb|EKG10466.1|  Six-bladed beta-propeller TolB-like protein           81.6    8e-14   Macrophomina phaseolina MS6
ref|XP_002838517.1|  hypothetical protein                             81.6    8e-14   Tuber melanosporum Mel28
ref|XP_003488788.1|  PREDICTED: eukaryotic translation initiation...  81.3    8e-14   
gb|KDQ34142.1|  hypothetical protein PLEOSDRAFT_1095628               81.3    8e-14   Pleurotus ostreatus PC15
ref|XP_007321669.1|  hypothetical protein SERLADRAFT_451892           81.3    9e-14   Serpula lacrymans var. lacrymans S7.9
gb|EGN96343.1|  hypothetical protein SERLA73DRAFT_170733              81.3    9e-14   Serpula lacrymans var. lacrymans S7.3
ref|XP_011131544.1|  eukaryotic translation initiation factor 2A      80.1    9e-14   Gregarina niphandrodes
ref|XP_007871399.1|  translation initiation factor eIF-2A             81.3    1e-13   Gloeophyllum trabeum ATCC 11539
gb|KEQ91281.1|  hypothetical protein AUEXF2481DRAFT_33231             81.3    1e-13   Aureobasidium subglaciale EXF-2481
gb|KIW75105.1|  hypothetical protein Z517_11876                       81.3    1e-13   Fonsecaea pedrosoi CBS 271.37
ref|XP_007931629.1|  hypothetical protein MYCFIDRAFT_168463           80.9    1e-13   Pseudocercospora fijiensis CIRAD86
gb|KIK93037.1|  hypothetical protein PAXRUDRAFT_829393                80.9    1e-13   Paxillus rubicundulus Ve08.2h10
gb|KEQ66984.1|  eukaryotic translation initiation factor 2A           80.9    1e-13   Aureobasidium melanogenum CBS 110374
ref|XP_011275696.1|  Eukaryotic translation initiation factor 2A      80.9    1e-13   Wickerhamomyces ciferrii
gb|ESX00859.1|  Eukaryotic initiation factor (eIF) 2A                 80.9    1e-13   Ogataea parapolymorpha DL-1
ref|XP_011397970.1|  Eukaryotic translation initiation factor 2A      80.5    1e-13   Auxenochlorella protothecoides
gb|KDQ18700.1|  hypothetical protein BOTBODRAFT_29077                 80.9    1e-13   Botryobasidium botryosum FD-172 SS1
gb|KIJ32447.1|  hypothetical protein M422DRAFT_213804                 80.5    2e-13   Sphaerobolus stellatus SS14
ref|XP_002550351.1|  conserved hypothetical protein                   80.5    2e-13   Candida tropicalis MYA-3404
ref|XP_005096415.1|  PREDICTED: eukaryotic translation initiation...  80.1    2e-13   Aplysia californica
ref|XP_001383729.2|  hypothetical protein PICST_88690                 80.5    2e-13   Scheffersomyces stipitis CBS 6054
ref|XP_007581397.1|  putative eukaryotic translation initiation f...  80.5    2e-13   
gb|EMG46660.1|  hypothetical protein G210_3080                        80.1    2e-13   Candida maltosa Xu316
emb|CCM04562.1|  predicted protein                                    80.1    2e-13   Fibroporia radiculosa
ref|XP_002260631.1|  hypothetical protein, conserved in Plasmodiu...  80.5    2e-13   Plasmodium knowlesi strain H
ref|XP_007384987.1|  translation initiation factor eIF-2A             80.1    2e-13   Punctularia strigosozonata HHB-11173 SS5
gb|KIK51730.1|  hypothetical protein GYMLUDRAFT_251789                80.5    2e-13   Gymnopus luxurians FD-317 M1
ref|XP_004833173.1|  Eukaryotic translation initiation factor eIF...  80.1    2e-13   Theileria equi strain WA
ref|XP_011505945.1|  PREDICTED: eukaryotic translation initiation...  80.1    2e-13   Ceratosolen solmsi marchali
ref|XP_766228.1|  hypothetical protein                                80.1    2e-13   Theileria parva strain Muguga
ref|XP_954073.1|  hypothetical protein                                80.1    2e-13   Theileria annulata
ref|XP_007370983.1|  translation initiation factor eIF-2A             80.1    2e-13   Dichomitus squalens LYAD-421 SS1
ref|XP_001933692.1|  conserved hypothetical protein                   80.1    2e-13   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_008715899.1|  hypothetical protein HMPREF1541_03325            80.1    2e-13   Cyphellophora europaea CBS 101466
gb|EEQ90753.1|  eukaryotic translation initiation factor 2A           80.1    2e-13   
ref|XP_002623307.1|  eukaryotic translation initiation factor 2A      80.1    2e-13   Blastomyces gilchristii SLH14081
gb|EQL36646.1|  hypothetical protein BDFG_02008                       80.1    2e-13   Blastomyces dermatitidis ATCC 26199
ref|XP_011311612.1|  PREDICTED: eukaryotic translation initiation...  79.7    2e-13   Fopius arisanus
gb|EGE78909.1|  eukaryotic translation initiation factor 2A           80.1    2e-13   Blastomyces dermatitidis ATCC 18188
gb|KEQ69570.1|  eukaryotic translation initiation factor 2A           80.1    2e-13   Aureobasidium namibiae CBS 147.97
ref|XP_001263854.1|  eukaryotic translation initiation factor sub...  80.1    2e-13   Aspergillus fischeri NRRL 181
emb|CCG80719.1|  Eukaryotic translation initiation factor 2A          79.7    3e-13   Taphrina deformans PYCC 5710
gb|KIR88067.1|  translation initiation factor 2A                      79.7    3e-13   Cryptococcus gattii VGIV IND107
ref|XP_745903.1|  hypothetical protein                                75.9    3e-13   
gb|KGB76678.1|  translation initiation factor 2A                      79.7    3e-13   Cryptococcus gattii VGII R265
gb|KIR25790.1|  translation initiation factor 2A                      79.7    3e-13   Cryptococcus gattii VGII LA55
dbj|GAA85688.1|  eukaryotic translation initiation factor subunit...  79.7    3e-13   Aspergillus kawachii IFO 4308
gb|KIR41242.1|  translation initiation factor 2A                      79.7    3e-13   Cryptococcus gattii VGII Ram5
ref|XP_012053715.1|  translation initiation factor 2A                 79.7    3e-13   Cryptococcus neoformans var. grubii H99
ref|XP_572226.1|  hypothetical protein CNH00340                       79.3    3e-13   Cryptococcus neoformans var. neoformans JEC21
ref|XP_011192685.1|  PREDICTED: eukaryotic translation initiation...  79.3    3e-13   Zeugodacus cucurbitae [melon fruit fly]
gb|KIJ94015.1|  hypothetical protein K443DRAFT_371678                 79.3    3e-13   Laccaria amethystina LaAM-08-1
gb|KIR59405.1|  translation initiation factor 2A                      79.3    3e-13   Cryptococcus gattii CA1873
gb|KIK38754.1|  hypothetical protein CY34DRAFT_809015                 79.3    3e-13   Suillus luteus UH-Slu-Lm8-n1
ref|XP_772552.1|  hypothetical protein CNBL0320                       79.3    3e-13   Cryptococcus neoformans var. neoformans B-3501A
gb|KIR45402.1|  translation initiation factor 2A                      79.3    3e-13   Cryptococcus gattii CA1280
gb|KEY76426.1|  eukaryotic translation initiation factor subunit ...  79.3    3e-13   Aspergillus fumigatus var. RP-2014
emb|CEG64097.1|  hypothetical protein RMATCC62417_01132               79.0    3e-13   Rhizopus microsporus
ref|XP_755009.1|  eukaryotic translation initiation factor subuni...  79.3    3e-13   Aspergillus fumigatus Af293
gb|EDP53138.1|  eukaryotic translation initiation factor subunit ...  79.3    3e-13   Aspergillus fumigatus A1163
ref|XP_003848258.1|  hypothetical protein MYCGRDRAFT_76608            79.3    4e-13   Zymoseptoria tritici IPO323
ref|XP_006690547.1|  translation initiation factor eIF-2A             79.3    4e-13   Yamadazyma tenuis ATCC 10573
ref|XP_008866648.1|  hypothetical protein H310_04198                  79.3    4e-13   Aphanomyces invadans
ref|XP_011325011.1|  hypothetical protein FGSG_06353                  79.3    4e-13   Fusarium graminearum PH-1
gb|KIV83701.1|  hypothetical protein PV11_05703                       79.3    4e-13   Exophiala sideris
gb|KII89455.1|  hypothetical protein PLICRDRAFT_91818                 79.3    4e-13   Plicaturopsis crispa FD-325 SS-3
ref|XP_001824444.1|  eukaryotic translation initiation factor 2A      79.3    4e-13   Aspergillus oryzae RIB40
ref|XP_009252535.1|  hypothetical protein FPSE_01140                  79.3    4e-13   Fusarium pseudograminearum CS3096
emb|CDR40825.1|  CYFA0S05e04918g1_1                                   79.0    4e-13   Cyberlindnera fabianii
gb|KIY51856.1|  translation initiation factor eIF-2A                  79.0    4e-13   Fistulina hepatica ATCC 64428
gb|EUD71096.1|  hypothetical protein YYG_03729                        79.0    4e-13   Plasmodium vinckei petteri
ref|XP_002384212.1|  eukaryotic translation initiation factor sub...  79.0    4e-13   Aspergillus flavus NRRL3357
gb|KJJ33530.1|  Eukaryotic translation initiation factor eIF2A        79.3    4e-13   
ref|XP_007372274.1|  hypothetical protein SPAPADRAFT_57955            79.0    4e-13   Spathaspora passalidarum NRRL Y-27907
ref|XP_001586889.1|  hypothetical protein SS1G_11918                  79.0    5e-13   Sclerotinia sclerotiorum 1980 UF-70
gb|KJK67706.1|  Eukaryotic translation initiation factor eIF2A        79.0    5e-13   Aspergillus parasiticus SU-1
ref|XP_009832082.1|  hypothetical protein H257_08018                  79.0    5e-13   Aphanomyces astaci
ref|XP_009542009.1|  hypothetical protein HETIRDRAFT_432080           79.0    5e-13   Heterobasidion irregulare TC 32-1
gb|KIW28165.1|  hypothetical protein PV07_07848                       79.0    5e-13   Cladophialophora immunda
emb|CEG64096.1|  hypothetical protein RMATCC62417_01132               79.0    5e-13   Rhizopus microsporus
ref|XP_007673111.1|  hypothetical protein BAUCODRAFT_63591            79.0    5e-13   Baudoinia panamericana UAMH 10762
emb|CAK40861.1|  unnamed protein product                              78.6    6e-13   Aspergillus niger
ref|XP_007264356.1|  translation initiation factor eIF-2A             78.6    6e-13   Fomitiporia mediterranea MF3/22
ref|XP_002416901.1|  eukaryotic translation initiation factor eIF...  78.6    6e-13   Candida dubliniensis CD36
ref|XP_001395020.2|  eukaryotic translation initiation factor 2A      78.6    6e-13   Aspergillus niger CBS 513.88
ref|XP_008037098.1|  translation initiation factor eIF-2A             78.6    6e-13   Trametes versicolor FP-101664 SS1
gb|KGK40819.1|  hypothetical protein JL09_g218                        78.6    6e-13   Pichia kudriavzevii
ref|XP_011642683.1|  PREDICTED: eukaryotic translation initiation...  78.6    6e-13   Pogonomyrmex barbatus
ref|XP_011642682.1|  PREDICTED: eukaryotic translation initiation...  78.6    6e-13   Pogonomyrmex barbatus
ref|XP_011294189.1|  PREDICTED: eukaryotic translation initiation...  78.6    6e-13   Musca domestica
gb|EEH03597.1|  eukaryotic translation initiation factor 2A           78.6    7e-13   Histoplasma capsulatum G186AR
ref|XP_002618238.1|  hypothetical protein CLUG_01697                  78.2    7e-13   Clavispora lusitaniae ATCC 42720
gb|KJX94276.1|  eukaryotic translation initiation factor subunit ...  78.6    7e-13   Zymoseptoria brevis
gb|KGQ98638.1|  translation initiation factor 2A                      78.6    7e-13   Candida albicans P37005
ref|XP_004526153.1|  PREDICTED: eukaryotic translation initiation...  78.6    7e-13   Ceratitis capitata [medfly]
gb|KHC40287.1|  translation initiation factor 2A                      78.6    7e-13   Candida albicans P76055
ref|XP_001610912.1|  hypothetical protein                             78.2    7e-13   Babesia bovis T2Bo
gb|KHC43079.1|  translation initiation factor 2A                      78.6    7e-13   Candida albicans P76067
gb|EER37472.1|  eukaryotic translation initiation factor 2A           78.6    7e-13   Histoplasma capsulatum H143
gb|KGU37457.1|  translation initiation factor 2A                      78.6    7e-13   Candida albicans P57055
ref|XP_003841861.1|  similar to eukaryotic translation initiation...  78.6    7e-13   Leptosphaeria maculans JN3
gb|KGT72433.1|  translation initiation factor 2A                      78.6    7e-13   Candida albicans 12C
gb|EEQ42913.1|  conserved hypothetical protein                        78.6    7e-13   
gb|KGU19265.1|  translation initiation factor 2A                      78.6    7e-13   
ref|XP_001544206.1|  conserved hypothetical protein                   78.6    7e-13   
gb|KGR03450.1|  translation initiation factor 2A                      78.2    7e-13   
gb|KGU36428.1|  translation initiation factor 2A                      78.2    8e-13   
gb|KGU33624.1|  translation initiation factor 2A                      78.2    8e-13   
gb|KGR21278.1|  translation initiation factor 2A                      78.2    8e-13   
gb|KGQ98131.1|  translation initiation factor 2A                      78.2    8e-13   
ref|XP_721430.1|  hypothetical protein CaO19.2930                     78.2    8e-13   
gb|KIW89196.1|  hypothetical protein Z519_10048                       78.6    8e-13   
ref|XP_002258997.1|  hypothetical protein                             78.6    8e-13   
gb|EME40398.1|  hypothetical protein DOTSEDRAFT_91574                 78.2    8e-13   
gb|EPQ63538.1|  Eukaryotic initiation factor eIF 2A                   78.2    8e-13   
ref|XP_011340598.1|  PREDICTED: eukaryotic translation initiation...  78.2    8e-13   
gb|KIW50531.1|  hypothetical protein PV05_09334                       78.2    8e-13   
gb|EMD97541.1|  hypothetical protein COCHEDRAFT_1164596               78.2    9e-13   
gb|KEQ82679.1|  translation initiation factor eIF-2A                  78.2    9e-13   
ref|XP_003301386.1|  hypothetical protein PTT_12871                   78.2    9e-13   
gb|KIR56816.1|  translation initiation factor 2A                      78.2    9e-13   
gb|EZA53440.1|  Eukaryotic translation initiation factor 2A           78.2    9e-13   
ref|XP_002975626.1|  hypothetical protein SELMODRAFT_104015           77.0    9e-13   
ref|XP_003867908.1|  Ygr054w protein                                  77.8    1e-12   
ref|XP_001270615.1|  eukaryotic translation initiation factor sub...  77.8    1e-12   
ref|XP_011140241.1|  PREDICTED: eukaryotic translation initiation...  77.8    1e-12   
ref|XP_007742000.1|  hypothetical protein A1O5_03197                  78.2    1e-12   
ref|XP_679773.1|  hypothetical protein                                77.8    1e-12   
ref|XP_007692831.1|  hypothetical protein COCMIDRAFT_9506             77.8    1e-12   
gb|EPS26619.1|  hypothetical protein PDE_01557                        77.8    1e-12   
ref|XP_001246721.1|  hypothetical protein CIMG_00492                  77.8    1e-12   
ref|XP_003066509.1|  hypothetical protein CPC735_057340               77.8    1e-12   
dbj|GAM43700.1|  translation initiation factor                        77.8    1e-12   
ref|XP_007695387.1|  hypothetical protein COCSADRAFT_23314            77.8    1e-12   
gb|EFW18563.1|  eukaryotic translation initiation factor 2A           77.8    1e-12   
gb|EUN21688.1|  hypothetical protein COCVIDRAFT_31153                 77.8    1e-12   
ref|XP_007396413.1|  hypothetical protein PHACADRAFT_257189           77.4    1e-12   
gb|ELQ32508.1|  hypothetical protein OOU_Y34scaffold01111g1           75.9    1e-12   
ref|XP_003140005.1|  hypothetical protein LOAG_04420                  77.4    1e-12   
gb|KDR82120.1|  hypothetical protein GALMADRAFT_135484                77.8    1e-12   
ref|XP_003195522.1|  hypothetical protein CGB_H0390W                  77.4    1e-12   
ref|XP_007714930.1|  hypothetical protein COCCADRAFT_103038           77.8    1e-12   
ref|XP_002427345.1|  eukaryotic translation initiation factor 3 s...  77.4    1e-12   
ref|XP_004199415.1|  Piso0_002854                                     77.4    1e-12   
emb|CCD50275.1|  hypothetical protein BofuT4P144000007001             77.4    1e-12   
gb|KIR81589.1|  translation initiation factor 2A                      77.4    1e-12   
gb|EPS98362.1|  hypothetical protein FOMPIDRAFT_1024669               77.4    1e-12   
ref|XP_011065972.1|  PREDICTED: eukaryotic translation initiation...  77.4    1e-12   
gb|KIM49787.1|  hypothetical protein M413DRAFT_438919                 77.4    1e-12   
gb|EDK37071.2|  hypothetical protein PGUG_01169                       76.3    1e-12   
ref|XP_001551064.1|  hypothetical protein BC1G_10321                  77.4    1e-12   
gb|KFY42827.1|  hypothetical protein V495_04316                       77.4    2e-12   
ref|XP_002486294.1|  eukaryotic translation initiation factor sub...  77.4    2e-12   
ref|XP_004200274.1|  Piso0_002854                                     77.4    2e-12   
ref|XP_011065965.1|  PREDICTED: eukaryotic translation initiation...  77.4    2e-12   
gb|ETB58350.1|  hypothetical protein YYC_03965                        77.4    2e-12   
gb|KFY58613.1|  hypothetical protein V497_04739                       77.4    2e-12   
ref|XP_012057564.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  77.4    2e-12   
ref|XP_009060744.1|  hypothetical protein LOTGIDRAFT_234486           77.4    2e-12   
ref|XP_001878372.1|  predicted protein                                77.4    2e-12   
ref|XP_001526794.1|  conserved hypothetical protein                   77.4    2e-12   
ref|XP_002152569.1|  eukaryotic translation initiation factor sub...  77.4    2e-12   
emb|CDM32354.1|  Eukaryotic translation initiation factor 2A          77.0    2e-12   
ref|XP_730360.1|  hypothetical protein                                77.0    2e-12   
emb|CDZ14796.1|  eukaryotic initiation factor 2a, putative            77.0    2e-12   
ref|XP_007343211.1|  translation initiation factor eIF-2A             77.0    2e-12   
emb|CCE40606.1|  hypothetical protein CPAR2_106410                    77.0    2e-12   
emb|CEJ91991.1|  Putative Eukaryotic translation initiation facto...  77.0    2e-12   
gb|EXL53103.1|  hypothetical protein FOCG_06514                       77.0    2e-12   
gb|KDN62036.1|  putative eukaryotic translation initiation factor...  77.0    2e-12   
gb|EGU84088.1|  hypothetical protein FOXB_05386                       77.0    2e-12   
emb|CDU16986.1|  eukaryotic initiation factor 2a, putative            77.0    2e-12   
ref|XP_005832037.1|  hypothetical protein GUITHDRAFT_94821            76.6    2e-12   
gb|KIW37414.1|  hypothetical protein PV06_10455                       77.0    2e-12   
gb|KFY28479.1|  hypothetical protein V493_02911                       76.6    2e-12   
gb|KIV99842.1|  hypothetical protein PV09_08511                       77.0    2e-12   
emb|CCV00571.1|  unnamed protein product                              76.6    3e-12   
gb|ESZ91591.1|  hypothetical protein SBOR_8026                        76.6    3e-12   
ref|XP_011391075.1|  hypothetical protein UMAG_04371                  76.6    3e-12   
gb|KDP44248.1|  hypothetical protein JCGZ_05715                       72.8    3e-12   
ref|XP_011696032.1|  PREDICTED: eukaryotic translation initiation...  76.6    3e-12   
gb|KIY71317.1|  translation initiation factor eIF-2A                  76.6    3e-12   
ref|XP_007308488.1|  translation initiation factor eIF-2A             76.6    3e-12   
gb|KIW15061.1|  hypothetical protein PV08_07848                       76.6    3e-12   
ref|XP_002476991.1|  predicted protein                                76.6    3e-12   
ref|XP_008727012.1|  hypothetical protein G647_04447                  76.6    3e-12   
gb|KIY02955.1|  hypothetical protein Z520_01420                       76.6    3e-12   
emb|CBQ69187.1|  conserved hypothetical protein                       76.6    3e-12   
ref|XP_011867165.1|  PREDICTED: eukaryotic translation initiation...  76.6    3e-12   
emb|CCU74170.1|  eukaryotic translation initiation factor 2A          76.6    3e-12   
gb|KJA19147.1|  hypothetical protein HYPSUDRAFT_56828                 76.6    3e-12   
gb|KGO65415.1|  Translation initiation factor 2A                      76.6    3e-12   
ref|XP_008625474.1|  hypothetical protein YYE_03603                   76.3    3e-12   
ref|XP_011202425.1|  PREDICTED: eukaryotic translation initiation...  76.3    3e-12   
ref|XP_010761506.1|  hypothetical protein PADG_06024                  76.6    3e-12   
gb|KJJ28672.1|  WD40YVTN repeat-like-containing domain                76.3    3e-12   
emb|CCA17134.1|  eukaryotic translation initiation factor 2A puta...  76.3    3e-12   
gb|KIJ63412.1|  hypothetical protein HYDPIDRAFT_168589                76.3    3e-12   
emb|CDR11651.1|  eukaryotic initiation factor 2a, putative            76.3    3e-12   
ref|XP_001487792.1|  hypothetical protein PGUG_01169                  75.1    3e-12   
dbj|GAD92272.1|  eukaryotic translation initiation factor subunit...  76.3    3e-12   
dbj|GAC74389.1|  predicted translation initiation factor related ...  76.3    3e-12   
gb|KGO37327.1|  Translation initiation factor 2A                      76.3    3e-12   
gb|EKV16587.1|  Eukaryotic translation initiation factor subunit ...  76.3    3e-12   
ref|XP_002541016.1|  conserved hypothetical protein                   76.3    3e-12   
ref|XP_008022838.1|  hypothetical protein SETTUDRAFT_167669           76.3    4e-12   
ref|XP_002047465.1|  GJ11919                                          76.3    4e-12   
ref|XP_008594598.1|  eukaryotic translation initiation factor eIF2A   76.3    4e-12   
ref|XP_007731381.1|  hypothetical protein A1O3_03051                  76.3    4e-12   
gb|KGQ10618.1|  Eukaryotic translation initiation factor 2A           76.3    4e-12   
ref|XP_004348522.1|  eukaryotic translation initiation factor eif...  76.3    4e-12   
ref|XP_007811031.1|  eukaryotic translation initiation factor sub...  76.3    4e-12   
emb|CDI55240.1|  eukaryotic translation initiation factor 2a          75.9    4e-12   
ref|XP_007820823.1|  Translation initiation factor 2A                 76.3    4e-12   
dbj|GAK66258.1|  translation initiation factor eIF-2A                 76.3    4e-12   
ref|NP_001189155.1|  CG7414, isoform C                                75.9    4e-12   
ref|XP_007805634.1|  hypothetical protein EPUS_07152                  76.3    4e-12   
gb|EEH23482.1|  hypothetical protein PABG_05693                       76.3    4e-12   
gb|KID78489.1|  Translation initiation factor 2A                      76.3    4e-12   
ref|XP_002563324.1|  Pc20g08010                                       76.3    4e-12   
ref|NP_649365.1|  CG7414, isoform A                                   75.9    4e-12   
gb|ETS62313.1|  hypothetical protein PaG_03390                        76.3    4e-12   
ref|XP_006666482.1|  eukaryotic translation initiation factor sub...  76.3    4e-12   
gb|EJW79217.1|  hypothetical protein WUBG_09870                       75.5    4e-12   
ref|XP_001958459.1|  GF10931                                          75.9    5e-12   
ref|XP_008547291.1|  PREDICTED: eukaryotic translation initiation...  75.9    5e-12   
gb|KIX00935.1|  hypothetical protein Z518_10000                       75.9    5e-12   
ref|XP_002085868.1|  GD15005                                          75.5    5e-12   
gb|KFY76790.1|  hypothetical protein V499_03667                       75.9    5e-12   
gb|EYE96244.1|  putative eukaryotic translation initiation factor...  75.9    5e-12   
emb|CCF50933.1|  uncharacterized protein UHOR_06830                   75.9    5e-12   
ref|XP_011251189.1|  PREDICTED: eukaryotic translation initiation...  75.5    5e-12   
gb|KFZ00972.1|  hypothetical protein V501_10315                       75.9    5e-12   
ref|XP_003051963.1|  predicted protein                                75.9    5e-12   
gb|EWG43637.1|  hypothetical protein FVEG_05029                       75.5    6e-12   
ref|XP_001868809.1|  eukaryotic translation initiation factor 2A      75.5    6e-12   
ref|XP_007782291.1|  hypothetical protein W97_06090                   75.5    6e-12   
ref|XP_001973693.1|  GG16228                                          75.5    6e-12   
emb|CCT67384.1|  related to eukaryotic translation initiation fac...  75.5    6e-12   
ref|XP_007722163.1|  hypothetical protein A1O1_03066                  75.5    7e-12   
ref|XP_001353584.2|  GA20333                                          75.5    7e-12   
ref|XP_002008555.1|  GI13558                                          75.5    7e-12   
gb|KFM57210.1|  Eukaryotic translation initiation factor 2A           73.2    7e-12   
ref|XP_002095774.1|  GE22589                                          75.5    7e-12   
dbj|GAM83282.1|  hypothetical protein ANO11243_012680                 75.5    8e-12   
ref|XP_006692243.1|  putative eukaryotic translation initiation f...  75.5    8e-12   
ref|XP_004349857.2|  eukaryotic translation initiation factor 2A      75.1    8e-12   
gb|EST09331.1|  putative translation initiation factor related to...  75.1    8e-12   
ref|XP_001892029.1|  LOC398445 protein                                75.5    8e-12   
emb|CCO30415.1|  Eukaryotic translation initiation factor 2A Shor...  74.3    8e-12   
ref|XP_003035534.1|  hypothetical protein SCHCODRAFT_84688            75.1    9e-12   
ref|XP_002062212.1|  GK16781                                          75.1    1e-11   
gb|EPE05237.1|  eukaryotic translation initiation factor subunit      75.1    1e-11   
gb|EIF46693.1|  eukaryotic translation initiation factor subunit      74.7    1e-11   
gb|KFH43771.1|  Eukaryotic translation initiation factor 2A-like ...  75.1    1e-11   
gb|ETW28493.1|  hypothetical protein PFFCH_04124                      74.7    1e-11   
gb|EMF08916.1|  eukaryotic translation initiation factor subunit ...  74.7    1e-11   
ref|XP_002778445.1|  conserved hypothetical protein                   74.7    1e-11   
gb|KHO01056.1|  Translation initiation factor 2A                      74.7    1e-11   
ref|XP_001217517.1|  conserved hypothetical protein                   74.7    1e-11   
ref|XP_001904662.1|  hypothetical protein                             74.7    1e-11   
gb|KIL91772.1|  eukaryotic translation initiation factor 2a           74.7    1e-11   
ref|XP_005705357.1|  eukaryotic translation initiation factor-rel...  74.3    1e-11   
gb|ELR04756.1|  hypothetical protein GMDG_06984                       74.7    1e-11   
ref|XP_972330.1|  PREDICTED: eukaryotic translation initiation fa...  74.3    1e-11   
ref|XP_009158946.1|  translation initiation factor eIF-3 subunit 9    74.7    1e-11   
emb|CEL54542.1|  Eukaryotic translation initiation factor 2A OS=S...  74.3    1e-11   
gb|KIW69319.1|  hypothetical protein PV04_05201                       74.7    1e-11   
gb|ERL91840.1|  hypothetical protein D910_09165                       74.3    1e-11   
ref|XP_001750023.1|  hypothetical protein                             74.3    1e-11   
ref|XP_007841192.1|  hypothetical protein PFICI_14420                 74.3    1e-11   
gb|AEE62222.1|  unknown                                               74.3    1e-11   
ref|XP_008485701.1|  PREDICTED: eukaryotic translation initiation...  70.9    2e-11   
gb|KID92484.1|  Translation initiation factor 2A                      74.3    2e-11   
ref|XP_002040874.1|  GM22412                                          74.3    2e-11   
gb|KFZ17848.1|  hypothetical protein V502_04381                       74.3    2e-11   
gb|KFY65830.1|  hypothetical protein V496_02314                       74.3    2e-11   
ref|XP_011435292.1|  PREDICTED: eukaryotic translation initiation...  74.3    2e-11   
gb|KFY82457.1|  hypothetical protein V500_10532                       74.3    2e-11   
ref|XP_003687328.1|  hypothetical protein TPHA_0J00710                74.3    2e-11   
gb|EKC26762.1|  Eukaryotic translation initiation factor 2A           74.3    2e-11   
emb|CCF37151.1|  eukaryotic translation initiation factor eIF2A       74.3    2e-11   
emb|CCE29872.1|  related to eukaryotic translation initiation fac...  74.3    2e-11   
emb|CCX33303.1|  Similar to Eukaryotic translation initiation fac...  74.3    2e-11   
ref|XP_501618.1|  YALI0C08877p                                        73.9    2e-11   
gb|ENN81579.1|  hypothetical protein YQE_02108                        73.9    2e-11   
ref|XP_002507119.1|  eukaryotic translation factor                    73.9    2e-11   
ref|XP_001227658.1|  hypothetical protein CHGG_09731                  73.9    2e-11   
dbj|GAC98050.1|  hypothetical protein PHSY_005638                     73.9    2e-11   
ref|XP_448414.1|  hypothetical protein                                73.9    2e-11   
gb|KIV96215.1|  hypothetical protein PV10_00106                       73.9    2e-11   
ref|XP_007274474.1|  eukaryotic translation initiation factor 2a      73.9    2e-11   
gb|KID96661.1|  Translation initiation factor 2A                      73.9    2e-11   
ref|XP_003718132.1|  eukaryotic translation initiation factor 2A      73.9    2e-11   
gb|EFX88811.1|  hypothetical protein DAPPUDRAFT_304806                73.6    2e-11   
gb|EFQ31744.1|  eukaryotic translation initiation factor eIF2A        73.9    2e-11   
gb|KDN48186.1|  translation initiation factor eIF-2A                  73.9    2e-11   
gb|EJT52371.1|  hypothetical protein A1Q1_04582                       72.4    2e-11   
gb|KHJ43593.1|  eukaryotic translation initiation factor eIF2A        73.6    3e-11   
ref|XP_007756448.1|  hypothetical protein A1O7_04246                  73.9    3e-11   
ref|XP_003678434.1|  hypothetical protein NCAS_0J01170                73.6    3e-11   
ref|XP_011167457.1|  PREDICTED: eukaryotic translation initiation...  73.6    3e-11   
ref|XP_002792179.1|  eukaryotic translation initiation factor 2A      73.6    3e-11   
ref|XP_007007525.1|  hypothetical protein TREMEDRAFT_45646            73.6    3e-11   
ref|XP_011167458.1|  PREDICTED: eukaryotic translation initiation...  73.6    3e-11   
gb|KDN40620.1|  hypothetical protein RSAG8_07949                      73.2    3e-11   
ref|XP_001694385.1|  eukaryotic initiation factor                     73.6    3e-11   
ref|WP_028827418.1|  hypothetical protein                             73.6    3e-11   
ref|XP_007789565.1|  putative eukaryotic translation initiation f...  73.6    3e-11   
ref|XP_009221827.1|  eukaryotic translation initiation factor 2A      73.6    3e-11   
ref|XP_660379.1|  hypothetical protein AN2775.2                       73.6    3e-11   
emb|CCI42427.1|  unnamed protein product                              73.6    3e-11   
ref|XP_001632001.1|  predicted protein                                73.2    3e-11   
emb|CBN79207.1|  eukaryotic initiation factor 2A                      73.6    3e-11   
gb|KEF62972.1|  hypothetical protein A1O9_00947                       73.6    3e-11   
emb|CDK29078.1|  unnamed protein product                              73.2    3e-11   
gb|KJZ72423.1|  hypothetical protein HIM_08226                        73.2    3e-11   
ref|XP_001611648.1|  hypothetical protein                             73.2    4e-11   
ref|XP_008087337.1|  DPP6 N-terminal                                  73.2    4e-11   
gb|KFY14472.1|  hypothetical protein V492_02600                       73.2    4e-11   
gb|KIO00823.1|  hypothetical protein M404DRAFT_29224                  73.2    4e-11   
gb|KEY67964.1|  hypothetical protein S7711_02169                      73.2    4e-11   
gb|KFA66894.1|  hypothetical protein S40285_02339                     73.2    4e-11   



>ref|XP_011091567.1| PREDICTED: eukaryotic translation initiation factor 2A [Sesamum 
indicum]
Length=516

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L  TKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIK+FHHNG
Sbjct  336  GNLPGDMAFWDYLEKKKLGATKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKIFHHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFK+MF+KL+Q DWKPESPDKFG+I+E  K+VDSLK++ET  QGQGSK ++ ++KT  
Sbjct  396  SLYFKRMFDKLFQVDWKPESPDKFGDITELSKSVDSLKLEETTRQGQGSKTTQASSKTAS  455

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            +NP  QKPAAYRPPHAKAAAAVQAELFG +PSGE+S
Sbjct  456  SNPSVQKPAAYRPPHAKAAAAVQAELFGVSPSGEMS  491



>emb|CDP10861.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TTKAE SVTSEWSPDGRYFMTATTAPRLQVDNGIK+FHHNG
Sbjct  335  GNLPGDMAFWDYVEKKQLGTTKAECSVTSEWSPDGRYFMTATTAPRLQVDNGIKIFHHNG  394

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFK+MF+KLYQADWKPESPD+FGEI+E  K+V+SLKID TK QGQGS        + P
Sbjct  395  SLYFKEMFDKLYQADWKPESPDRFGEIAELGKSVESLKIDGTKPQGQGS--KSSQVSSKP  452

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            AN PAQKPAAYRPPHAKAAAAVQA+LFGG+PSGELS
Sbjct  453  ANAPAQKPAAYRPPHAKAAAAVQAQLFGGSPSGELS  488



>gb|KDP44253.1| hypothetical protein JCGZ_05720 [Jatropha curcas]
Length=490

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AE SVTSEWSPDGRYFMTATTAPRLQVDNGIK+FH++G
Sbjct  313  GNLPGDMAFWDYVNKKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQVDNGIKIFHYDG  372

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF+KLYQA+WKPESPD+FGEI+E +K+VDSLK++ETK QGQG
Sbjct  373  SLYFKKMFDKLYQAEWKPESPDRFGEIAELVKSVDSLKVEETKPQGQG  420



>ref|XP_012065068.1| PREDICTED: eukaryotic translation initiation factor 2A [Jatropha 
curcas]
Length=513

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AE SVTSEWSPDGRYFMTATTAPRLQVDNGIK+FH++G
Sbjct  336  GNLPGDMAFWDYVNKKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQVDNGIKIFHYDG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF+KLYQA+WKPESPD+FGEI+E +K+VDSLK++ETK QGQG
Sbjct  396  SLYFKKMFDKLYQAEWKPESPDRFGEIAELVKSVDSLKVEETKPQGQG  443



>ref|XP_011037397.1| PREDICTED: eukaryotic translation initiation factor 2A [Populus 
euphratica]
Length=513

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KKE+ TTKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYVDKKEIGTTKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SLYFKKMF+KLY+ +WKPESPD+FGEI+E +K+VDSLK+ ETK QGQG+
Sbjct  397  SLYFKKMFDKLYEVEWKPESPDRFGEIAELIKSVDSLKVTETKSQGQGA  445



>ref|XP_009763010.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X1 [Nicotiana sylvestris]
Length=520

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+FHHNG
Sbjct  337  GNLPGDMAFWDYKEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKMF++LYQ DWKPES +KFG+I + +KAV S++IDE K  G+GSKA++   K TP
Sbjct  397  SLYFKKMFDRLYQVDWKPESVEKFGDIEDLVKAVGSVEIDEAKAPGKGSKATQAVPKATP  456

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPA KPAAYRPPHAK AAAVQAELFGG+ SGELS
Sbjct  457  ANPPAAKPAAYRPPHAKVAAAVQAELFGGSSSGELS  492



>ref|XP_004244753.1| PREDICTED: eukaryotic translation initiation factor 2A [Solanum 
lycopersicum]
Length=524

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 127/163 (78%), Gaps = 7/163 (4%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+KVFHHNG
Sbjct  337  GNLPGDMAFWDYREKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKVFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKMF++LYQ DWKPES +KFG+I + +KAV S+KIDE KV G+GSKA++ A K T 
Sbjct  397  SLYFKKMFDRLYQVDWKPESVEKFGDIEDLVKAVSSVKIDEAKVPGKGSKATQAAPKATQ  456

Query  499  anppaqkpaayrpph-------akaaaavqAELFGGNPSGELS  392
            A P A                 AKAAA VQAELFG +PSGELS
Sbjct  457  AVPKATPANPPAAKPAAYRPPHAKAAAVVQAELFGASPSGELS  499



>ref|XP_009763011.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X2 [Nicotiana sylvestris]
Length=520

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+FHHNG
Sbjct  337  GNLPGDMAFWDYKEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKMF++LYQ DWKPES +KFG+I + +KAV S++IDE K  G+GSKA++   K TP
Sbjct  397  SLYFKKMFDRLYQVDWKPESVEKFGDIEDLVKAVGSVEIDEAKAPGKGSKATQAVPKATP  456

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPA KPAAYRPPHAK AAAVQAELFGG+ SGELS
Sbjct  457  ANPPAAKPAAYRPPHAKVAAAVQAELFGGSSSGELS  492



>ref|XP_009763012.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X3 [Nicotiana sylvestris]
Length=520

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+FHHNG
Sbjct  337  GNLPGDMAFWDYKEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKMF++LYQ DWKPES +KFG+I + +KAV S++IDE K  G+GSKA++   K TP
Sbjct  397  SLYFKKMFDRLYQVDWKPESVEKFGDIEDLVKAVGSVEIDEAKAPGKGSKATQAVPKATP  456

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPA KPAAYRPPHAK AAAVQAELFGG+ SGELS
Sbjct  457  ANPPAAKPAAYRPPHAKVAAAVQAELFGGSSSGELS  492



>ref|XP_007222982.1| hypothetical protein PRUPE_ppa004316mg [Prunus persica]
 gb|EMJ24181.1| hypothetical protein PRUPE_ppa004316mg [Prunus persica]
Length=517

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDYG KK+L TT+AELSVTSEWSPDG YFMTATTAPRLQVDNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYGEKKQLGTTRAELSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KLYQADWKPESPD+FG+I+E +K++ SLK+ ETK QG  S
Sbjct  397  SLFFKKMFDKLYQADWKPESPDRFGDIAELVKSIGSLKVVETKPQGDRS  445



>ref|XP_006376433.1| hypothetical protein POPTR_0013s13000g [Populus trichocarpa]
 gb|ERP54230.1| hypothetical protein POPTR_0013s13000g [Populus trichocarpa]
Length=513

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK++ TTKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYVDKKQIGTTKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SLYFKKMF+KLY+ +WKPESPD+FGEI+E +K+VDSLK+ ETK QGQG+
Sbjct  397  SLYFKKMFDKLYEVEWKPESPDRFGEIAELIKSVDSLKVTETKSQGQGA  445



>ref|XP_010912787.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2A [Elaeis guineensis]
Length=519

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK L TTKAE SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  336  GNLPGDMAFWDYSEKKLLGTTKAECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF KLYQADWKPE+P++FG+I++ +K+VD+LKIDE K Q QG
Sbjct  396  SLYFKKMFNKLYQADWKPEAPEEFGDITDLVKSVDTLKIDEPKKQAQG  443



>gb|KDO64034.1| hypothetical protein CISIN_1g013871mg [Citrus sinensis]
Length=321

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY   K+L TT+AE SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  144  GNLPGDMAFWDYVDGKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHHNG  203

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KL+QA+WKP SPDKFG+ISE +K+V SLK+ ETK QG GS
Sbjct  204  SLFFKKMFDKLFQAEWKPVSPDKFGDISELIKSVGSLKVAETKSQGSGS  252



>ref|XP_002530577.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF31807.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=584

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  408  GNLPGDMAFWDYVNKKQLGTTRAECSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  467

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SLYFKKMF KLYQA+WKPESPDKF EI+E  K+VDSLKI+ETK+QGQG+
Sbjct  468  SLYFKKMFGKLYQAEWKPESPDKFDEIAELAKSVDSLKIEETKLQGQGA  516



>ref|XP_007050960.1| Eukaryotic translation initiation factor eIF2A family protein 
isoform 2 [Theobroma cacao]
 gb|EOX95117.1| Eukaryotic translation initiation factor eIF2A family protein 
isoform 2 [Theobroma cacao]
Length=518

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD+  KK+L TT+AE SVTSEWS DGRYFMTATTAPRLQVDN IK+FHHNG
Sbjct  339  GNLPGDMAFWDFVDKKQLGTTRAECSVTSEWSYDGRYFMTATTAPRLQVDNCIKIFHHNG  398

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SL FKKMF+KL+QADWKPESPDKFGEI+E +K+VDS+K++ETK +GQGS     + KT  
Sbjct  399  SLCFKKMFDKLFQADWKPESPDKFGEIAELIKSVDSMKVEETKPRGQGS----TSKKTAS  454

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPAQKPAAYRPPHAK AA VQAELFGG+ +GE+S
Sbjct  455  ANPPAQKPAAYRPPHAKNAATVQAELFGGSSAGEMS  490



>ref|XP_006355778.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Solanum 
tuberosum]
Length=531

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 127/170 (75%), Gaps = 14/170 (8%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+KVFHHNG
Sbjct  337  GNLPGDMAFWDYREKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKVFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKMF++LYQ DWKPES +KFG I + +KAV S+KIDE KV G+GSKA++   K T 
Sbjct  397  SLYFKKMFDRLYQVDWKPESVEKFGGIEDLVKAVGSVKIDEAKVPGKGSKATQAVPKATQ  456

Query  499  anppaqkpaayrpph--------------akaaaavqAELFGGNPSGELS  392
            A   A +      P               AKAAA VQAELFGG+PSGELS
Sbjct  457  AVSKAAQAIPKATPANPPAAKPAAYRPPHAKAAAVVQAELFGGSPSGELS  506



>gb|AFK44772.1| unknown [Lotus japonicus]
Length=218

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  KK+LA TKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  41   GNLPGDMVFWDYADKKQLAATKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  100

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF+KL+QADWKPESP KFG+I+E +K++DS+K+++ K  GQG
Sbjct  101  SLYFKKMFDKLFQADWKPESPSKFGDIAELIKSIDSVKLEDKKPSGQG  148



>ref|XP_002276161.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_003632107.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650701.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650702.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650703.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650704.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650705.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650706.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650707.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650708.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650709.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650710.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650711.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650712.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 ref|XP_010650713.1| PREDICTED: eukaryotic translation initiation factor 2A [Vitis 
vinifera]
 emb|CBI24670.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH NG
Sbjct  334  GNLPGDMAFWDYKEKKQLGTTRAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHPNG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFK MF+KLYQADWKPESPD+FGEI+E  +++DSLK+ ETK QGQGSK+S    K T 
Sbjct  394  SLYFKTMFDKLYQADWKPESPDRFGEIAELAQSIDSLKVGETKQQGQGSKSSVAPNKATS  453

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPP QKPAAYRPPHAK AAA+Q +LFGG+ + E+S
Sbjct  454  ANPPTQKPAAYRPPHAKTAAAIQTKLFGGSSTEEMS  489



>ref|XP_008339356.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2A [Malus domestica]
Length=514

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMAFWDYIEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KLYQADWKPESPD+FG+I+E +K+++SLK+ ETK QG+ S
Sbjct  397  SLFFKKMFDKLYQADWKPESPDRFGDIAELVKSIESLKVVETKPQGERS  445



>ref|XP_010268199.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X2 [Nelumbo nucifera]
Length=416

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK L TTKAE SVTSEWSP+G YFMTATTAPRLQVDN IK+FHHNG
Sbjct  232  GNLPGDMAFWDYVEKKLLGTTKAECSVTSEWSPNGLYFMTATTAPRLQVDNAIKIFHHNG  291

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKM++KLYQA+WKPE+P+KFG+++E +K+VD+LK+DE K QGQG+K+S+ +TK   
Sbjct  292  SLYFKKMYDKLYQAEWKPEAPEKFGDVAELVKSVDALKVDEVKPQGQGAKSSQASTKKAT  351

Query  499  anppaqkpaayrpphakaaaavqAELF-GGNPSGELS  392
            +  P QKPAAYRPPHAK AAAVQA+LF GG+PS E+S
Sbjct  352  STIPVQKPAAYRPPHAKEAAAVQAQLFGGGSPSEEMS  388



>emb|CAN83983.1| hypothetical protein VITISV_001098 [Vitis vinifera]
Length=567

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH NG
Sbjct  383  GNLPGDMAFWDYKEKKQLGTTRAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHPNG  442

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFK MF+KLYQADWKPESPD+FGEI+E  +++DSLK+ ETK QGQGSK+S    K T 
Sbjct  443  SLYFKTMFDKLYQADWKPESPDRFGEIAELAQSIDSLKVGETKQQGQGSKSSVAPNKATS  502

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPP QKPAAYRPPHAK AAA+Q +LFGG+ + E+S
Sbjct  503  ANPPTQKPAAYRPPHAKTAAAIQTKLFGGSSTEEMS  538



>gb|KDO64032.1| hypothetical protein CISIN_1g013871mg [Citrus sinensis]
 gb|KDO64033.1| hypothetical protein CISIN_1g013871mg [Citrus sinensis]
Length=434

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY   K+L TT+AE SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  257  GNLPGDMAFWDYVDGKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHHNG  316

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KL+QA+WKP SPDKFG+ISE +K+V SLK+ ETK QG GS
Sbjct  317  SLFFKKMFDKLFQAEWKPVSPDKFGDISELIKSVGSLKVAETKSQGSGS  365



>ref|XP_010268198.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X1 [Nelumbo nucifera]
Length=520

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK L TTKAE SVTSEWSP+G YFMTATTAPRLQVDN IK+FHHNG
Sbjct  336  GNLPGDMAFWDYVEKKLLGTTKAECSVTSEWSPNGLYFMTATTAPRLQVDNAIKIFHHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKM++KLYQA+WKPE+P+KFG+++E +K+VD+LK+DE K QGQG+K+S+ +TK   
Sbjct  396  SLYFKKMYDKLYQAEWKPEAPEKFGDVAELVKSVDALKVDEVKPQGQGAKSSQASTKKAT  455

Query  499  anppaqkpaayrpphakaaaavqAELF-GGNPSGELS  392
            +  P QKPAAYRPPHAK AAAVQA+LF GG+PS E+S
Sbjct  456  STIPVQKPAAYRPPHAKEAAAVQAQLFGGGSPSEEMS  492



>ref|XP_008222503.1| PREDICTED: eukaryotic translation initiation factor 2A [Prunus 
mume]
Length=517

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDG YFMTATTAPRLQVDNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYVEKKQLGTTRAELSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KLYQADWKPESPD+FG+I+E +K++ SLK+ ETK QG  S
Sbjct  397  SLFFKKMFDKLYQADWKPESPDRFGDIAELVKSIGSLKVVETKPQGDRS  445



>ref|XP_007050959.1| Eukaryotic translation initiation factor eIF2A family protein 
isoform 1 [Theobroma cacao]
 gb|EOX95116.1| Eukaryotic translation initiation factor eIF2A family protein 
isoform 1 [Theobroma cacao]
Length=558

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD+  KK+L TT+AE SVTSEWS DGRYFMTATTAPRLQVDN IK+FHHNG
Sbjct  380  GNLPGDMAFWDFVDKKQLGTTRAECSVTSEWSYDGRYFMTATTAPRLQVDNCIKIFHHNG  439

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL FKKMF+KL+QADWKPESPDKFGEI+E +K+VDS+K++ETK +GQGS
Sbjct  440  SLCFKKMFDKLFQADWKPESPDKFGEIAELIKSVDSMKVEETKPRGQGS  488



>ref|XP_010094120.1| hypothetical protein L484_018138 [Morus notabilis]
 gb|EXB55210.1| hypothetical protein L484_018138 [Morus notabilis]
Length=468

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TTKAELSVTSEWS DG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  275  GNLPGDMAFWDYTEKKQLGTTKAELSVTSEWSSDGCYFMTATTAPRLQVDNGIKIFHYNG  334

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SLYFKKMF+KL+QADWKPES D++G+I+E +KA+D+LK+DETK QG+ S
Sbjct  335  SLYFKKMFDKLFQADWKPESLDRYGDINELIKAIDTLKVDETKPQGEMS  383



>ref|XP_006478620.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Citrus 
sinensis]
Length=514

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY   K+L TT+AE SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYVDGKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KL+QA+WKP SPDKFG+ISE +K+V SLK+ ETK QG GS
Sbjct  397  SLFFKKMFDKLFQAEWKPVSPDKFGDISELIKSVGSLKVAETKSQGSGS  445



>ref|XP_006442822.1| hypothetical protein CICLE_v10019752mg [Citrus clementina]
 gb|ESR56062.1| hypothetical protein CICLE_v10019752mg [Citrus clementina]
Length=514

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY   K+L TT+AE SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYVDGKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KL+QA+WKP SPDKFG+ISE +K+V SLK+ ETK QG GS
Sbjct  397  SLFFKKMFDKLFQAEWKPVSPDKFGDISELIKSVGSLKVAETKSQGSGS  445



>ref|XP_009758480.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X2 [Nicotiana sylvestris]
Length=189

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  838  AXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGSLYFKKM  659
            A WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+FHHNGSLYFKKM
Sbjct  13   AFWDYKEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKIFHHNGSLYFKKM  72

Query  658  FEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttpanppaqk  479
            F++LY+ DWKPES +KFG+I + +KAV S+KIDE K  G+GSKA++   K TPANPPA K
Sbjct  73   FDRLYKVDWKPESVEKFGDIEDLVKAVGSVKIDEAKAPGKGSKATQAVPKATPANPPAAK  132

Query  478  paayrpphakaaaavqAELFGGNPSGELS  392
            PAAYRPPHAK AAAVQAELFGG+ SGELS
Sbjct  133  PAAYRPPHAKVAAAVQAELFGGSSSGELS  161



>gb|EYU40971.1| hypothetical protein MIMGU_mgv1a005360mg [Erythranthe guttata]
Length=487

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPG+MA WDY  KK+L  TKAELSV+SEWS DGRYFMTATTAPRLQVDNGIK+FHHNG
Sbjct  337  GNLPGNMAFWDYSEKKKLGDTKAELSVSSEWSSDGRYFMTATTAPRLQVDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFK+MFEKLYQ DWKPESPDKF +I+E LK+VDS+K++E   QGQG
Sbjct  397  SLYFKRMFEKLYQVDWKPESPDKFEDIAELLKSVDSIKLEEPPKQGQG  444



>ref|XP_009615607.1| PREDICTED: eukaryotic translation initiation factor 2A [Nicotiana 
tomentosiformis]
Length=520

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+FH NG
Sbjct  337  GNLPGDMAFWDYKEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGLKIFHQNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SLYFKKMF++LYQ DWKP S +KFG+I + +K V S+KIDE K  G+GSKA++   K TP
Sbjct  397  SLYFKKMFDRLYQVDWKPVSVEKFGDIEDLVKTVGSVKIDEAKAPGKGSKANQAVPKATP  456

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPA KPAAYRPPHAK AAAVQAELFGG+ SGELS
Sbjct  457  ANPPAAKPAAYRPPHAKVAAAVQAELFGGSSSGELS  492



>ref|XP_006442821.1| hypothetical protein CICLE_v10019752mg [Citrus clementina]
 gb|ESR56061.1| hypothetical protein CICLE_v10019752mg [Citrus clementina]
Length=512

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY   K+L TT+AE SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  337  GNLPGDMAFWDYVDGKQLGTTRAECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL+FKKMF+KL+QA+WKP SPDKFG+ISE +K+V SLK+ ETK QG  S
Sbjct  397  SLFFKKMFDKLFQAEWKPVSPDKFGDISELIKSVGSLKVAETKSQGSAS  445



>ref|XP_008454042.1| PREDICTED: eukaryotic translation initiation factor 2A [Cucumis 
melo]
Length=519

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L  TK+E SVTSEWSPDG+YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  336  GNLPGDMAFWDYKEKKQLGRTKSECSVTSEWSPDGQYFMTATTAPRLQVDNGIKIFHYNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            +LYFKKMF+KL+QADWKPES DKFGEI   +K+V+SL +D+ K QGQGS
Sbjct  396  ALYFKKMFDKLFQADWKPESSDKFGEIDLLVKSVESLNVDQKKTQGQGS  444



>ref|XP_011653038.1| PREDICTED: eukaryotic translation initiation factor 2A [Cucumis 
sativus]
 gb|KGN53022.1| hypothetical protein Csa_4G011690 [Cucumis sativus]
Length=519

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L  TKAE SVTSEWSPDG++FMTATTAPRLQVDNGIK+FH+NG
Sbjct  336  GNLPGDMAFWDYKEKKQLGRTKAECSVTSEWSPDGQFFMTATTAPRLQVDNGIKIFHYNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            +LYFKKMF+KL+QADWKPES DKFGEI   +K+V+SL +D+ K QGQGS
Sbjct  396  ALYFKKMFDKLFQADWKPESSDKFGEIDLLVKSVESLNVDQKKTQGQGS  444



>ref|XP_004309726.1| PREDICTED: eukaryotic translation initiation factor 2A [Fragaria 
vesca subsp. vesca]
Length=519

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L TTKAELSVTSEWSPDG YFMTATTAPRLQVDN IK+FHHNG
Sbjct  339  GNLPGDMAFWDYMEKKQLGTTKAELSVTSEWSPDGCYFMTATTAPRLQVDNEIKIFHHNG  398

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SL+FKKMF+KL+QADWKPESPD+F +ISE +K+  S+K+D  K QG+ SK+S+ + K  P
Sbjct  399  SLFFKKMFDKLFQADWKPESPDRFSDISELVKSFVSIKVDNAKPQGERSKSSQTSAKAIP  458

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
             NPPAQKPAAYRPP+AK AA VQAELFGG  S  +S
Sbjct  459  NNPPAQKPAAYRPPNAKQAAIVQAELFGGTSSETMS  494



>ref|XP_004505162.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Cicer 
arietinum]
Length=517

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  KK+L TTKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYVDKKQLGTTKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF+KLYQ DWKPESP KFG+I+E +K++DS+K+++ K  GQG
Sbjct  397  SLYFKKMFDKLYQVDWKPESPSKFGDITELIKSLDSIKLEDKKPSGQG  444



>ref|XP_008791788.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X2 [Phoenix dactylifera]
Length=514

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK L TTKAE SVTSEWSPDG YFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  336  GNLPGDMAFWDYSEKKLLGTTKAECSVTSEWSPDGHYFMTATTAPRLQIDNGIKIFHHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK  551
            +LYFKKMF KLYQA WKPE+P+KFG+I++ +K+V++LKIDE K
Sbjct  396  TLYFKKMFNKLYQAAWKPEAPEKFGDITDLVKSVNTLKIDEPK  438



>gb|AFK44469.1| unknown [Medicago truncatula]
Length=516

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  +K+LA+TKAE SV+SEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYVERKQLASTKAEWSVSSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFK+MF+KLYQADWKPESP KFG+I+E +K++DS+K+++ K  GQG
Sbjct  397  SLYFKQMFDKLYQADWKPESPSKFGDITELIKSLDSIKLEDKKPSGQG  444



>ref|XP_003608061.1| Eukaryotic translation initiation factor 2A [Medicago truncatula]
 gb|AES90258.1| eukaryotic translation initiation factor eIF2A-like protein [Medicago 
truncatula]
Length=516

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  +K+LA+TKAE SV+SEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYVERKQLASTKAEWSVSSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFK+MF+KLYQADWKPESP KFG+I+E +K++DS+K+++ K  GQG
Sbjct  397  SLYFKQMFDKLYQADWKPESPSKFGDITELIKSLDSIKLEDKKPSGQG  444



>ref|XP_003608062.1| Eukaryotic translation initiation factor 2A [Medicago truncatula]
 gb|AES90259.1| eukaryotic translation initiation factor eIF2A-like protein [Medicago 
truncatula]
Length=504

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  +K+LA+TKAE SV+SEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYVERKQLASTKAEWSVSSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFK+MF+KLYQADWKPESP KFG+I+E +K++DS+K+++ K  GQG
Sbjct  397  SLYFKQMFDKLYQADWKPESPSKFGDITELIKSLDSIKLEDKKPSGQG  444



>ref|XP_008791787.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X1 [Phoenix dactylifera]
Length=522

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK L TTKAE SVTSEWSPDG YFMTATTAPRLQ+DNGIK+FHHNG
Sbjct  336  GNLPGDMAFWDYSEKKLLGTTKAECSVTSEWSPDGHYFMTATTAPRLQIDNGIKIFHHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK  551
            +LYFKKMF KLYQA WKPE+P+KFG+I++ +K+V++LKIDE K
Sbjct  396  TLYFKKMFNKLYQAAWKPEAPEKFGDITDLVKSVNTLKIDEPK  438



>ref|XP_010069250.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Eucalyptus 
grandis]
Length=520

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L  TKAE SVTSEWSP+G YFMTATTAPRLQ+DN IK+FHHNG
Sbjct  337  GNLPGDMAFWDYREKKQLGATKAECSVTSEWSPNGCYFMTATTAPRLQIDNCIKIFHHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            SL+FKKMF+KLYQA+WK ESP+ FGE++E +K++DSLK++E K QGQ
Sbjct  397  SLFFKKMFDKLYQAEWKQESPESFGEVAELIKSIDSLKVEEQKPQGQ  443



>ref|XP_009758478.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X1 [Nicotiana sylvestris]
Length=203

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -2

Query  838  AXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGSLYFKKM  659
            A WDY  KK+L TT+AELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+FHHNGSLYFKKM
Sbjct  13   AFWDYKEKKQLGTTRAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKIFHHNGSLYFKKM  72

Query  658  FEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            F++LY+ DWKPES +KFG+I + +KAV S+KIDE K  G+GS
Sbjct  73   FDRLYKVDWKPESVEKFGDIEDLVKAVGSVKIDEAKAPGKGS  114



>gb|KCW44729.1| hypothetical protein EUGRSUZ_L01724 [Eucalyptus grandis]
Length=458

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            G LPGDMA WDY  KK+L TTKA+ SVTSEWSP+G YFMTATTAPRLQ+DN IK+ HHNG
Sbjct  275  GKLPGDMAFWDYREKKQLGTTKADCSVTSEWSPNGCYFMTATTAPRLQIDNCIKILHHNG  334

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            SL+FKKMF+KLYQA+WKPESP++F E++E +K+VDSLK++E K QGQ
Sbjct  335  SLFFKKMFDKLYQAEWKPESPERFCEVAELIKSVDSLKVEERKPQGQ  381



>gb|KHG22382.1| Eukaryotic translation initiation factor 2A [Gossypium arboreum]
Length=535

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L TT+AE SVT+EWS DG YFMTATTAPRLQVDN +K+F++NG
Sbjct  356  GNLPGDMAFWDIVDKKQLGTTRAECSVTNEWSADGCYFMTATTAPRLQVDNCVKIFNYNG  415

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SL FKKMF KL+QADWKPESPDKFGEI+E +K+V S+KI+ETK QGQGS       K   
Sbjct  416  SLLFKKMFNKLFQADWKPESPDKFGEIAELIKSVGSVKIEETKSQGQGS----TTKKPAS  471

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPAQKPAAYRPPHAK AAAVQAELFGG+ +GE+S
Sbjct  472  ANPPAQKPAAYRPPHAKNAAAVQAELFGGSSTGEMS  507



>ref|XP_010540054.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X2 [Tarenaya hassleriana]
Length=457

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L +TKAE SVTSEWS DGRYFMTA+TAPR QVDNGIK+F+++G
Sbjct  283  GNLPGDMAFWDVVNKKQLGSTKAEWSVTSEWSADGRYFMTASTAPRRQVDNGIKIFNYDG  342

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            +++FKKMF+KLYQADWKPESP+KFGEIS+ +K+V+SLK+ ETK QGQGS
Sbjct  343  TIHFKKMFDKLYQADWKPESPEKFGEISQLVKSVESLKVQETKPQGQGS  391



>gb|KCW57543.1| hypothetical protein EUGRSUZ_H00311 [Eucalyptus grandis]
Length=612

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK+L  TKAE SVTSEWSP+G YFMTATTAPRLQ+DN IK+FHHNG
Sbjct  429  GNLPGDMAFWDYREKKQLGATKAECSVTSEWSPNGCYFMTATTAPRLQIDNCIKIFHHNG  488

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            SL+FKKMF+KLYQA+WK ESP+ FGE++E +K++DSLK++E K QGQ
Sbjct  489  SLFFKKMFDKLYQAEWKQESPESFGEVAELIKSIDSLKVEEQKPQGQ  535



>ref|XP_010040986.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2A-like [Eucalyptus grandis]
Length=519

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            G LPGDMA WDY  KK+L TTKA+ SVTSEWSP+G YFMTATTAPRLQ+DN IK+ HHNG
Sbjct  336  GKLPGDMAFWDYREKKQLGTTKADCSVTSEWSPNGCYFMTATTAPRLQIDNCIKILHHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            SL+FKKMF+KLYQA+WKPESP++F E++E +K+VDSLK++E K QGQ
Sbjct  396  SLFFKKMFDKLYQAEWKPESPERFCEVAELIKSVDSLKVEERKPQGQ  442



>ref|XP_010540051.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010540053.1| PREDICTED: eukaryotic translation initiation factor 2A isoform 
X1 [Tarenaya hassleriana]
Length=508

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L +TKAE SVTSEWS DGRYFMTA+TAPR QVDNGIK+F+++G
Sbjct  334  GNLPGDMAFWDVVNKKQLGSTKAEWSVTSEWSADGRYFMTASTAPRRQVDNGIKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            +++FKKMF+KLYQADWKPESP+KFGEIS+ +K+V+SLK+ ETK QGQGS
Sbjct  394  TIHFKKMFDKLYQADWKPESPEKFGEISQLVKSVESLKVQETKPQGQGS  442



>gb|KJB27839.1| hypothetical protein B456_005G012500 [Gossypium raimondii]
Length=518

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L TT+AE SVTSEWS DG YFMTATTAPRLQVDN +K+F +NG
Sbjct  339  GNLPGDMAFWDIIDKKQLGTTRAECSVTSEWSADGCYFMTATTAPRLQVDNCVKIFSYNG  398

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SL FKKMF KL+QADWKPESPDKFGEI+E +K+V S+KI+ETK  GQGS       K   
Sbjct  399  SLLFKKMFNKLFQADWKPESPDKFGEIAELIKSVGSVKIEETKSLGQGS----TTKKPAS  454

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPAQKPAAYRPPHAK AAAVQAELFGG+ +GE+S
Sbjct  455  ANPPAQKPAAYRPPHAKNAAAVQAELFGGSSTGEMS  490



>gb|KJB27838.1| hypothetical protein B456_005G012500 [Gossypium raimondii]
Length=549

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L TT+AE SVTSEWS DG YFMTATTAPRLQVDN +K+F +NG
Sbjct  370  GNLPGDMAFWDIIDKKQLGTTRAECSVTSEWSADGCYFMTATTAPRLQVDNCVKIFSYNG  429

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
            SL FKKMF KL+QADWKPESPDKFGEI+E +K+V S+KI+ETK  GQGS       K   
Sbjct  430  SLLFKKMFNKLFQADWKPESPDKFGEIAELIKSVGSVKIEETKSLGQGS----TTKKPAS  485

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            ANPPAQKPAAYRPPHAK AAAVQAELFGG+ +GE+S
Sbjct  486  ANPPAQKPAAYRPPHAKNAAAVQAELFGGSSTGEMS  521



>ref|XP_003529378.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Glycine 
max]
 gb|KHN31036.1| Eukaryotic translation initiation factor 2A [Glycine soja]
Length=517

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  KK+L  TKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYIDKKQLGATKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF+KLYQADWKPESP KFG+I+E +K+++ +++++ K  GQG
Sbjct  397  SLYFKKMFDKLYQADWKPESPSKFGDIAELIKSLNLVQLEDKKPSGQG  444



>gb|KJB27837.1| hypothetical protein B456_005G012500 [Gossypium raimondii]
Length=513

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L TT+AE SVTSEWS DG YFMTATTAPRLQVDN +K+F +NG
Sbjct  370  GNLPGDMAFWDIIDKKQLGTTRAECSVTSEWSADGCYFMTATTAPRLQVDNCVKIFSYNG  429

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL FKKMF KL+QADWKPESPDKFGEI+E +K+V S+KI+ETK  GQGS
Sbjct  430  SLLFKKMFNKLFQADWKPESPDKFGEIAELIKSVGSVKIEETKSLGQGS  478



>ref|XP_004953030.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Setaria 
italica]
Length=523

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +A TKAE SVTSEWSPDGR+FMTATTAPRLQ+DNGIK+F HNG
Sbjct  337  GNLPGDMAFWDYSEKKLVAKTKAECSVTSEWSPDGRHFMTATTAPRLQIDNGIKIFDHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQ--GQGS  533
            SL FKKMFE+LYQADWKPE+P++FG+I++   ++ SL+I+ETK Q   QGS
Sbjct  397  SLQFKKMFERLYQADWKPEAPERFGDIADLTTSLSSLRIEETKKQASAQGS  447



>ref|XP_003518869.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Glycine 
max]
 gb|KHN32363.1| Eukaryotic translation initiation factor 2A [Glycine soja]
Length=518

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  KK+L  TKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYIDKKQLGATKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLYFKKMF+KLYQ DWKPESP KFG+I+E +K+++ +++++ K  GQG
Sbjct  397  SLYFKKMFDKLYQVDWKPESPGKFGDIAELIKSLNLVQLEDKKPSGQG  444



>ref|XP_006300463.1| hypothetical protein CARUB_v10020260mg [Capsella rubella]
 gb|EOA33361.1| hypothetical protein CARUB_v10020260mg [Capsella rubella]
Length=461

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPG MA WD   KK++ + KAE SVTSEWSPDGRYF+TATTAPRLQ+DNG+K+F+++G
Sbjct  283  GNLPGYMAFWDVVNKKQIGSNKAECSVTSEWSPDGRYFLTATTAPRLQIDNGLKIFNYDG  342

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              YFKKMFE+LYQA+WKPESPD+FGEISE +K+V+SLK+ + K QGQGS
Sbjct  343  KPYFKKMFERLYQAEWKPESPDRFGEISELIKSVESLKLGDGKSQGQGS  391



>ref|XP_007156559.1| hypothetical protein PHAVU_003G296400g [Phaseolus vulgaris]
 gb|ESW28553.1| hypothetical protein PHAVU_003G296400g [Phaseolus vulgaris]
Length=518

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WDY  KK+L TTKAE SVTSEWSPDG YFMTATTAPRLQVDNGIK+FH+NG
Sbjct  337  GNLPGDMVFWDYIDKKQLGTTKAEWSVTSEWSPDGCYFMTATTAPRLQVDNGIKIFHYNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK  551
            SLYFKKMF+KLYQADWKPESP KFG+I+E +K+++ +++++ K
Sbjct  397  SLYFKKMFDKLYQADWKPESPSKFGDIAELIKSLNLVQLEDKK  439



>ref|XP_002887475.1| hypothetical protein ARALYDRAFT_476449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63734.1| hypothetical protein ARALYDRAFT_476449 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDVVNKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGMKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              YFKKMFE+LYQA+WKPESPD+FG+ISE +K+V+SLK+ E K QGQGS
Sbjct  394  KRYFKKMFERLYQAEWKPESPDRFGDISELIKSVESLKLGEGKSQGQGS  442



>ref|XP_010471373.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Camelina 
sativa]
Length=511

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDVVSKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGMKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              YFKK FEKLYQA+WKPESPD+FGEISE +K+V+SLK+ E K QGQGS
Sbjct  394  KRYFKKAFEKLYQAEWKPESPDRFGEISELIKSVESLKLGEGKSQGQGS  442



>ref|XP_009104827.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Brassica 
rapa]
Length=513

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 4/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNGIK+F+++G
Sbjct  335  GNLPGDMTFWDVVSKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGIKIFNYDG  394

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
              YFKKMFE+LYQ +WKPESPD+F EISE LK+V+SLK++E K QGQGS       K   
Sbjct  395  KRYFKKMFERLYQVEWKPESPDRFDEISELLKSVESLKLEEGKSQGQGS----SQKKPVA  450

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            + P  Q+PAAYRPPHAK AAA+QAEL G NP GE+S
Sbjct  451  SIPTIQRPAAYRPPHAKQAAAIQAELLGVNPEGEMS  486



>ref|XP_006390583.1| hypothetical protein EUTSA_v10018413mg [Eutrema salsugineum]
 dbj|BAJ33996.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27869.1| hypothetical protein EUTSA_v10018413mg [Eutrema salsugineum]
Length=513

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDG YF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDIANKKQLGSNKAEWSVTSEWSPDGLYFLTASTAPRRQIDNGLKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
              YFKK FE+LYQA+WKPESPD+FGEISE +K+V+SLK++  K QGQGS       K   
Sbjct  394  KRYFKKNFERLYQAEWKPESPDRFGEISELIKSVESLKLEAGKSQGQGS-----TQKKAV  448

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            A    QKPAAYRPPHAK AAA+QAEL GGNP GE+S
Sbjct  449  APTTIQKPAAYRPPHAKHAAAIQAELLGGNPEGEMS  484



>emb|CDX68240.1| BnaA07g22800D [Brassica napus]
Length=513

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 4/156 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNGIK+F+++G
Sbjct  335  GNLPGDMTFWDVVSKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGIKIFNYDG  394

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttp  500
              YFKKMFE+LYQ +WKPESPD+F EISE LK+V+SLK++E K QGQGS       K   
Sbjct  395  KRYFKKMFERLYQVEWKPESPDRFDEISELLKSVESLKLEEGKSQGQGS----SQKKPVA  450

Query  499  anppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
            + P  Q+PAAYRPPHAK AAA+QAEL G NP GE+S
Sbjct  451  SIPTIQRPAAYRPPHAKQAAAIQAELLGVNPEGEMS  486



>ref|XP_009406438.1| PREDICTED: eukaryotic translation initiation factor 2A [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406439.1| PREDICTED: eukaryotic translation initiation factor 2A [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406440.1| PREDICTED: eukaryotic translation initiation factor 2A [Musa 
acuminata subsp. malaccensis]
Length=521

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK L TTKAE SVTSEWSPDG+YFMT TTAPRLQ+DNGIK+F ++G
Sbjct  337  GNLPGDMAFWDYTEKKLLGTTKAEWSVTSEWSPDGQYFMTVTTAPRLQIDNGIKIFRYDG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKID--ETKVQ  545
            SLYFKKMF KLYQADWKPE+P++F +I+E +K+V++LKID  E KVQ
Sbjct  397  SLYFKKMFSKLYQADWKPEAPERFDDINELVKSVETLKIDNNEKKVQ  443



>gb|EEC73558.1| hypothetical protein OsI_07992 [Oryza sativa Indica Group]
 gb|EEE57334.1| hypothetical protein OsJ_07449 [Oryza sativa Japonica Group]
Length=522

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +  TKAE SVTSEWSPDGR+FMTATTAPRLQ+DNGIK+F HNG
Sbjct  336  GNLPGDMAFWDYSEKKLVGKTKAECSVTSEWSPDGRHFMTATTAPRLQIDNGIKIFDHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK--VQGQGS  533
            SL FKKMFEKLYQADWKPE+P+KF +I++   ++ S+KI+ETK  V  QGS
Sbjct  396  SLQFKKMFEKLYQADWKPEAPEKFSDIADLTISLGSIKIEETKKQVSAQGS  446



>ref|XP_002452417.1| hypothetical protein SORBIDRAFT_04g025410 [Sorghum bicolor]
 gb|EES05393.1| hypothetical protein SORBIDRAFT_04g025410 [Sorghum bicolor]
Length=523

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +A TKAE SVTSEWSPDGR+FMTATTAPRLQ+DN IK+F HNG
Sbjct  337  GNLPGDMAFWDYSEKKLVAKTKAECSVTSEWSPDGRHFMTATTAPRLQIDNCIKIFDHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK--VQGQGS  533
            SL FKKMFE+LYQADWKPE P++F +I++   ++ +LKI+ETK  V  QGS
Sbjct  397  SLQFKKMFERLYQADWKPEVPERFSDIADLTTSLSTLKIEETKKQVSAQGS  447



>ref|XP_003575319.1| PREDICTED: eukaryotic translation initiation factor 2A [Brachypodium 
distachyon]
Length=521

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +  TKAE SVTSEWSPDGR+FMTATTAPRLQ+DNGIK+F HNG
Sbjct  336  GNLPGDMAFWDYSEKKLVGKTKAEWSVTSEWSPDGRHFMTATTAPRLQIDNGIKIFDHNG  395

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQG--QGS  533
            SL FKKMFEKLYQ DWKPE+P++FG+I++   +++++ IDETK  G  QGS
Sbjct  396  SLQFKKMFEKLYQVDWKPEAPERFGDIADLTTSLNNITIDETKKSGSAQGS  446



>ref|NP_001117592.1| eukaryotic translation initiation factor eIF2A-like protein [Arabidopsis 
thaliana]
 gb|AEE35426.1| eukaryotic translation initiation factor eIF2A-like protein [Arabidopsis 
thaliana]
Length=484

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDVVNKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGMKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              Y+KKMFE+LYQA+WKPESP++FG+ISE +K+V+SLK+ E K QGQGS
Sbjct  394  KRYYKKMFERLYQAEWKPESPERFGDISELIKSVESLKLGEGKSQGQGS  442



>ref|NP_565058.1| eukaryotic translation initiation factor eIF2A-like protein [Arabidopsis 
thaliana]
 gb|AAG52134.1|AC010556_16 unknown protein; 49372-46275 [Arabidopsis thaliana]
 gb|AAL07151.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14246.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35425.1| eukaryotic translation initiation factor eIF2A-like protein [Arabidopsis 
thaliana]
Length=513

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDVVNKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGMKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              Y+KKMFE+LYQA+WKPESP++FG+ISE +K+V+SLK+ E K QGQGS
Sbjct  394  KRYYKKMFERLYQAEWKPESPERFGDISELIKSVESLKLGEGKSQGQGS  442



>gb|AAM61003.1| unknown [Arabidopsis thaliana]
Length=512

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNG+K+F+++G
Sbjct  333  GNLPGDMAFWDVVNKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGMKIFNYDG  392

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              Y+KKMFE+LYQA+WKPESP++FG+ISE +K+V+SLK+ E K QGQGS
Sbjct  393  KRYYKKMFERLYQAEWKPESPERFGDISELIKSVESLKLGEGKSQGQGS  441



>ref|XP_010416106.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Camelina 
sativa]
Length=512

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNG+K+F+++G
Sbjct  335  GNLPGDMAFWDVVNKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGMKIFNYDG  394

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              YFKK FEKLYQA+WKP SPD+FGEISE +K+V+SLK+ E K QGQGS
Sbjct  395  KRYFKKAFEKLYQAEWKPVSPDRFGEISELIKSVESLKLGEGKSQGQGS  443



>ref|XP_010672409.1| PREDICTED: eukaryotic translation initiation factor 2A [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L TTKAE SVTSEWSP+G +FMTA+TAPR Q+DNGIK+F HNG
Sbjct  337  GNLPGDMAFWDCTEKKQLGTTKAEWSVTSEWSPNGCFFMTASTAPRRQIDNGIKIFLHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            SLY+KKMF+KL+QADWK ES DKFG+I+E +K+V SLK++E K QGQG
Sbjct  397  SLYYKKMFDKLFQADWKRESADKFGDIAELVKSVGSLKLEEEKSQGQG  444



>ref|XP_010428226.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X1 [Camelina sativa]
Length=511

 Score =   167 bits (422),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVT EWSPDG YF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDVVNKKQLGSNKAEWSVTHEWSPDGHYFLTASTAPRRQIDNGMKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
              YFKK FEKLYQA+WKPESPD+FGEISE +K+V+SLK+ E K QGQGS
Sbjct  394  KRYFKKAFEKLYQAEWKPESPDRFGEISELIKSVESLKLGEGKSQGQGS  442



>ref|NP_001159182.1| hypothetical protein [Zea mays]
 gb|ACN25338.1| unknown [Zea mays]
 gb|AFW72227.1| hypothetical protein ZEAMMB73_910567 [Zea mays]
Length=523

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +A TKAE SVTSEWSPDGR+FMTATTAPRLQ+DN IK+F HNG
Sbjct  337  GNLPGDMAFWDYSEKKLVAKTKAECSVTSEWSPDGRHFMTATTAPRLQIDNCIKIFDHNG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK--VQGQGS  533
            SL FKKMFE+LYQADWKPE+ ++F +I++   ++ +LKI+ETK  V  QGS
Sbjct  397  SLQFKKMFERLYQADWKPEAAERFTDIADLTTSLSTLKIEETKKQVSAQGS  447



>ref|XP_010428227.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X2 [Camelina sativa]
Length=507

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WD   KK+L + KAE SVT EWSPDG YF+TA+TAPR Q+DNG+K+F+++G
Sbjct  334  GNLPGDMAFWDVVNKKQLGSNKAEWSVTHEWSPDGHYFLTASTAPRRQIDNGMKIFNYDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
              YFKK FEKLYQA+WKPESPD+FGEISE +K+V+SLK+ E K QGQ
Sbjct  394  KRYFKKAFEKLYQAEWKPESPDRFGEISELIKSVESLKLGEGKSQGQ  440



>gb|AFW72228.1| hypothetical protein ZEAMMB73_910567 [Zea mays]
Length=181

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = -2

Query  841  MAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGSLYFKK  662
            MA WDY  KK +A TKAE SVTSEWSPDGR+FMTATTAPRLQ+DN IK+F HNGSL FKK
Sbjct  1    MAFWDYSEKKLVAKTKAECSVTSEWSPDGRHFMTATTAPRLQIDNCIKIFDHNGSLQFKK  60

Query  661  MFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK--VQGQGS  533
            MFE+LYQADWKPE+ ++F +I++   ++ +LKI+ETK  V  QGS
Sbjct  61   MFERLYQADWKPEAAERFTDIADLTTSLSTLKIEETKKQVSAQGS  105



>gb|EMS68178.1| Eukaryotic translation initiation factor 2A [Triticum urartu]
Length=476

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +   KAE SV SEWSPDGR+FMTATTAPRLQ+DN IK+F H G
Sbjct  263  GNLPGDMAFWDYSEKKLIQKAKAEWSVISEWSPDGRHFMTATTAPRLQIDNRIKIFDHTG  322

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL F K FEKLYQ DWKPESP++F +I+E   +++ LKI+ETK QGQGS
Sbjct  323  SLQFIKEFEKLYQVDWKPESPERFVDIAELTISLNGLKIEETKKQGQGS  371



>dbj|BAD19332.1| putative eukaryotic translation initiation factor 2A [Oryza sativa 
Japonica Group]
Length=506

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 92/121 (76%), Gaps = 13/121 (11%)
 Frame = -2

Query  856  NLPGDM-------------AXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQ  716
            +LPGD+             A WDY  KK +  TKAE SVTSEWSPDGR+FMTATTAPRLQ
Sbjct  310  DLPGDILDLILSTSYRFSRAFWDYSEKKLVGKTKAECSVTSEWSPDGRHFMTATTAPRLQ  369

Query  715  VDNGIKVFHHNGSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            +DNGIK+F HNGSL FKKMFEKLYQADWKPE+P+KF +I++   ++ S+KI+ETK Q QG
Sbjct  370  IDNGIKIFDHNGSLQFKKMFEKLYQADWKPEAPEKFSDIADLTISLGSIKIEETKKQAQG  429

Query  535  S  533
            S
Sbjct  430  S  430



>ref|XP_006856004.1| PREDICTED: eukaryotic translation initiation factor 2A [Amborella 
trichopoda]
 gb|ERN17471.1| hypothetical protein AMTR_s00059p00033770 [Amborella trichopoda]
Length=511

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA W    K+ L TTK+E SVTSEWSPDGRYFMTATTAPRLQ+DNGIK+FH +G
Sbjct  334  GNLPGDMAFWVCSEKRLLGTTKSECSVTSEWSPDGRYFMTATTAPRLQIDNGIKIFHLDG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDS-LKIDE  557
            SLYFKKMFEKLYQADWKPE+ ++FG+I E +K V + LKID+
Sbjct  394  SLYFKKMFEKLYQADWKPEAVERFGDIDELVKFVKTNLKIDD  435



>ref|XP_006647481.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2A-like [Oryza brachyantha]
Length=510

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -2

Query  838  AXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGSLYFKKM  659
            A WDY  KK +  TKAE SVTSEWSPDGR+FMTATTAPRLQ+DN IK+F HNGSL FKKM
Sbjct  334  AFWDYSEKKLVGKTKAECSVTSEWSPDGRHFMTATTAPRLQIDNCIKIFDHNGSLQFKKM  393

Query  658  FEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            FEKLYQADWKPE+P++FG+I++   A+ S+KI+E +V  QGS
Sbjct  394  FEKLYQADWKPEAPERFGDIADLTTALVSIKIEEKQVSAQGS  435



>gb|EPS73953.1| hypothetical protein M569_00803, partial [Genlisea aurea]
Length=474

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 85/102 (83%), Gaps = 3/102 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  K++L  TKAELSVTSEWSPDGRYFMTATTAPRLQVDNG+K+F  +G
Sbjct  337  GNLPGDMAFWDYIEKRKLGATKAELSVTSEWSPDGRYFMTATTAPRLQVDNGVKIFFPDG  396

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDET  554
            SLYFKKM +KL+QA+WKPE  DKFG++S  L   DSLK+ E 
Sbjct  397  SLYFKKMVDKLFQAEWKPECGDKFGDVSAVL---DSLKLGEA  435



>gb|ABR17269.1| unknown [Picea sitchensis]
Length=528

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPG+MA WD   KK L ++KAE SVTSEWSPDGRYFMTATTAPRLQVDNGIK+F +NG
Sbjct  334  GNLPGEMAFWDCSAKKLLGSSKAEWSVTSEWSPDGRYFMTATTAPRLQVDNGIKIFSYNG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV-DSLKIDETKVQGQGS  533
            SLYFKKMF+KLYQA+W+P     +G++ E ++ V ++L+I+ T    + S
Sbjct  394  SLYFKKMFDKLYQAEWRPAESTTYGDLPELVEQVKENLRIETTNAAPKTS  443



>emb|CDY11124.1| BnaC06g23760D [Brassica napus]
Length=567

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 115/157 (73%), Gaps = 5/157 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WD   KK+L + KAE SVTSEWSPDGRYF+TA+TAPR Q+DNGIK+F+++G
Sbjct  388  GNLPGDMTFWDVVSKKQLGSNKAEWSVTSEWSPDGRYFLTASTAPRRQIDNGIKIFNYDG  447

Query  679  SLYFKKMFEKLY-QADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatktt  503
                  +   L  + +WKPESPD+F EISE LK+V+SLK++E K QGQGS       K  
Sbjct  448  KPLKNIITTCLTKRVEWKPESPDRFDEISELLKSVESLKLEEGKSQGQGS----SQKKPV  503

Query  502  panppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
             + P  Q+PAAYRPPHAK AAA+QAEL G NP GE+S
Sbjct  504  ASIPTIQRPAAYRPPHAKQAAAIQAELLGVNPEGEMS  540



>gb|EMT21080.1| hypothetical protein F775_32515 [Aegilops tauschii]
Length=472

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -2

Query  817  KKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGSLYFKKMFEKLYQA  638
            KK +   KAE SV SEWSPDGR+FMTATTAPRLQ+DN IK+F H GSL F K FEKLYQ 
Sbjct  273  KKLIQKAKAEWSVISEWSPDGRHFMTATTAPRLQIDNRIKIFDHTGSLQFIKEFEKLYQV  332

Query  637  DWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            DWKPESP++FG+I+E   +++ +KI+ETK QGQGS
Sbjct  333  DWKPESPERFGDIAELTISLNGIKIEETKKQGQGS  367



>gb|AGU42080.1| eukaryotic translation initiation factor 2A, partial [Leymus 
chinensis]
Length=167

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDMA WDY  KK +   KAE SV SEWSPDGR+FMTATTAPRLQ+DNGIK+F H G
Sbjct  91   GNLPGDMAFWDYSEKKLVQKAKAEWSVISEWSPDGRHFMTATTAPRLQIDNGIKIFDHTG  150

Query  679  SLYFKKMFEKLYQADWK  629
            SL F+KMFEKLYQA+WK
Sbjct  151  SLQFEKMFEKLYQAEWK  167



>ref|XP_009758481.1| PREDICTED: eukaryotic translation initiation factor 2A-like isoform 
X3 [Nicotiana sylvestris]
Length=160

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  745  MTATTAPRLQVDNGIKVFHHNGSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLK  566
            MTATTAPRLQVDNG+K+FHHNGSLYFKKMF++LY+ DWKPES +KFG+I + +KAV S+K
Sbjct  1    MTATTAPRLQVDNGVKIFHHNGSLYFKKMFDRLYKVDWKPESVEKFGDIEDLVKAVGSVK  60

Query  565  IDETKVQGQGS  533
            IDE K  G+GS
Sbjct  61   IDEAKAPGKGS  71



>ref|XP_001775689.1| predicted protein [Physcomitrella patens]
 gb|EDQ59492.1| predicted protein [Physcomitrella patens]
Length=499

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGD+A WD    K   T KA ++VT+EWSPDGRYFMTATTAPRLQVDNG KVF ++G
Sbjct  331  GNLPGDVAFWDRESLKCFHTLKAPVTVTAEWSPDGRYFMTATTAPRLQVDNGFKVFKYDG  390

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            + +++K ++KLYQA+W+P S D +
Sbjct  391  TPHYEKKYDKLYQAEWRPASSDVY  414



>gb|AET00399.2| eukaryotic translation initiation factor eIF2A [Medicago truncatula]
Length=270

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 5/73 (7%)
 Frame = -2

Query  856  NLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGS  677
            N  G M  WDY  +K+L     E SV+SEWSP+G YFMTATT PRLQVDNGIK+FH+NGS
Sbjct  126  NQQGGMYFWDYVERKQL-----EWSVSSEWSPNGCYFMTATTTPRLQVDNGIKMFHYNGS  180

Query  676  LYFKKMFEKLYQA  638
            LYFK+MF+KLYQ+
Sbjct  181  LYFKQMFDKLYQS  193



>ref|XP_009355429.1| PREDICTED: eukaryotic translation initiation factor 2A-like, 
partial [Pyrus x bretschneideri]
Length=120

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVF  692
            GNLPGDMA WDY  KK+L TT+AEL VTSEWSPDGRYFMT TTAPRLQVDNGIK+ 
Sbjct  53   GNLPGDMAFWDYIEKKQLGTTRAELFVTSEWSPDGRYFMTVTTAPRLQVDNGIKII  108



>ref|XP_003617440.1| Disrupted meiotic cDNA [Medicago truncatula]
Length=358

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 5/69 (7%)
 Frame = -2

Query  841  MAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNGSLYFKK  662
            M  WDY  +K+L     E SV+SEWSP+G YFMTATT PRLQVDNGIK+FH+NGSLYFK+
Sbjct  212  MYFWDYVERKQL-----EWSVSSEWSPNGCYFMTATTTPRLQVDNGIKMFHYNGSLYFKQ  266

Query  661  MFEKLYQAD  635
            MF+KLYQ +
Sbjct  267  MFDKLYQVN  275



>ref|XP_002973604.1| hypothetical protein SELMODRAFT_149237 [Selaginella moellendorffii]
 gb|EFJ25264.1| hypothetical protein SELMODRAFT_149237 [Selaginella moellendorffii]
Length=552

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGDM  WD    K +  TK+  SVT EW+PDGR  MTATTAPR++VDNGI++F + G
Sbjct  323  GNLPGDMVFWDRNTLKSIGNTKSPCSVTCEWAPDGRLLMTATTAPRMRVDNGIRIFKYTG  382

Query  679  SLYFKKMFEKLYQADWKP  626
            +L  ++    LYQADW P
Sbjct  383  ALLEEQKINDLYQADWLP  400



>ref|XP_004512811.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Cicer 
arietinum]
Length=222

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNG  704
            GNLPGDM  WDY  KK+L TTKAE SVTSEWSPDG YFMTATTAPRLQVDNG
Sbjct  162  GNLPGDMVFWDYVDKKQLGTTKAEWSVTSEWSPDGCYFMTATTAPRLQVDNG  213



>ref|XP_007050961.1| Eukaryotic translation initiation factor eIF2A family protein 
isoform 3 [Theobroma cacao]
 gb|EOX95118.1| Eukaryotic translation initiation factor eIF2A family protein 
isoform 3 [Theobroma cacao]
Length=428

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDN---GIKVFH  689
            GNLPGDMA WD+  KK+L TT+AE SVTSEWS DGRYFMTATTAPRLQVDN    + VF 
Sbjct  339  GNLPGDMAFWDFVDKKQLGTTRAECSVTSEWSYDGRYFMTATTAPRLQVDNWYVVVDVFI  398

Query  688  HNG  680
            + G
Sbjct  399  YGG  401



>emb|CDY66322.1| BnaCnng50300D [Brassica napus]
Length=207

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 23/104 (22%)
 Frame = -2

Query  703  IKVFHHNGSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkas  524
            IK+F+++   YFKKMFE+LYQA+WKPE PD+F EISE +KAVDSLK+++ K QGQGS   
Sbjct  105  IKIFNYDRKRYFKKMFERLYQAEWKPEFPDRFSEISELVKAVDSLKLEDGKSQGQGS---  161

Query  523  kpatkttpanppaqkpaayrpphakaaaavqAELFGGNPSGELS  392
                                      AAA+QA+L GGNP+GE+S
Sbjct  162  --------------------AQKKAHAAAIQAKLLGGNPAGEMS  185



>dbj|GAA99129.1| hypothetical protein E5Q_05819 [Mixia osmundae IAM 14324]
Length=639

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  +D    K+L T  A  + T +WSPDGRY + AT +PRL+VDNGIK+FHH G
Sbjct  329  GNLAGEIDIYDRKTLKKLTTFDAPNTSTCQWSPDGRYLLCATLSPRLRVDNGIKLFHHTG  388

Query  679  SLYFKKMFEKLYQADWKP  626
            +L   +  E+LYQA W+P
Sbjct  389  ALVHVQDMEELYQAGWRP  406



>gb|KEI39231.1| hypothetical protein L969DRAFT_48767 [Mixia osmundae IAM 14324]
Length=647

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  +D    K+L T  A  + T +WSPDGRY + AT +PRL+VDNGIK+FHH G
Sbjct  337  GNLAGEIDIYDRKTLKKLTTFDAPNTSTCQWSPDGRYLLCATLSPRLRVDNGIKLFHHTG  396

Query  679  SLYFKKMFEKLYQADWKP  626
            +L   +  E+LYQA W+P
Sbjct  397  ALVHVQDMEELYQAGWRP  414



>ref|XP_003335452.2| hypothetical protein PGTG_17305 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP91033.2| hypothetical protein PGTG_17305 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=656

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G M  WD    +++AT +   +   EWSPDGR+ M AT +PRL+VDNG++VFH+ G
Sbjct  360  GNLAGTMDIWDRRTLEKVATIEGSNTSHCEWSPDGRFIMCATLSPRLRVDNGVRVFHYRG  419

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
             L      E LY A W+P++ ++F
Sbjct  420  QLIHVNPVEHLYAASWRPQAAERF  443



>ref|NP_001047375.2| Os02g0606100 [Oryza sativa Japonica Group]
 dbj|BAF09289.2| Os02g0606100, partial [Oryza sativa Japonica Group]
Length=138

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = -2

Query  706  GIKVFHHNGSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETK--VQGQGS  533
            GIK+F HNGSL FKKMFEKLYQADWKPE+P+KF +I++   ++ S+KI+ETK  V  QGS
Sbjct  3    GIKIFDHNGSLQFKKMFEKLYQADWKPEAPEKFSDIADLTISLGSIKIEETKKQVSAQGS  62



>gb|KJB27836.1| hypothetical protein B456_005G012500 [Gossypium raimondii]
Length=425

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDN  707
            GNLPGDMA WD   KK+L TT+AE SVTSEWS DG YFMTATTAPRLQVDN
Sbjct  370  GNLPGDMAFWDIIDKKQLGTTRAECSVTSEWSADGCYFMTATTAPRLQVDN  420



>ref|XP_004359476.1| eukaryotic translation initiation factor 2A [Dictyostelium fasciculatum]
 gb|EGG21626.1| eukaryotic translation initiation factor 2A [Dictyostelium fasciculatum]
Length=598

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GDM  WD    K +A+T A  +V +EW+ D  + +TA  +PR++VDNG+K+F ++G
Sbjct  359  GNLQGDMDFWDLTKFKRVASTTAHCAVYTEWAADSVHLLTAVLSPRIRVDNGVKLFRYDG  418

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEI  599
            S+ FK+   +LYQ  W+P+S   F ++
Sbjct  419  SIVFKQDIPELYQVLWRPQSAHAFADL  445



>ref|XP_003596987.1| ATP-dependent RNA helicase dhh1 [Medicago truncatula]
Length=488

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  739  ATTAPRLQVDNGIKVFHHNGSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKID  560
            A   P+   +  IK+FH+NGSLYFK+MF+KLYQADWKPESP KFG+++E +K++DS+K++
Sbjct  245  AEGIPKRSYNIDIKIFHYNGSLYFKQMFDKLYQADWKPESPSKFGDMTELIKSLDSIKLE  304

Query  559  ETKVQG  542
            + K  G
Sbjct  305  DKKPSG  310



>gb|KDE05020.1| hypothetical protein MVLG_04564 [Microbotryum violaceum p1A1 
Lamole]
Length=613

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K++ T +A  +V  EWSPDGRY M AT +PRL+VDNG++ +H  G
Sbjct  330  GNLAGQVDVWDRKTLKKVCTFEAPNTVHCEWSPDGRYLMCATLSPRLRVDNGVRFYHCTG  389

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            SL   +  E+LY   W+P   + F
Sbjct  390  SLMHIEAIEELYSVSWRPAPVNLF  413



>ref|XP_002492155.1| Eukaryotic initiation factor (eIF) 2A [Komagataella pastoris 
GS115]
 emb|CAY69875.1| Eukaryotic initiation factor (eIF) 2A [Komagataella pastoris 
GS115]
 emb|CCA37757.1| Eukaryotic translation initiation factor 2A [Komagataella pastoris 
CBS 7435]
Length=618

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (64%), Gaps = 6/99 (6%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K K++AT +A  +   EWSPDG+Y MTATT PRL+VDN  K++HH 
Sbjct  337  GNLQGTVEIYDRQDKFKKIATFEASNTSVCEWSPDGQYIMTATTVPRLRVDNCCKIWHHT  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLK  566
            G L + K +++L+ A W+P+    F       +A+DS+K
Sbjct  397  GELCYIKEYKELFSAKWRPQDSSLFDP-----RALDSIK  430



>ref|XP_002771283.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER03099.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=705

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GN+ G+M  WD    K + + +AE  V S W+PDGR+F TATT PR++VDN I ++ +NG
Sbjct  372  GNMAGEMDFWDMAECKVVGSLRAECPVISTWAPDGRHFSTATTWPRMRVDNKIDIYSYNG  431

Query  679  SLYFKKMFEKLYQADWKPES  620
             L  +  F +LY A WKP +
Sbjct  432  RLICRHEFNELYSASWKPSA  451



>ref|XP_002775504.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER07320.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=705

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GN+ G+M  WD    K + + +AE  V S W+PDGR+F TATT PR++VDN I ++ +NG
Sbjct  372  GNMAGEMDFWDMAECKVVGSLRAECPVISTWAPDGRHFSTATTWPRMRVDNKIDIYSYNG  431

Query  679  SLYFKKMFEKLYQADWKPES  620
             L  +  F +LY A WKP +
Sbjct  432  RLICRHEFNELYSASWKPSA  451



>ref|XP_007416969.1| hypothetical protein MELLADRAFT_50613 [Melampsora larici-populina 
98AG31]
 gb|EGF99705.1| hypothetical protein MELLADRAFT_50613 [Melampsora larici-populina 
98AG31]
Length=631

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K+++T +   +   EWSPDGR+ + AT +PRL+VDNGI++FH+ G
Sbjct  343  GNLAGTIDIWDRRTLKKVSTIEGSNTSHCEWSPDGRFILCATLSPRLRVDNGIRIFHYTG  402

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            SL   +  + LY A W+P S + F
Sbjct  403  SLVHLESIDNLYAASWRPASAELF  426



>gb|KFH69922.1| hypothetical protein MVEG_04726 [Mortierella verticillata NRRL 
6337]
Length=621

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G M  WD    K++ +  A  +   EWSPDGR+ +TAT +PRL+VDNG K++H+ G
Sbjct  331  GNLAGTMDFWDRKTLKKITSVSARDTTACEWSPDGRHILTATLSPRLRVDNGYKIWHYTG  390

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            +L   +   +LYQ  W+P +P+ +
Sbjct  391  TLVHVEEMNELYQVSWRPCAPEIY  414



>emb|CDR47229.1| RHTO0S14e00848g1_1 [Rhodosporidium toruloides]
Length=622

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D    K++ T  A  +V  EWS DGRY M AT +PRL+VDNGIK++H  G
Sbjct  332  GNLAGQIDIYDRQTLKKVTTFDAPNTVHCEWSADGRYLMCATLSPRLRVDNGIKMYHFTG  391

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   +  E+LYQA W+P +P+
Sbjct  392  GLLHVEQIEELYQASWRPANPE  413



>gb|EMS24744.1| eukaryotic translation initiation factor 2A [Rhodosporidium toruloides 
NP11]
Length=603

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D    K++ T  A  +V  EWS DGRY M AT +PRL+VDNGIK++H  G
Sbjct  313  GNLAGQIDIYDRQTLKKVTTFDAPNTVHCEWSADGRYLMCATLSPRLRVDNGIKMYHFTG  372

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   +  E+LYQA W+P +P+
Sbjct  373  GLLHVEQIEELYQASWRPANPE  394



>emb|CDH60138.1| eukaryotic translation initiation factor 2a [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=556

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    +++ T +A  +   EWSP GRY MTAT  PRL+VDNG K++HH+G
Sbjct  329  GNLNGTIDLWDRKTLRKVNTFQAPNASHCEWSPCGRYIMTATLTPRLRVDNGFKMWHHSG  388

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL +++  ++L+Q  W+PE    +  +         +KI   K     S
Sbjct  389  SLIYEESVDELFQVGWRPEPASAYPAMRGLSPPPKPIKISAGKTPAAAS  437



>emb|CEP07516.1| hypothetical protein [Parasitella parasitica]
Length=564

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K+++T  A  +   EWSP GRY +TAT  PRL+VDNG K++HH+G
Sbjct  334  GNLNGTVDLWDRKNLKKISTFAASNASHCEWSPCGRYLLTATLTPRLRVDNGFKLWHHSG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            +L +++  ++LYQ  ++PES  ++
Sbjct  394  TLIYEEAVDELYQISYRPESASRY  417



>ref|XP_666669.1| hypothetical protein [Cryptosporidium hominis TU502]
Length=586

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  WD   +K +  T A   +T EWS  GR+ + +TT+PRL+VDN I++F +NG
Sbjct  409  GNLAGDLDIWDLDKQKLIGQTNASCCITLEWSVCGRFLLASTTSPRLRVDNAIRIFRYNG  468

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L  +  F+ LY A W P++ D
Sbjct  469  DLLKRVNFDTLYSAYWSPKTAD  490



>ref|XP_628276.1| eIF-3A like translation initiation factor that has a WD40 repeat-containing 
beta propeller [Cryptosporidium parvum Iowa II]
 gb|EAK90565.1| eIF-3A like translation initiation factor that has a WD40 repeat-containing 
beta propeller [Cryptosporidium parvum Iowa II]
Length=586

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  WD   +K +  T A   +T EWS  GR+ + +TT+PRL+VDN I++F +NG
Sbjct  409  GNLAGDLDIWDLDKQKLIGQTNASCCITLEWSVCGRFLLASTTSPRLRVDNAIRIFRYNG  468

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L  +  F+ LY A W P++ D
Sbjct  469  DLLKRVNFDTLYSAYWSPKTAD  490



>gb|EFA83818.1| eukaryotic translation initiation factor 2A [Polysphondylium 
pallidum PN500]
Length=620

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GDM  WD    K++ +T A  +  SEW+ D  +F+TA  +PR++VDNGI+V  ++G
Sbjct  359  GNLQGDMDFWDLTRYKKIVSTHAHCATYSEWAADSIHFLTAVLSPRIRVDNGIRVIKYDG  418

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            S  +++   +LYQA W+P++P  F
Sbjct  419  STVYQEQIPELYQAFWRPQNPLAF  442



>emb|CDS03260.1| hypothetical protein LRAMOSA00662 [Absidia idahoensis var. thermophila]
Length=556

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 61/109 (56%), Gaps = 0/109 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    +++ T +A  +   EWSP GRY MTAT  PRL+VDNG K++HH+G
Sbjct  329  GNLNGTIDLWDRKTLRKVNTFQAPNASHCEWSPCGRYIMTATLTPRLRVDNGFKMWHHSG  388

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGS  533
            SL +++  ++L+Q  W+PE    +  +         +K+   K     S
Sbjct  389  SLIYEESVDELFQVGWRPEPASAYPAMRGLSPPPKPIKVSAGKTTASSS  437



>ref|XP_003021920.1| hypothetical protein TRV_03950 [Trichophyton verrucosum HKI 0517]
 gb|EFE41302.1| hypothetical protein TRV_03950 [Trichophyton verrucosum HKI 0517]
Length=686

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  285  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  344

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  345  GALMYNEDMNELYSVSWRPQSPNSHPLTSNPLNPV  379



>ref|XP_003014681.1| hypothetical protein ARB_07243 [Arthroderma benhamiae CBS 112371]
 gb|EFE33778.1| hypothetical protein ARB_07243 [Arthroderma benhamiae CBS 112371]
Length=702

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  301  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  360

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  361  GALMYNEDMNELYSVSWRPQSPNSHPLTSNPLNPV  395



>gb|EZG03550.1| hypothetical protein H106_06998 [Trichophyton rubrum CBS 735.88]
Length=736

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  396  GALMYNEDMNELYSVSWRPQSPNSHPLTSNPLNPV  430



>gb|EZF70534.1| hypothetical protein H105_07173 [Trichophyton soudanense CBS 
452.61]
Length=736

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  396  GALMYNEDMNELYSVSWRPQSPNSHPLTSNPLNPV  430



>ref|XP_003237774.1| eukaryotic translation initiation factor 2A [Trichophyton rubrum 
CBS 118892]
 gb|EGD86225.1| hypothetical protein TERG_02486 [Trichophyton rubrum CBS 118892]
 gb|EZF11619.1| hypothetical protein H100_07178 [Trichophyton rubrum MR850]
 gb|EZF38656.1| hypothetical protein H102_07138 [Trichophyton rubrum CBS 100081]
 gb|EZF49280.1| hypothetical protein H103_07161 [Trichophyton rubrum CBS 288.86]
 gb|EZF59908.1| hypothetical protein H104_07115 [Trichophyton rubrum CBS 289.86]
 gb|EZF81169.1| hypothetical protein H110_07161 [Trichophyton rubrum MR1448]
 gb|EZF91717.1| hypothetical protein H113_07214 [Trichophyton rubrum MR1459]
 gb|EZG13442.1| hypothetical protein H107_07321 [Trichophyton rubrum CBS 202.88]
 gb|KDB30296.1| hypothetical protein H112_07153 [Trichophyton rubrum D6]
Length=736

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  396  GALMYNEDMNELYSVSWRPQSPNSHPLTSNPLNPV  430



>gb|EZF30182.1| hypothetical protein H101_06175 [Trichophyton interdigitale H6]
 gb|KDB21141.1| hypothetical protein H109_06908 [Trichophyton interdigitale MR816]
Length=532

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  131  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  190

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  191  GALMYNEDMNELYSVSWRPQSPNCHPLTSNPLNPV  225



>ref|XP_625143.2| PREDICTED: eukaryotic translation initiation factor 2A-like [Apis 
mellifera]
Length=577

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD G +K +A T+A  +   +WSPDG +FMTATTAPRL++ NG K++H+ G
Sbjct  334  GNLRGGIELWDVGNRKLIAKTEAPDTTLLQWSPDGEHFMTATTAPRLRMGNGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            +L +++ +   E+L++  W+  SP  F E     KAV+ +   + +   Q
Sbjct  394  TLLYERPWNEQEELWEVLWQTFSPGTFPEKPISYKAVEGIAPSQPQASKQ  443



>ref|XP_457760.2| DEHA2C01826p [Debaryomyces hansenii CBS767]
 emb|CAG85796.2| DEHA2C01826p [Debaryomyces hansenii CBS767]
Length=620

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K  ++ T +A  +   EWSP GRY +TATT+PRL+VDNG K++H +
Sbjct  341  GNLQGTVDVYDRQNKFSKVVTFEAANTSVCEWSPCGRYILTATTSPRLRVDNGCKIWHAS  400

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G L + K +++LY   WKP+S DKF
Sbjct  401  GKLVYLKEYQELYSITWKPQSLDKF  425



>ref|NP_001153415.1| eukaryotic translation initiation factor 2A [Nasonia vitripennis]
Length=584

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   KK +AT++A  +   EWSPDG +++TATTAPRL++ NG K+FH+ G
Sbjct  334  GNLRGGIELWDIANKKMIATSEAPDTTLLEWSPDGEHYITATTAPRLRMSNGFKIFHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            +L +++ +   E+L++  W+   P+ F E     KAV+ +   + +   Q
Sbjct  394  TLLYERPWNKQEELWEVLWQRFPPNTFKEKPISYKAVEGIAPSQPQASKQ  443



>ref|XP_002787751.1| hypothetical protein Pmar_PMAR012528 [Perkinsus marinus ATCC 
50983]
 gb|EER19547.1| hypothetical protein Pmar_PMAR012528 [Perkinsus marinus ATCC 
50983]
Length=723

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GN+ G+M  WD    K + + +AE  V S W+PDGR+F TATT PR++VDN I ++ + G
Sbjct  376  GNMAGEMDFWDMAEYKVVGSLRAECPVISVWAPDGRHFSTATTWPRMRVDNKIDIYSYTG  435

Query  679  SLYFKKMFEKLYQADWKPES  620
             L  +  F++LY A WKP +
Sbjct  436  RLICRHEFDELYSASWKPST  455



>ref|XP_008212385.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2A isoform X1 [Nasonia vitripennis]
Length=584

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   KK +AT++A  +   EWSPDG +++TATTAPRL++ NG K+FH+ G
Sbjct  334  GNLRGGIELWDIANKKMIATSEAPDTTLLEWSPDGEHYITATTAPRLRMSNGFKIFHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            +L +++ +   E+L++  W+   P+ F E     KAV+ +   + +   Q
Sbjct  394  TLLYERPWNKQEELWEVLWQRFPPNTFKEKPISYKAVEGIAPSQPQASKQ  443



>ref|XP_003696259.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 2A-like [Apis florea]
Length=581

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD G +K +A T+A  +   +WSPDG +FMTATTAPRL++ NG K++H+ G
Sbjct  334  GNLRGGIELWDVGNRKLIAKTEAPDTTLLQWSPDGEHFMTATTAPRLRMGNGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            +L +++ +   E+L++  W+  SP  F E     KAV+ +   + +   Q
Sbjct  394  TLLYERPWNEQEELWEVLWQTFSPGTFPEKPISYKAVEGIAPSQPQASKQ  443



>gb|EZF30181.1| hypothetical protein H101_06175 [Trichophyton interdigitale H6]
 gb|KDB21140.1| hypothetical protein H109_06908 [Trichophyton interdigitale MR816]
Length=737

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  396  GALMYNEDMNELYSVSWRPQSPNCHPLTSNPLNPV  430



>gb|EGE00539.1| eukaryotic translation initiation factor 2A [Trichophyton tonsurans 
CBS 112818]
 gb|EGE08919.1| eukaryotic translation initiation factor 2A [Trichophyton equinum 
CBS 127.97]
Length=737

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWHVT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
            G+L + +   +LY   W+P+SP+     S  L  V
Sbjct  396  GALMYNEDMNELYSVSWRPQSPNCHPLTSNPLNPV  430



>ref|XP_002141246.1| hypothetical protein [Cryptosporidium muris RN66]
 gb|EEA06897.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
Length=583

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  WD   +K +  T A   +T EWS DGRY + +TT+PRL+VDN I+VF +NG
Sbjct  386  GNLAGELDIWDVTKQKLIGQTNASCCITLEWSFDGRYLLASTTSPRLRVDNAIRVFRYNG  445

Query  679  SLYFKKMFEKLYQADWKP  626
             L  +  F+ LY A W P
Sbjct  446  DLLGRIDFDTLYSAFWTP  463



>ref|XP_001616596.1| hypothetical protein [Plasmodium vivax Sal-1]
 gb|EDL46869.1| hypothetical protein, conserved [Plasmodium vivax]
Length=677

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  W+   KKE+  TK+  +V  E+  DG++F+TATT PRL+VDN +K+F HNG
Sbjct  481  GNLSGDITLWNTSTKKEVTKTKSSCAVVCEFFNDGKHFLTATTHPRLRVDNHLKIFTHNG  540

Query  679  SLYFKKMFEKLYQADWKPESPDKFGE  602
             +  +  FE+LY     P +  KF E
Sbjct  541  FIVSRINFEELYNVIILPLNKIKFCE  566



>gb|KIL68462.1| hypothetical protein M378DRAFT_8534 [Amanita muscaria Koide BX008]
Length=651

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  333  GNLAGKIDIYDRRTLSKVCTIDAPNTSHCEWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKPESPD---KFGEI  599
             +   ++ E+LYQA W+P   D   +FG I
Sbjct  393  PMMHVQLTEELYQASWRPHPADSAPQFGPI  422



>gb|KIY91464.1| Eukaryotic translation initiation factor 2A [Monoraphidium neglectum]
Length=165

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = -2

Query  859  GNLPGDMAXW---DYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+  W   + G  K++A T++E +V + WSP GRY MT+T APRL+VDN +KVF 
Sbjct  41   GNLPGDLVFWSKLNKGACKQIAATRSE-AVNASWSPCGRYVMTSTVAPRLRVDNNVKVFT  99

Query  688  HNGSLYFKKMFEKLYQADWKPESPDKF  608
            + G    +K F+ L +A W P     F
Sbjct  100  YYGEKVAEKKFDVLLEAQWLPAPSGTF  126



>ref|XP_001840028.2| eukaryotic translation initiation factor 2A [Coprinopsis cinerea 
okayama7#130]
 gb|EAU81809.2| eukaryotic translation initiation factor 2A [Coprinopsis cinerea 
okayama7#130]
Length=669

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G M  +D    K+L T  A  +   EWSPDGR+ +TAT +PRL+VDNG+K++H  G
Sbjct  333  GNLAGKMDIFDRRTVKKLCTIDAPNTSHCEWSPDGRFILTATLSPRLRVDNGVKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKP  626
             L   +  E+LYQA W+P
Sbjct  393  PLVHIQATEELYQASWRP  410



>gb|KIP07516.1| hypothetical protein PHLGIDRAFT_105620 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=623

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK+FH +G
Sbjct  334  GNLAGKVDIYDRRTLNKVTTVDASNTSHCEWSPDGRFLLTATLSPRLRVDNGIKIFHCSG  393

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   +  E+LYQA W+P   D
Sbjct  394  PLMHVQPVEELYQASWRPTHVD  415



>emb|CDO66847.1| eukaryotic translation initiation factor eIF2A, putative [Plasmodium 
reichenowi]
Length=673

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD++ W+   KKE+  TK+  +V  E+  DG++F+TATT PRL+VDN +K+F +NG
Sbjct  497  GNLSGDISIWNTSTKKEITKTKSSCAVICEFFNDGKHFLTATTHPRLRVDNNLKIFKYNG  556

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISE  593
             +  +  FE+LY     P +  KF +  E
Sbjct  557  LIVSRINFEELYNVIILPFNKIKFQQTEE  585



>gb|ETW16172.1| hypothetical protein PFFVO_05003 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
Length=660

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD++ W+   KKE+  TK+  +V  E+  DG++F+TATT PRL+VDN +K+F +NG
Sbjct  485  GNLSGDISIWNTSTKKEITKTKSSCAVICEFFNDGKHFLTATTHPRLRVDNNLKIFKYNG  544

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISE  593
             +  +  FE+LY     P +  KF +  E
Sbjct  545  LIVSRINFEELYNVIILPFNKIKFQQTEE  573



>ref|XP_001348534.1| eIF2A [Plasmodium falciparum 3D7]
 gb|AAN36973.1| eIF2A [Plasmodium falciparum 3D7]
 gb|ETW33895.1| hypothetical protein PFTANZ_05348 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW39896.1| hypothetical protein PFNF135_05924 [Plasmodium falciparum NF135/5.C10]
 gb|ETW46754.1| hypothetical protein PFMALIP_05205 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW54026.1| hypothetical protein PFUGPA_03898 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW58333.1| hypothetical protein PFMC_05436 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUT78885.1| hypothetical protein PFAG_05461 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC73827.1| hypothetical protein C923_05491 [Plasmodium falciparum UGT5.1]
 gb|EWC85743.1| hypothetical protein PFNF54_05409 [Plasmodium falciparum NF54]
Length=661

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD++ W+   KKE+  TK+  +V  E+  DG++F+TATT PRL+VDN +K+F +NG
Sbjct  485  GNLSGDISIWNTSTKKEITKTKSSCAVICEFFNDGKHFLTATTHPRLRVDNNLKIFKYNG  544

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISE  593
             +  +  FE+LY     P +  KF +  E
Sbjct  545  LIVSRINFEELYNVIILPFNKIKFQQTEE  573



>gb|EUR62824.1| hypothetical protein PFBG_05429 [Plasmodium falciparum 7G8]
Length=661

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD++ W+   KKE+  TK+  +V  E+  DG++F+TATT PRL+VDN +K+F +NG
Sbjct  485  GNLSGDISIWNTSTKKEITKTKSSCAVICEFFNDGKHFLTATTHPRLRVDNNLKIFKYNG  544

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISE  593
             +  +  FE+LY     P +  KF +  E
Sbjct  545  LIVSRINFEELYNVIILPFNKIKFQQTEE  573



>ref|XP_003707307.1| PREDICTED: eukaryotic translation initiation factor 2A [Megachile 
rotundata]
Length=579

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 67/111 (60%), Gaps = 3/111 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD G +K +A T+A  +   +WSPDG +FMTATTAPRL++ NG K++H+ G
Sbjct  334  GNLRGGIELWDVGNRKLIAKTEAPDTTLLQWSPDGEHFMTATTAPRLRMGNGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            +L +++ +   E+L++  W+   P  F E     KAV+ +   + +   Q 
Sbjct  394  TLLYERPWNEQEELWEVLWQTFPPQTFPEKPISYKAVEGIAPSQPQASKQA  444



>ref|XP_638688.1| eukaryotic translation initiation factor 2A [Dictyostelium discoideum 
AX4]
 sp|Q54PV7.1|EIF2A_DICDI RecName: Full=Eukaryotic translation initiation factor 2A; Short=eIF-2A 
[Dictyostelium discoideum]
 gb|EAL65322.1| eukaryotic translation initiation factor 2A [Dictyostelium discoideum 
AX4]
Length=608

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GDM  WD    K +  T++  ++ +EWS D  +FMTA  +PR++VDNG+K+  ++ 
Sbjct  374  GNLQGDMDFWDLTRYKRICGTQSHCAIYTEWSADSVHFMTAVLSPRIRVDNGVKIIKYDN  433

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            ++ +++   +LYQA W+P +P  F
Sbjct  434  TIVYQENIPELYQASWRPLNPLVF  457



>ref|XP_003173016.1| eukaryotic translation initiation factor 2A [Microsporum gypseum 
CBS 118893]
 gb|EFR02605.1| eukaryotic translation initiation factor 2A [Microsporum gypseum 
CBS 118893]
Length=736

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDG++ +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDVEKDYKKIVTIEASNASVCEWSPDGKHILTATTSPRLRVDNGVRIWHVT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDS  572
            G+L + +   +LY   W+P+SP+     S  L  V S
Sbjct  396  GALMYNEDMNELYSVAWRPQSPNSHPLTSNPLTPVPS  432



>ref|XP_002952956.1| eukaryotic translation initiation factor [Volvox carteri f. nagariensis]
 gb|EFJ45878.1| eukaryotic translation initiation factor [Volvox carteri f. nagariensis]
Length=658

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 66/107 (62%), Gaps = 14/107 (13%)
 Frame = -2

Query  859  GNLPGDMAXWD---YGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+  +D    G  K++   ++  +V++EWSPDGR  +TATTAPRL+VDN IKVF 
Sbjct  357  GNLPGDIVFYDKKTSGTCKQMGAVRSP-AVSAEWSPDGRLLLTATTAPRLRVDNNIKVFT  415

Query  688  HNGSLYFKKMFEKLYQADW----------KPESPDKFGEISEFLKAV  578
            ++G     + FE L +A W          +P+SP++   +++  +AV
Sbjct  416  YHGEERLHQRFETLLEARWRPAPRGAFQDRPQSPERLEAVAKGGEAV  462



>ref|XP_009268229.1| Eukaryotic translation initiation factor 2A [Wallemia ichthyophaga 
EXF-994]
 gb|EOR00952.1| Eukaryotic translation initiation factor 2A [Wallemia ichthyophaga 
EXF-994]
Length=549

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K++       +   EWSPDGR+ +TAT +PRL+VDNG+KV+H  G
Sbjct  324  GNLAGQVDIWDRKSLKKVCQIDCSNTSHCEWSPDGRFILTATCSPRLRVDNGVKVWHLTG  383

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
             L   K  E+LYQ  W+P+    F
Sbjct  384  KLIDIKPIEELYQVHWRPQDVSNF  407



>ref|XP_006675197.1| hypothetical protein BATDEDRAFT_18651 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84373.1| hypothetical protein BATDEDRAFT_18651 [Batrachochytrium dendrobatidis 
JAM81]
Length=573

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GDM  WD    K++ T KA  S + +W+PDG++ MT+T   RL+VDNGIK++H+ G
Sbjct  338  GNLAGDMDIWDRRSFKKMCTIKASNSSSCDWAPDGKHIMTSTLYKRLKVDNGIKIWHYTG  397

Query  679  SLYFKKMFEKLYQADWKPESPD  614
            +L  +   ++++Q  W P S D
Sbjct  398  ALVHQVQVKEMHQTSWMPASRD  419



>ref|XP_006611440.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Apis 
dorsata]
Length=577

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD G +K +A T+A  +   +WSPDG +FMTATTAPRL++ NG K++H+ G
Sbjct  334  GNLRGGIELWDVGNRKLIAKTEAPDTTLLQWSPDGEHFMTATTAPRLRMGNGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAV  578
            +L +++ +   E+L++  W+  SP  F E     KAV
Sbjct  394  TLLYERPWNEQEELWEVLWQTFSPGTFPEKPISYKAV  430



>gb|KJP88971.1| hypothetical protein AK88_01263 [Plasmodium fragile]
Length=655

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  W+   KKE++ TKA  +V  E+  DG++F+TATT PRL+VDN +K+F H+G
Sbjct  471  GNLSGDITVWNTSTKKEVSKTKASCAVICEFFNDGKHFLTATTHPRLRVDNHLKIFTHDG  530

Query  679  SLYFKKMFEKLYQADWKPESPDKFGE  602
             +  +  FE+LY+    P +   F E
Sbjct  531  FIVSRINFEELYKVIILPFNKINFAE  556



>ref|XP_006957322.1| translation initiation factor eIF-2A [Wallemia sebi CBS 633.66]
 gb|EIM22657.1| translation initiation factor eIF-2A [Wallemia sebi CBS 633.66]
Length=549

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD     ++       +   EWSPDGRY +TAT +PRL+VDNG+K++H  G
Sbjct  324  GNLAGQVDIWDRRTLSKVCQIDCSNTSHCEWSPDGRYILTATCSPRLRVDNGVKLWHLTG  383

Query  679  SLYFKKMFEKLYQADWKPES----PDKFGEISEFLKAVDSLKI  563
             L      E+LYQ  WKP      P+   EI    K  DS+KI
Sbjct  384  KLIHIHPIEELYQVHWKPVDVKSFPEFRNEIEPAPKPHDSVKI  426



>ref|XP_011085364.1| PREDICTED: uncharacterized protein LOC105167374 [Sesamum indicum]
Length=115

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  661  MFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQGSkaskpatkttpanppaq  482
            MF+KL+Q DWKPESPDKFG+I+E  K+VDSLK++ET  QGQGSK ++ ++KT  +NP  Q
Sbjct  1    MFDKLFQVDWKPESPDKFGDITELSKSVDSLKLEETTRQGQGSKTTQASSKTASSNPSVQ  60

Query  481  kpaayrpphakaaaavqAELFGGNPSGELS  392
            KPAAYRPPHAKAAAAVQAELFG +PSGE+S
Sbjct  61   KPAAYRPPHAKAAAAVQAELFGVSPSGEMS  90



>gb|KHJ32293.1| putative eukaryotic translation initiation factor 2a protein 
[Erysiphe necator]
Length=688

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +       EWSPD RY +TATT+PRL+VDNG++++H  
Sbjct  336  GNLAGQMDIYDLEKNYKKICTIEGGNPSVCEWSPDSRYILTATTSPRLRVDNGVRIWHVG  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEI  599
            GS+ + +   +LYQ  W+P++ D F E+
Sbjct  396  GSIMYNQDMVELYQVTWRPQNFDVFPEV  423



>ref|XP_003286563.1| hypothetical protein DICPUDRAFT_31095 [Dictyostelium purpureum]
 gb|EGC36920.1| hypothetical protein DICPUDRAFT_31095 [Dictyostelium purpureum]
Length=575

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GDM  WD    +++ +T++  +V +EW+ D  +FMTA  +PR++VDNGIK+  ++ 
Sbjct  340  GNLQGDMDFWDLTRYRKICSTQSHCAVFTEWAADSIHFMTAVLSPRIRVDNGIKIQRYDN  399

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            ++ +K+   +LYQA W+P +P  F
Sbjct  400  TVVYKEDIPELYQALWRPLNPLSF  423



>gb|EXX52633.1| hypothetical protein RirG_251340 [Rhizophagus irregularis DAOM 
197198w]
Length=562

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G+M  WD    K++A  +A  S  S WSPDG Y MTA  +PRL+VDNG K++H+ G
Sbjct  314  GNLKGEMDIWDRKTLKKIAEIEAPNSSESSWSPDGIYIMTAILSPRLRVDNGYKIWHYTG  373

Query  679  SLYFKKMFEKLYQADWKPES  620
            SL   +  ++L Q  W+P S
Sbjct  374  SLVHNQNIDELLQIQWRPTS  393



>gb|ESA18036.1| hypothetical protein GLOINDRAFT_145685 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52632.1| hypothetical protein RirG_251340 [Rhizophagus irregularis DAOM 
197198w]
Length=581

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G+M  WD    K++A  +A  S  S WSPDG Y MTA  +PRL+VDNG K++H+ G
Sbjct  333  GNLKGEMDIWDRKTLKKIAEIEAPNSSESSWSPDGIYIMTAILSPRLRVDNGYKIWHYTG  392

Query  679  SLYFKKMFEKLYQADWKPES  620
            SL   +  ++L Q  W+P S
Sbjct  393  SLVHNQNIDELLQIQWRPTS  412



>ref|XP_001418583.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96876.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=563

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -2

Query  859  GNLPGDMAXWDY---GXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+  +     G  K + +T+A  SVT EWSPDGR  +T+T APRL VDNG K++ 
Sbjct  360  GNLPGDVKFFQKMKDGKYKPIGSTRASCSVTLEWSPDGRRLLTSTIAPRLNVDNGWKIWR  419

Query  688  HNGSLYFKKMFEKLYQADWKP  626
            +NG L   +   K+Y+A W+P
Sbjct  420  YNGDLLLHEERAKIYEATWRP  440



>gb|EXX52631.1| hypothetical protein RirG_251340 [Rhizophagus irregularis DAOM 
197198w]
Length=582

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G+M  WD    K++A  +A  S  S WSPDG Y MTA  +PRL+VDNG K++H+ G
Sbjct  333  GNLKGEMDIWDRKTLKKIAEIEAPNSSESSWSPDGIYIMTAILSPRLRVDNGYKIWHYTG  392

Query  679  SLYFKKMFEKLYQADWKPES  620
            SL   +  ++L Q  W+P S
Sbjct  393  SLVHNQNIDELLQIQWRPTS  412



>ref|XP_009689476.1| uncharacterized protein TOT_010000636 [Theileria orientalis strain 
Shintoku]
 dbj|BAM39175.1| uncharacterized protein TOT_010000636 [Theileria orientalis strain 
Shintoku]
Length=539

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  WD   K+++A +K++ SVT E+SPDGRYF+TATT PR++VD   K+F H G
Sbjct  380  GNLRGEIDIWDMKTKRKIAQSKSDCSVTCEFSPDGRYFVTATTVPRMRVDCCFKIFTHGG  439

Query  679  SLYFKKMFEKLYQA  638
             L  K  F +LY  
Sbjct  440  KLIKKVDFGELYHV  453



>ref|XP_007875224.1| hypothetical protein PNEG_03161 [Pneumocystis murina B123]
 gb|EMR08321.1| hypothetical protein PNEG_03161 [Pneumocystis murina B123]
Length=605

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   + K++ T +A  S   EWSPDGR+ +T  T+PRL+VDNGIK++H++
Sbjct  328  GNLKGTIDIYDKEKEMKKITTIEASNSTVCEWSPDGRHILTGITSPRLRVDNGIKIWHYS  387

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G+L + +   +LY+  W+P++P+ +
Sbjct  388  GALMYSEEINELYEVFWQPQNPEIY  412



>ref|XP_007508443.1| eukaryotic translation initiation factor 2A [Bathycoccus prasinos]
 emb|CCO20547.1| eukaryotic translation initiation factor 2A [Bathycoccus prasinos]
Length=642

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = -2

Query  859  GNLPGDMAXWDY---GXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+  +     G  K + + +A  SVT+EWSP GR  +T+T APRL VDNG K++ 
Sbjct  425  GNLPGDVKFYHRLFDGKFKLMGSCRAACSVTAEWSPCGRRLLTSTVAPRLNVDNGFKIWR  484

Query  688  HNGSLYFKKMFEKLYQADWKPE  623
            +NG L      EKLY+A W+P 
Sbjct  485  YNGELLAHVEREKLYEAAWRPR  506



>ref|XP_005646475.1| eIF2A-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21931.1| eIF2A-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=617

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDY---GXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+  +D    G  K++  T+A+ +V+ EW+PDGR  +TATTAPRL+VDNG +++ 
Sbjct  347  GNLPGDILFFDKKADGKLKQMGATRADNAVSLEWAPDGRSVLTATTAPRLRVDNGFQIYK  406

Query  688  HNGSLYFKKMFEKLYQADWKPESPDKF  608
            + G    ++  E L +A W+P   D F
Sbjct  407  YTGEKLLEQKVEVLLEARWQPAPRDTF  433



>ref|XP_008816961.1| hypothetical protein C922_03147 [Plasmodium inui San Antonio 
1]
 gb|EUD66513.1| hypothetical protein C922_03147 [Plasmodium inui San Antonio 
1]
Length=694

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  W+   KKE+  TKA  +V  E+  DG++F+TATT PRL+VDN +K+F H+G
Sbjct  507  GNLSGDITLWNTSTKKEVTRTKASCAVICEFFNDGKHFVTATTHPRLRVDNHLKIFTHDG  566

Query  679  SLYFKKMFEKLYQADWKPESPDKFGE  602
             +  +  FE+LYQ    P +   F E
Sbjct  567  FIVSRINFEELYQVIILPFNKIPFSE  592



>ref|XP_002843081.1| eukaryotic translation initiation factor 2A [Arthroderma otae 
CBS 113480]
 gb|EEQ35345.1| eukaryotic translation initiation factor 2A [Arthroderma otae 
CBS 113480]
Length=715

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDG++ +TATT+PRL+VDNG++++H +
Sbjct  311  GNLAGQMDIYDVEKDYKKIVTVEASNASVCEWSPDGKHILTATTSPRLRVDNGVRIWHVS  370

Query  682  GSLYFKKMFEKLYQADWKPESP  617
            G+L + +   +LY   W+P+SP
Sbjct  371  GALMYNEDMNELYSVSWRPQSP  392



>gb|EPB92920.1| hypothetical protein HMPREF1544_00359 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=567

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K++ T  A  +   EWSP GRY +TAT  PRL+VDNG K++HH+G
Sbjct  333  GNLNGTVDLWDRKTLKKINTFAASNASHCEWSPCGRYLLTATLTPRLRVDNGFKLWHHSG  392

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            +L +++  ++LYQ  ++PE   ++
Sbjct  393  TLIYEEAVDELYQIGYRPEPAARY  416



>gb|KDQ59846.1| hypothetical protein JAAARDRAFT_126728 [Jaapia argillacea MUCL 
33604]
Length=652

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  335  GNLAGKIDIFDRRTLTKVTTIDAPNTSVCEWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  394

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFL  587
             L   +  ++LYQA W+P S D      + +
Sbjct  395  PLMHVQGVDELYQASWRPTSVDALPSFPQVI  425



>emb|CCJ28474.1| unnamed protein product [Pneumocystis jirovecii]
Length=604

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKK-ELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K  ++AT +A  +   +WSPDGR+ +T  T+PRL+VDNGIK++H+ 
Sbjct  328  GNLQGTIDIYDKEKKMVKIATIEASNASVCKWSPDGRHILTGITSPRLRVDNGIKIWHYT  387

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G+L + +   +LYQ  W+P+ P+ +
Sbjct  388  GTLMYSEEINELYQVLWRPQDPEIY  412



>ref|XP_001802462.1| hypothetical protein SNOG_12236 [Phaeosphaeria nodorum SN15]
 gb|EAT80648.1| hypothetical protein SNOG_12236 [Phaeosphaeria nodorum SN15]
Length=714

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL GDM  +D      +L T KA      EWSPDG++ ++A T+PRL+VDNGI+++H  
Sbjct  335  GNLAGDMDIYDLEKNYHKLCTIKASNCTYCEWSPDGKHILSAITSPRLRVDNGIRIYHIG  394

Query  682  GSLYFKKMFEKLYQADWKPESP  617
            G L + +   ++Y   W+P+SP
Sbjct  395  GQLMYNEEMTEMYHVTWRPQSP  416



>ref|XP_003080114.1| Translation initiation factor 3, subunit b (eIF-3b) (ISS) [Ostreococcus 
tauri]
 emb|CAL54281.1| Translation initiation factor, beta propellor-like domain [Ostreococcus 
tauri]
Length=572

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -2

Query  859  GNLPGDMAXWDY---GXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+  +     G  K + +T+A  SVT EWSPDGR  +T+T APRL VDNG K++ 
Sbjct  371  GNLPGDIKFFQKMKDGKYKPVGSTRAACSVTLEWSPDGRRLLTSTVAPRLNVDNGWKIWR  430

Query  688  HNGSLYFKKMFEKLYQADWKP  626
            +NG L   +   K+Y+A W+P
Sbjct  431  YNGDLLLHEERAKIYEAFWRP  451



>ref|XP_006458732.1| hypothetical protein AGABI2DRAFT_200574 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV50693.1| hypothetical protein AGABI2DRAFT_200574 [Agaricus bisporus var. 
bisporus H97]
Length=678

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   +WSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  333  GNLAGKIDIFDRRTLNKVITIDAPNTSHCDWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKP  626
             L   KM ++LYQA W+P
Sbjct  393  PLVHVKMIDELYQARWRP  410



>ref|XP_007326307.1| hypothetical protein AGABI1DRAFT_69517 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83250.1| hypothetical protein AGABI1DRAFT_69517 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=671

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   +WSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  333  GNLAGKIDIFDRRTLNKVITIDAPNTSHCDWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKP  626
             L   KM ++LYQA W+P
Sbjct  393  PLVHVKMIDELYQARWRP  410



>gb|KIM87305.1| hypothetical protein PILCRDRAFT_814794 [Piloderma croceum F 1598]
Length=647

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H +G
Sbjct  333  GNLAGKLDVFDRRTLNKVCTIDAPNTSHCEWSPDGRFLLTATLSPRLRVDNGIKIWHCSG  392

Query  679  SLYFKKMFEKLYQADWKP  626
            +L   +  ++LYQA W+P
Sbjct  393  TLVHVQAVDELYQASWRP  410



>gb|KIM54327.1| hypothetical protein SCLCIDRAFT_1222132 [Scleroderma citrinum 
Foug A]
Length=657

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +   D     +LAT +A  +    WSP GR+ MTA  +PRL+VDNGIK++H +G
Sbjct  333  GNLAGKIDVIDRRTLAKLATIEASNTSHCAWSPCGRFLMTAVLSPRLRVDNGIKIWHCSG  392

Query  679  SLYFKKMFEKLYQADWKPESPDK---FGE  602
             L   +  E+LYQA W+P S D+   FG+
Sbjct  393  PLMHVQAIEELYQASWRPMSVDQAPPFGQ  421



>dbj|GAM28955.1| hypothetical protein SAMD00019534_121310 [Acytostelium subglobosum 
LB1]
Length=612

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GDM  WD    +++ +T A  +  +EW+ D  +F+ A  +PR++VDNG+KV  ++G
Sbjct  363  GNLQGDMDFWDLTKFRKIISTHAHCATLTEWAADSVHFVVAFLSPRIRVDNGLKVIKYDG  422

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLK  566
            S+ +K+    LYQ  W+P++P  F +    +    ++K
Sbjct  423  SVIYKEAIPDLYQVQWRPQNPLAFPDERIVMPPASAIK  460



>dbj|GAN02148.1| translation initiation factor eIF-2A [Mucor ambiguus]
Length=568

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K++ T  A  +   EWSP GRY +TAT  PRL+VDNG K++HH+G
Sbjct  333  GNLNGTVDLWDRKTLKKINTFAASNASHCEWSPCGRYLLTATLTPRLRVDNGFKLWHHSG  392

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
            +L +++   +LYQ  ++PE   ++
Sbjct  393  TLIYEEAVNELYQIGYRPEPAARY  416



>gb|KIO20385.1| hypothetical protein M407DRAFT_29964 [Tulasnella calospora MUT 
4182]
Length=684

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 54/88 (61%), Gaps = 3/88 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++    A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  332  GNLAGKVEIFDRRSLTKVCEIDAPNTSWCEWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  391

Query  679  SLYFKKMFEKLYQADWKP---ESPDKFG  605
            +L    M E+LYQA W+P   ES   FG
Sbjct  392  TLMHVHMVEELYQASWRPAPVESAPPFG  419



>ref|XP_003395436.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Bombus 
terrestris]
Length=534

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   +K +A T+A  +   +WSPDG +FMTATTAPRL++ NG K++H+ G
Sbjct  334  GNLRGGIELWDVANRKLIAKTEAPDTTLLQWSPDGEHFMTATTAPRLRMGNGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            +L +++ +   E+L++  W+   P  F E     KAV+ +   + +   Q
Sbjct  394  TLLYERPWNEQEELWEVLWQTFPPGTFPEKPISYKAVEGIAPSQPQASKQ  443



>ref|XP_007849394.1| eukaryotic translation initiation factor 2a [Moniliophthora roreri 
MCA 2997]
 gb|ESK91313.1| eukaryotic translation initiation factor 2a [Moniliophthora roreri 
MCA 2997]
Length=668

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = -2

Query  859  GNLPGDMAXWD-----YGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKV  695
            GNL G +  +D     +  + +++T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK+
Sbjct  337  GNLAGKIDIYDRRNLSHPTQSKISTIDAPNTSHCEWSPDGRFLLTATLSPRLRVDNGIKI  396

Query  694  FHHNGSLYFKKMFEKLYQADWKPESPDKFGEI  599
            +H  G+L   ++ E+LYQA W+P   D+   I
Sbjct  397  WHAGGTLVHVQLTEELYQASWRPTPIDQVPPI  428



>ref|XP_004224282.1| hypothetical protein PCYB_132100 [Plasmodium cynomolgi strain 
B]
 dbj|GAB68335.1| hypothetical protein PCYB_132100 [Plasmodium cynomolgi strain 
B]
Length=564

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  W+   KKE+  TK+  +V  E+  DG +F+TATT PRL+VDN +K+F H+G
Sbjct  368  GNLSGDITLWNTSTKKEVTKTKSSCAVICEFFNDGMHFLTATTHPRLRVDNHLKIFTHDG  427

Query  679  SLYFKKMFEKLYQADWKPESPDKFGE  602
             +  +  FE+LY+    P S   F E
Sbjct  428  FIVSRINFEELYKVIILPLSKIPFSE  453



>gb|KIJ10832.1| hypothetical protein PAXINDRAFT_172050 [Paxillus involutus ATCC 
200175]
Length=644

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +    WSPDGR+ +TAT +PRL+VDNGIKV+H  G
Sbjct  315  GNLAGKIDVYDRRTLTKITTIDAPNTSYCSWSPDGRFLLTATLSPRLRVDNGIKVWHATG  374

Query  679  SLYFKKMFEKLYQADWKPESPDK  611
             L   +  E+LYQA W+P   D+
Sbjct  375  PLVHVQAIEELYQASWRPTPVDQ  397



>gb|KKA24824.1| Eukaryotic translation initiation factor subunit eIF2A [Rasamsonia 
emersonii CBS 393.64]
Length=710

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNG++++H +
Sbjct  341  GNLAGQMDVYDLEKNYNKVATIEASNATVCEWSPDGKHILTATTSPRLRVDNGVRIWHVS  400

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G+L + +   +LYQ  W+P+S
Sbjct  401  GNLMYNEDMNELYQVCWRPQS  421



>gb|EKG10466.1| Six-bladed beta-propeller TolB-like protein [Macrophomina phaseolina 
MS6]
Length=721

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++ T +A  S   EWSPDG++ MTATT+PRL+VDNGI+++H  
Sbjct  337  GNLAGQMDIYDLEKDYAKVCTIEAANSSICEWSPDGKHIMTATTSPRLRVDNGIRIYHVT  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G L +   F +LY   W+P+S  ++
Sbjct  397  GGLQYFAEFNELYHVTWRPQSTAEY  421



>ref|XP_002838517.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82708.1| unnamed protein product [Tuber melanosporum]
Length=713

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDY-GXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     K++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG+K++H+ 
Sbjct  332  GNLQGSMDIYDRQAGMKKICTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVKIWHYT  391

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L +    ++LY   W P+S
Sbjct  392  GGLMYNIDLDELYHVTWLPQS  412



>ref|XP_003488788.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Bombus 
impatiens]
Length=577

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   +K +A T+A  +   +WSPDG +FMTATTAPRL++ NG K++H+ G
Sbjct  334  GNLRGGIELWDVANRKLIAKTEAPDTTLLQWSPDGEHFMTATTAPRLRMGNGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
            +L +++ +   E+L++  W+   P  F E     KAV+ +   + +   Q
Sbjct  394  TLLYERPWNEQEELWEVLWQTFPPGTFPEKPISYKAVEGIAPSQPQASKQ  443



>gb|KDQ34142.1| hypothetical protein PLEOSDRAFT_1095628 [Pleurotus ostreatus 
PC15]
Length=671

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNG+KV+H +G
Sbjct  333  GNLAGKIDIFDRRSLTKVCTVDAPNTSHCEWSPDGRFLLTATLSPRLRVDNGLKVWHCSG  392

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   +  E+LYQA W+P   D
Sbjct  393  PLVHFQAVEELYQASWRPTPVD  414



>ref|XP_007321669.1| hypothetical protein SERLADRAFT_451892 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO21883.1| hypothetical protein SERLADRAFT_451892 [Serpula lacrymans var. 
lacrymans S7.9]
Length=639

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D    +++ T  A  +   EWSPDGR+ +TAT +PRL+VDNG+K++H  G
Sbjct  333  GNLAGKIDVFDRRTLQKVCTIDAPNTSFCEWSPDGRFLLTATLSPRLRVDNGLKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKP  626
             L   +  E+LYQA W+P
Sbjct  393  PLVHVQAIEELYQASWRP  410



>gb|EGN96343.1| hypothetical protein SERLA73DRAFT_170733 [Serpula lacrymans var. 
lacrymans S7.3]
Length=685

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D    +++ T  A  +   EWSPDGR+ +TAT +PRL+VDNG+K++H  G
Sbjct  379  GNLAGKIDVFDRRTLQKVCTIDAPNTSFCEWSPDGRFLLTATLSPRLRVDNGLKIWHCTG  438

Query  679  SLYFKKMFEKLYQADWKP  626
             L   +  E+LYQA W+P
Sbjct  439  PLVHVQAIEELYQASWRP  456



>ref|XP_011131544.1| eukaryotic translation initiation factor 2A [Gregarina niphandrodes]
 gb|EZG55468.1| eukaryotic translation initiation factor 2A [Gregarina niphandrodes]
Length=379

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPGD+  WD   ++ +  TK   +V   +SPD  + + +TT PRL+VDN +K+   NG
Sbjct  157  GNLPGDVEVWDISKQEIIGLTKLPWTVDLSFSPDAYWLLASTTTPRLRVDNCLKIVRVNG  216

Query  679  SLYFKKMFEKLYQADWKP  626
                +K F++LYQADW+P
Sbjct  217  EPVLEKAFDELYQADWRP  234



>ref|XP_007871399.1| translation initiation factor eIF-2A [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ50143.1| translation initiation factor eIF-2A [Gloeophyllum trabeum ATCC 
11539]
Length=635

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G M+  D     ++A+ +A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H +G
Sbjct  333  GNLAGKMSVIDRKILSQVASIEAPNTSWCEWSPDGRFILTATLSPRLRVDNGIKIWHCSG  392

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   +  ++LYQ  W+P   D
Sbjct  393  PLMHVQAIDELYQTSWRPTPVD  414



>gb|KEQ91281.1| hypothetical protein AUEXF2481DRAFT_33231 [Aureobasidium subglaciale 
EXF-2481]
Length=670

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     ++++T +A  +   EWSPDG++ +TATT+PRL+VDN I+V+H +
Sbjct  333  GNLAGTMDIYDMEKNYQKVSTIEASNASICEWSPDGQHILTATTSPRLRVDNAIRVWHVS  392

Query  682  GSLYFKKMFEKLYQADWKPESPDK  611
            GS  F +   +LY   W+PES +K
Sbjct  393  GSFMFNEEMNELYHVTWRPESTEK  416



>gb|KIW75105.1| hypothetical protein Z517_11876 [Fonsecaea pedrosoi CBS 271.37]
Length=758

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++ T +A  +   EWSPDG + +TATT+PRL+VDNGI+++H  
Sbjct  337  GNLAGQMDIYDLEKDFAKICTVEASNASVCEWSPDGLHILTATTSPRLRVDNGIRIWHAG  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            GSL + +   +LY   W+P+S D +
Sbjct  397  GSLMYNQDLNELYHVCWRPQSADAY  421



>ref|XP_007931629.1| hypothetical protein MYCFIDRAFT_168463 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME77875.1| hypothetical protein MYCFIDRAFT_168463 [Pseudocercospora fijiensis 
CIRAD86]
Length=702

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKE-LATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     E + T +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H  
Sbjct  337  GNLAGQMDIYDLSKNYEKVCTIEASNASVCEWSPDGKHILTATTSPRLRVDNGIRIWHVG  396

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LYQ  W+P+S
Sbjct  397  GGLMYNEDMTELYQVTWRPQS  417



>gb|KIK93037.1| hypothetical protein PAXRUDRAFT_829393 [Paxillus rubicundulus 
Ve08.2h10]
Length=661

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 3/89 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +    WSPDGR+ +TAT +PRL+VDNGIKV+H  G
Sbjct  333  GNLAGKIDVFDRRTYNKITTIDAPNTSYCSWSPDGRFLLTATLSPRLRVDNGIKVWHATG  392

Query  679  SLYFKKMFEKLYQADWKPESPDK---FGE  602
             L   +  E+LYQA W+P   D+   FG+
Sbjct  393  PLVHIQAIEELYQASWRPTPVDQAPPFGQ  421



>gb|KEQ66984.1| eukaryotic translation initiation factor 2A [Aureobasidium melanogenum 
CBS 110374]
Length=668

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     ++++T +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  333  GNLAGTMDIYDMEKNYQKVSTIEASNASICEWSPDGQHILTATTSPRLRVDNGIRMWHVS  392

Query  682  GSLYFKKMFEKLYQADWKPESPDK  611
            GS  + +   +LY   W+PES +K
Sbjct  393  GSFMYNEEMNELYHVTWRPESAEK  416



>ref|XP_011275696.1| Eukaryotic translation initiation factor 2A [Wickerhamomyces 
ciferrii]
 emb|CCH42451.1| Eukaryotic translation initiation factor 2A [Wickerhamomyces 
ciferrii]
Length=609

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K  ++++  A  +   +WSPDGRY +TATT+PRL+VDNG+KV++  
Sbjct  333  GNLQGTVDVYDRLQKFSKISSFSASNTSVCQWSPDGRYILTATTSPRLRVDNGVKVWYAT  392

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G L F K F++L+  DW+P   + F
Sbjct  393  GKLIFNKDFKELFAVDWRPRPLETF  417



>gb|ESX00859.1| Eukaryotic initiation factor (eIF) 2A [Ogataea parapolymorpha 
DL-1]
Length=594

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G++   D   K  ++A+ KA  +   +WSPDGRY +TATT+PRL+VDN +K+++ N
Sbjct  340  GNLQGNVDILDRQNKFAKVASFKASNTSVCKWSPDGRYILTATTSPRLRVDNCVKIWYAN  399

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEF--LKAVD  575
            GSL + K F +LY  DW      +F  +S+F  +K +D
Sbjct  400  GSLCYVKEFPELYSVDW------RFQPLSDFPPIKGLD  431



>ref|XP_011397970.1| Eukaryotic translation initiation factor 2A [Auxenochlorella 
protothecoides]
 gb|KFM25082.1| Eukaryotic translation initiation factor 2A [Auxenochlorella 
protothecoides]
Length=524

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDY---GXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFH  689
            GNLPGD+A +D    G  K + TT+AE  V  EWSP G   + +TTAPRL+VDNGI+VF 
Sbjct  322  GNLPGDLAFYDKKADGKCKPMGTTRAENGVALEWSPCGHMVLVSTTAPRLRVDNGIQVFR  381

Query  688  HNGSLYFKKMFEKLYQADWKPESPDKFGE  602
             + +    + +  L QA W+P +P  F +
Sbjct  382  ADAARLAARPYPILLQAAWRPAAPGSFSD  410



>gb|KDQ18700.1| hypothetical protein BOTBODRAFT_29077 [Botryobasidium botryosum 
FD-172 SS1]
Length=653

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D    +++ +  A  +   EWS DGR+ MTAT +PRL+VDNGIK++H  G
Sbjct  337  GNLAGGIEVYDRRTLQKVCSIDASNTSWCEWSRDGRFIMTATLSPRLRVDNGIKIWHCTG  396

Query  679  SLYFKKMFEKLYQADWKP  626
            SL    + E+LYQA W+P
Sbjct  397  SLMHVHLVEELYQASWRP  414



>gb|KIJ32447.1| hypothetical protein M422DRAFT_213804 [Sphaerobolus stellatus 
SS14]
Length=638

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 3/108 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D      + T  A  S   EWSPDG++ +TAT +PRL+VDNGIK++H  G
Sbjct  333  GNLAGKVDIYDRRTLGRVTTIDAPNSSWCEWSPDGKFLLTATLSPRLRVDNGIKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKPESPDK---FGEISEFLKAVDSLKIDETKVQ  545
             L    M ++LYQ  W+P   D+   FG+      A     ++ T  +
Sbjct  393  PLIHIHMIDELYQVSWRPTPVDQCPAFGQTLPIAPAPSPSAVEHTTAK  440



>ref|XP_002550351.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER31866.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=631

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K   + T +A  +   EWSP GR+ +TATT+PRL+VDNG K++H +
Sbjct  349  GNLQGTVDVYDRQNKFSRVVTFEASNTSVCEWSPCGRFILTATTSPRLRVDNGCKIWHAS  408

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEI  599
            G L + K + +LY   WKP++ D+F  I
Sbjct  409  GKLVYLKEYPELYSIGWKPQALDQFPPI  436



>ref|XP_005096415.1| PREDICTED: eukaryotic translation initiation factor 2A-like [Aplysia 
californica]
Length=578

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  WD   +++++ T+A  +   EWSPDG++ +T+TTAPRL+V NG +++H+ G
Sbjct  329  GNLAGNLEFWDVKQRRQISKTQAADTTHFEWSPDGQHMLTSTTAPRLRVGNGYRIWHYTG  388

Query  679  SLY---FKKMFEKLYQADWKPESP  617
            +L    F     +L+QA W+P +P
Sbjct  389  TLMLQTFTTDHAELWQAKWRPSAP  412



>ref|XP_001383729.2| hypothetical protein PICST_88690 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN65700.2| predicted protein [Scheffersomyces stipitis CBS 6054]
Length=629

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 1/91 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K  ++ T +A  +   EWSP GRY +TATT+PRL+VDNG+KV+H +
Sbjct  341  GNLQGTVDVYDRQNKFSKVVTFEAANTSVCEWSPCGRYILTATTSPRLRVDNGLKVWHAS  400

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEF  590
            G L + K +++LY   WKP++  +F  + + 
Sbjct  401  GQLVYLKEYQELYAIGWKPQTIAEFPPLKQL  431



>ref|XP_007581397.1| putative eukaryotic translation initiation factor subunit protein 
[Neofusicoccum parvum UCRNP2]
 gb|EOD51129.1| putative eukaryotic translation initiation factor subunit protein 
[Neofusicoccum parvum UCRNP2]
Length=707

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++ T +A  S   EWSPDG + MTATT+PRL+VDNGI+++H  
Sbjct  337  GNLAGQMDIYDLEKDYAKVCTIEAANSSICEWSPDGTHIMTATTSPRLRVDNGIRIYHVT  396

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L +   F +LY   W+P+S
Sbjct  397  GGLQYFTEFNELYHVTWRPQS  417



>gb|EMG46660.1| hypothetical protein G210_3080 [Candida maltosa Xu316]
Length=636

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K   + + +A  +   EWSP GR+ +TATT+PRL+VDNG+KV+H +
Sbjct  340  GNLQGTVDVYDRQNKFSRVVSFEASNTSVCEWSPCGRFILTATTSPRLRVDNGLKVWHAS  399

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEI  599
            G L + + F +LY   WKP++ D+F  I
Sbjct  400  GKLIYLQEFPELYSIGWKPQAIDQFPPI  427



>emb|CCM04562.1| predicted protein [Fibroporia radiculosa]
Length=627

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ +  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  334  GNLAGKVDIYDRRTLAKVTSIDASNTSHCEWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  393

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L    + ++LYQA W+P   D
Sbjct  394  PLVHVHLIDELYQASWRPTPVD  415



>ref|XP_002260631.1| hypothetical protein, conserved in Plasmodium species [Plasmodium 
knowlesi strain H]
 emb|CAQ42603.1| hypothetical protein, conserved in Plasmodium species [Plasmodium 
knowlesi strain H]
Length=935

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  W+   +KE++ TKA  +V  E+  DG++F+TATT PRL+VDN +K+F H+G
Sbjct  736  GNLSGDITLWNTSTEKEVSKTKASCAVVCEFFNDGKHFLTATTHPRLRVDNHLKIFTHDG  795

Query  679  SLYFKKMFEKLYQADWKPESPDKFGE  602
             +  +  FE+LY+    P +   F E
Sbjct  796  FIVSRINFEELYKVIILPFNKINFSE  821



>ref|XP_007384987.1| translation initiation factor eIF-2A [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN07884.1| translation initiation factor eIF-2A [Punctularia strigosozonata 
HHB-11173 SS5]
Length=569

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 0/107 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  332  GNLAGKINVYDRRTLAKVTTIDAPNTSHCEWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  391

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQ  539
             L   ++ ++LYQ  W+P   D      + L    +    + + +GQ
Sbjct  392  PLVHVQLTDELYQVGWRPTPVDALPPFGQALPPAPAPAPSDGEKKGQ  438



>gb|KIK51730.1| hypothetical protein GYMLUDRAFT_251789 [Gymnopus luxurians FD-317 
M1]
Length=740

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     +L +  A  +   +WSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  333  GNLAGKIDIFDRRSLTKLCSIDAPNTSYCDWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   ++ E++YQA W+P   D
Sbjct  393  PLMHVQLVEEMYQASWRPTPVD  414



>ref|XP_004833173.1| Eukaryotic translation initiation factor eIF2A family member 
protein [Babesia equi]
 gb|EKX73721.1| Eukaryotic translation initiation factor eIF2A family member 
protein [Babesia equi strain WA]
Length=540

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD+  WD   KK +A +K++ SVT E+SPDGRYF+TATT PR++VD   K+F ++G
Sbjct  374  GNLRGDIDIWDLKTKKIIAQSKSDCSVTCEFSPDGRYFVTATTVPRMRVDCCFKIFSYSG  433

Query  679  SLYFKKMFEKLYQA  638
                +  FE+L+  
Sbjct  434  RSVTRVDFEELHNV  447



>ref|XP_011505945.1| PREDICTED: eukaryotic translation initiation factor 2A [Ceratosolen 
solmsi marchali]
Length=593

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 3/111 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  WD   +K +AT+ A  S   EWSPDG ++MTATTAPRL++ NG K++H+ G
Sbjct  343  GNLRGEIELWDTVNRKLIATSDAPDSTLLEWSPDGEHYMTATTAPRLRMSNGFKIWHYTG  402

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            +L +++ +   E+L++  W+    D F E     KAV  +   + +   Q 
Sbjct  403  TLLYERPWNKQEELWEVLWQKFPSDLFKEKPIKYKAVGGIAPSQPQASKQA  453



>ref|XP_766228.1| hypothetical protein [Theileria parva strain Muguga]
 gb|EAN33945.1| hypothetical protein TP01_0707 [Theileria parva]
Length=560

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  WD   KK+++ +K+E SV+ E+SPDG YF+TATT PR++VD   K+F ++G
Sbjct  401  GNLRGEIDIWDMKTKKKISQSKSECSVSCEFSPDGMYFVTATTVPRMRVDCCFKIFSYSG  460

Query  679  SLYFKKMFEKLYQA  638
             L  +  FE+LY  
Sbjct  461  KLVQRVDFEELYHV  474



>ref|XP_954073.1| hypothetical protein [Theileria annulata]
 emb|CAI73396.1| hypothetical protein, conserved [Theileria annulata]
Length=596

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G++  WD   KK+++ +K+E SV+ E+SPDG YF+TATT PR++VD   K+F ++G
Sbjct  437  GNLRGEIDIWDMKTKKKISQSKSECSVSCEFSPDGMYFVTATTVPRMRVDCCFKIFSYSG  496

Query  679  SLYFKKMFEKLYQA  638
             L  +  FE+LY  
Sbjct  497  KLVQRVDFEELYHV  510



>ref|XP_007370983.1| translation initiation factor eIF-2A [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF56310.1| translation initiation factor eIF-2A [Dichomitus squalens LYAD-421 
SS1]
Length=645

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ +  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  334  GNLAGKVDIYDRRTLNKVTSIDASNTSHCEWSPDGRFLLTATLSPRLRVDNGIKIWHCTG  393

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
             L   ++ E+LYQ  W+P   D  
Sbjct  394  PLVHVQLTEELYQVSWRPTPVDAL  417



>ref|XP_001933692.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU45882.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=713

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL GDM  +D      ++   K   S   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  337  GNLAGDMDIYDLERNFAKVCHVKTSNSTYCEWSPDGQHILTATTSPRLRVDNGIRIYHVS  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            GSL + +   +LY   W+P+    F
Sbjct  397  GSLMYNEDMAELYHVVWRPQPTSMF  421



>ref|XP_008715899.1| hypothetical protein HMPREF1541_03325 [Cyphellophora europaea 
CBS 101466]
 gb|ETN41390.1| hypothetical protein HMPREF1541_03325 [Cyphellophora europaea 
CBS 101466]
Length=740

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 1/107 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++ T +A  +   EWSPDGR+ +TATT+PRL+VDNG+++++  
Sbjct  337  GNLAGQMDIYDLEKDFTKICTIEASNASVCEWSPDGRHILTATTSPRLRVDNGVRIWYAG  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQG  542
            G L + + F +LY   W+P+        S  L  V +  I  T+  G
Sbjct  397  GPLMYNEDFSELYHVCWRPQPTSAHPMPSNALSTVPTPHISATQYLG  443



>gb|EEQ90753.1| eukaryotic translation initiation factor 2A [Blastomyces dermatitidis 
ER-3]
Length=704

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNG++++H  
Sbjct  314  GNLAGQMDIYDLDKDYTKIATIEASNASVCEWSPDGKFILTATTSPRLRVDNGVRIWHVG  373

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LYQ  W+P+S
Sbjct  374  GGLMYNEDLTELYQVCWRPQS  394



>ref|XP_002623307.1| eukaryotic translation initiation factor 2A [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ71555.1| eukaryotic translation initiation factor 2A [Blastomyces dermatitidis 
SLH14081]
Length=704

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNG++++H  
Sbjct  314  GNLAGQMDIYDLDKDYTKIATIEASNASVCEWSPDGKFILTATTSPRLRVDNGVRIWHVG  373

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LYQ  W+P+S
Sbjct  374  GGLMYNEDLTELYQVCWRPQS  394



>gb|EQL36646.1| hypothetical protein BDFG_02008 [Blastomyces dermatitidis ATCC 
26199]
Length=730

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNG++++H  
Sbjct  340  GNLAGQMDIYDLDKDYTKIATIEASNASVCEWSPDGKFILTATTSPRLRVDNGVRIWHVG  399

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LYQ  W+P+S
Sbjct  400  GGLMYNEDLTELYQVCWRPQS  420



>ref|XP_011311612.1| PREDICTED: eukaryotic translation initiation factor 2A [Fopius 
arisanus]
Length=570

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 66/111 (59%), Gaps = 3/111 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   +K +A T A  S   +WSPDG +F+TATTAPRL+V NG K++H+ G
Sbjct  334  GNLRGGIELWDTAKRKLIAQTDAPDSTLLQWSPDGEHFVTATTAPRLRVANGFKIWHYTG  393

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGEISEFLKAVDSLKIDETKVQGQG  536
            +L +++ +   E+L++  W+    + F E +   KAV+ +   + +   Q 
Sbjct  394  TLLYERPWNKQEELWEVHWQVFPKNVFPEKTISYKAVEGIAPSQPQASKQA  444



>gb|EGE78909.1| eukaryotic translation initiation factor 2A [Blastomyces dermatitidis 
ATCC 18188]
Length=730

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNG++++H  
Sbjct  340  GNLAGQMDIYDLDKDYTKIATIEASNASVCEWSPDGKFILTATTSPRLRVDNGVRIWHVG  399

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LYQ  W+P+S
Sbjct  400  GGLMYNEDLTELYQVCWRPQS  420



>gb|KEQ69570.1| eukaryotic translation initiation factor 2A [Aureobasidium namibiae 
CBS 147.97]
Length=669

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     ++++T +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  333  GNLAGTMDIYDMEKNYQKVSTIEASNASICEWSPDGQHILTATTSPRLRVDNGIRMWHVS  392

Query  682  GSLYFKKMFEKLYQADWKPESPDK  611
            GS  + +   +LY   W+PES +K
Sbjct  393  GSFLYNEEMNELYHVTWRPESIEK  416



>ref|XP_001263854.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Neosartorya fischeri NRRL 181]
 gb|EAW21957.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Neosartorya fischeri NRRL 181]
Length=683

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  338  GNLAGQMDIYDLDKNYNKVATVEASNASVCEWSPDGQFILTATTSPRLRVDNGIRIWHVS  397

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LY+  W+P+S
Sbjct  398  GGLMYNEDMNELYEVVWRPQS  418



>emb|CCG80719.1| Eukaryotic translation initiation factor 2A [Taphrina deformans 
PYCC 5710]
Length=588

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G M  ++    K++AT  A  +   EWSPD R+ +TATT+PRL+VDNGIK++H+ G
Sbjct  328  GNLQGTMDIYERNGMKKIATIDAANTSHCEWSPDSRHILTATTSPRLRVDNGIKIWHYKG  387

Query  679  SLYFKKMFEKLYQADWKPESPDKF  608
             L + +  ++L+ A  +P+S   F
Sbjct  388  QLVYTEDHQELFYATMRPQSVQDF  411



>gb|KIR88067.1| translation initiation factor 2A [Cryptococcus gattii IND107]
Length=629

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  364  GNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  423

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA + P+   +  +I  F   +
Sbjct  424  QLLHIQPIEELYQASFAPQ---RVADIGSFPAVI  454



>ref|XP_745903.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH74296.1| hypothetical protein PC000025.00.0 [Plasmodium chabaudi chabaudi]
Length=171

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD++ W+   KKE+  TK+  +V  E+  D ++F+TATT PRL+VDN IK++ +NG
Sbjct  1    GNLSGDISIWNTINKKEITKTKSSCAVICEFFNDDKHFLTATTHPRLRVDNNIKIYKYNG  60

Query  679  SLYFKKMFEKLYQADWKP  626
             +  K  F++LY     P
Sbjct  61   LIVSKLDFDELYNVIILP  78



>gb|KGB76678.1| translation initiation factor 2A [Cryptococcus gattii R265]
 gb|KIR34372.1| translation initiation factor 2A [Cryptococcus gattii MMRL2647]
 gb|KIR70014.1| translation initiation factor 2A [Cryptococcus gattii CA1014]
 gb|KIR98744.1| translation initiation factor 2A [Cryptococcus gattii 2001/935-1]
Length=630

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  365  GNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA + P+   +  +I  F   +
Sbjct  425  QLLHIQPIEELYQASFAPQ---RVADIGSFPAVI  455



>gb|KIR25790.1| translation initiation factor 2A [Cryptococcus gattii LA55]
 gb|KIR90017.1| translation initiation factor 2A [Cryptococcus gattii CBS 10090]
Length=630

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  365  GNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA + P+   +  +I  F   +
Sbjct  425  QLLHIQPIEELYQASFAPQ---RVADIGSFPAVI  455



>dbj|GAA85688.1| eukaryotic translation initiation factor subunit eIF2A [Aspergillus 
kawachii IFO 4308]
Length=673

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +    WSPDG+Y +TATT+PRL+VDNGI+++H +
Sbjct  336  GNLAGQMDIYDMDKNFHKIATVEASNASVCNWSPDGQYILTATTSPRLRVDNGIRIWHVS  395

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G+L + +   +LY   W+P+S
Sbjct  396  GALMYNEDMNELYDVCWRPQS  416



>gb|KIR41242.1| translation initiation factor 2A [Cryptococcus gattii Ram5]
 gb|KIY56212.1| translation initiation factor 2A [Cryptococcus gattii 99/473]
Length=630

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  365  GNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA + P+   +  +I  F   +
Sbjct  425  QLLHIQPIEELYQASFAPQ---RVADIGSFPAVI  455



>ref|XP_012053715.1| translation initiation factor 2A [Cryptococcus neoformans var. 
grubii H99]
 gb|AFR98792.1| translation initiation factor 2A [Cryptococcus neoformans var. 
grubii H99]
Length=630

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  365  GNLAGGIDIWDVSTRNKIAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFG  605
             L   +  E+LYQA + P+     G
Sbjct  425  QLLHIQPVEELYQASFAPQRVTDIG  449



>ref|XP_572226.1| hypothetical protein CNH00340 [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW44919.1| hypothetical protein CNH00340 [Cryptococcus neoformans var. neoformans 
JEC21]
Length=630

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+K++  NG
Sbjct  365  GNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKIWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA +   +P +  EI  F   V
Sbjct  425  QLLHIQPVEELYQASF---APQRVTEIGSFPAIV  455



>ref|XP_011192685.1| PREDICTED: eukaryotic translation initiation factor 2A [Bactrocera 
cucurbitae]
Length=623

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPG++  WD   K++L   K   +   EW+P+G YF+TATTAPRL++ NG KV+H++G
Sbjct  347  GNLPGNVEIWDMKKKEKLTNIKCPDTTYFEWNPNGMYFITATTAPRLRIGNGFKVYHYSG  406

Query  679  SLYFKKMF---EKLYQADWKPESPDKFGE  602
            SL  + ++   ++L   +W+  S ++F E
Sbjct  407  SLVHETIWPQGQELLGIEWQKYSENQFIE  435



>gb|KIJ94015.1| hypothetical protein K443DRAFT_371678 [Laccaria amethystina LaAM-08-1]
Length=635

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 56/89 (63%), Gaps = 3/89 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR  +TAT +PRL+VDNGIKV+H +G
Sbjct  333  GNLAGKLDIFDRRNLGKVCTIDAPNTSFCEWSPDGRSLLTATLSPRLRVDNGIKVWHCSG  392

Query  679  SLYFKKMFEKLYQADWKP---ESPDKFGE  602
             L   +  E+LYQA W+P   E+  +FG+
Sbjct  393  PLMHVQSTEELYQASWRPTPVEAVPQFGQ  421



>gb|KIR59405.1| translation initiation factor 2A [Cryptococcus gattii CA1873]
Length=630

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  365  GNLAGGIDIWDVSTRSKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA + P+   +  +I  F   +
Sbjct  425  QLLHIQPIEELYQASFAPQ---RVADIGSFPAVI  455



>gb|KIK38754.1| hypothetical protein CY34DRAFT_809015 [Suillus luteus UH-Slu-Lm8-n1]
Length=657

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSP GR+ +TAT +PRL+VDNG+KV+H  G
Sbjct  333  GNLAGKIDIFDRRTLTKICTIDAPNTSYCEWSPCGRFLLTATLSPRLRVDNGMKVWHCTG  392

Query  679  SLYFKKMFEKLYQADWKPESPDK  611
             L   ++ E+LYQA W+P   D+
Sbjct  393  GLMHVQLVEELYQASWRPTPLDQ  415



>ref|XP_772552.1| hypothetical protein CNBL0320 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL17905.1| hypothetical protein CNBL0320 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=630

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+K++  NG
Sbjct  365  GNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKIWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA +   +P +  EI  F   V
Sbjct  425  QLLHIQPVEELYQASF---APQRVTEIGSFPAIV  455



>gb|KIR45402.1| translation initiation factor 2A [Cryptococcus gattii CA1280]
Length=630

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD   + ++A  KA  +   EWSP GRY +TAT +PRL+VDNG+KV+  NG
Sbjct  365  GNLAGGIDIWDVSTRSKVAEFKASNASHCEWSPCGRYVLTATLSPRLRVDNGVKVWWCNG  424

Query  679  SLYFKKMFEKLYQADWKPESPDKFGEISEFLKAV  578
             L   +  E+LYQA + P+   +  +I  F   +
Sbjct  425  QLLHIQPIEELYQASFAPQ---RVADIGSFPAVI  455



>gb|KEY76426.1| eukaryotic translation initiation factor subunit eIF2A [Aspergillus 
fumigatus var. RP-2014]
Length=686

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  338  GNLAGQMDIYDLDKNYNKVATIEASNASVCEWSPDGQFILTATTSPRLRVDNGIRIWHVS  397

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LY+  W+P+S
Sbjct  398  GGLMYNEDMNELYEVVWRPQS  418



>emb|CEG64097.1| hypothetical protein RMATCC62417_01132 [Rhizopus microsporus]
Length=427

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  WD    K+L T  A  +   EWSP GR+ +TAT  PRL+VDNG K++H +G
Sbjct  189  GNLNGTVDLWDRKTLKKLNTFSASNASHCEWSPCGRFLLTATMTPRLRVDNGFKLWHQSG  248

Query  679  SLYFKKMFEKLYQADWKPE  623
            +L +++  E+LYQ  ++P+
Sbjct  249  TLVYEEEIEELYQISYRPQ  267



>ref|XP_755009.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Aspergillus fumigatus Af293]
 gb|EAL92971.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Aspergillus fumigatus Af293]
Length=684

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  338  GNLAGQMDIYDLDKNYNKVATIEASNASVCEWSPDGQFILTATTSPRLRVDNGIRIWHVS  397

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LY+  W+P+S
Sbjct  398  GGLMYNEDMNELYEVVWRPQS  418



>gb|EDP53138.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Aspergillus fumigatus A1163]
Length=690

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG++ +TATT+PRL+VDNGI+++H +
Sbjct  338  GNLAGQMDIYDLDKNYNKVATIEASNASVCEWSPDGQFILTATTSPRLRVDNGIRIWHVS  397

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G L + +   +LY+  W+P+S
Sbjct  398  GGLMYNEDMNELYEVVWRPQS  418



>ref|XP_003848258.1| hypothetical protein MYCGRDRAFT_76608 [Zymoseptoria tritici IPO323]
 gb|EGP83234.1| hypothetical protein MYCGRDRAFT_76608 [Zymoseptoria tritici IPO323]
Length=698

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKE-LATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D     E +AT +   +   EWSPDG++ +TATT+PRL+VDNGI+V+H  
Sbjct  337  GNLAGTMDIYDLEKNYEKVATIEGSNTSLCEWSPDGKHILTATTSPRLRVDNGIRVWHVG  396

Query  682  GSLYFKKMFEKLYQADWKPESPDK  611
            G L + +   +LY   W+P+S D+
Sbjct  397  GGLMYNQDMHELYHVVWRPQSADQ  420



>ref|XP_006690547.1| translation initiation factor eIF-2A [Candida tenuis ATCC 10573]
 ref|XP_006690548.1| hypothetical protein CANTEDRAFT_128247 [Candida tenuis ATCC 10573]
 gb|EGV61333.1| translation initiation factor eIF-2A [Candida tenuis ATCC 10573]
 gb|EGV61334.1| hypothetical protein CANTEDRAFT_128247 [Candida tenuis ATCC 10573]
Length=621

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K +++ + +A  +    WSPDGRY +TATT+PRL+VDNG+KV+H +
Sbjct  337  GNLQGTVDIYDRQDKFRKVVSFEASNTSVCSWSPDGRYILTATTSPRLRVDNGLKVWHFS  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISE  593
            G L + + + +L+   WKP   + F  IS+
Sbjct  397  GRLIYYREYTELFAVGWKPAKVEDFPAISK  426



>ref|XP_008866648.1| hypothetical protein H310_04198 [Aphanomyces invadans]
 gb|ETW05210.1| hypothetical protein H310_04198 [Aphanomyces invadans]
Length=610

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNLPG+M  WD    K+L +TKAE + T  WSPD RYF TATT PR++VDNG K+F ++G
Sbjct  353  GNLPGNMDFWDRNKLKKLGSTKAECATTHGWSPDSRYFYTATTFPRVRVDNGFKLFKYDG  412

Query  679  S  677
            +
Sbjct  413  T  413



>ref|XP_011325011.1| hypothetical protein FGSG_06353 [Fusarium graminearum PH-1]
 gb|ESU12435.1| hypothetical protein FGSG_06353 [Fusarium graminearum PH-1]
 gb|EYB26715.1| hypothetical protein FG05_06353 [Fusarium graminearum]
 emb|CEF87538.1| unnamed protein product [Fusarium graminearum]
Length=676

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D     +++ T ++      EWSPD RY MTATT+PRL+VDNGIK++H N
Sbjct  337  GNLAGQIDIYDLEKDFRKVTTIESGNPSVCEWSPDSRYIMTATTSPRLRVDNGIKLWHVN  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G + + +   +LY   W+P+SP+  
Sbjct  397  GGIMYNEDMIELYNVIWRPQSPESI  421



>gb|KIV83701.1| hypothetical protein PV11_05703 [Exophiala sideris]
Length=746

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++ T +A  +   EWSPDG + +TATT+PRL+VDNGI+++H  
Sbjct  338  GNLAGQMDIYDLEKDVSKICTIEASNASVCEWSPDGVHILTATTSPRLRVDNGIRIWHAG  397

Query  682  GSLYFKKMFEKLYQADWKPESP  617
            G+L + +   +LY   W+P+SP
Sbjct  398  GTLMYNEDMSELYHVCWRPQSP  419



>gb|KII89455.1| hypothetical protein PLICRDRAFT_91818 [Plicaturopsis crispa FD-325 
SS-3]
Length=650

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNGIK++H  G
Sbjct  333  GNLAGKIDIFDRRSLAKVTTIDAPNTSYCEWSPDGRFLLTATCSPRLRVDNGIKIWHCTG  392

Query  679  SLYFKKMFEKLYQADWKPESPD  614
             L   +  ++LYQ  W+P   D
Sbjct  393  PLVHYQTIDELYQVSWRPTPVD  414



>ref|XP_001824444.1| eukaryotic translation initiation factor 2A [Aspergillus oryzae 
RIB40]
 dbj|BAE63311.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT77863.1| putative translation initiation factor related to eIF-3a [Aspergillus 
oryzae 3.042]
 gb|KDE75775.1| putative translation initiation factor [Aspergillus oryzae 100-8]
Length=664

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKK-ELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG+Y +TATT+PRL+VDNG++++H +
Sbjct  338  GNLAGQMDIYDLEKNYFKIATVEASNASVCEWSPDGKYILTATTSPRLRVDNGVRLWHVS  397

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G+L + +   +LY   W+P+S
Sbjct  398  GALVYNEEMHELYDVFWRPQS  418



>ref|XP_009252535.1| hypothetical protein FPSE_01140 [Fusarium pseudograminearum CS3096]
 gb|EKJ78652.1| hypothetical protein FPSE_01140 [Fusarium pseudograminearum CS3096]
Length=674

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D     +++ T ++      EWSPD RY MTATT+PRL+VDNGIK++H N
Sbjct  337  GNLAGQIDIYDLEKDFRKVTTIESGNPSVCEWSPDSRYIMTATTSPRLRVDNGIKLWHVN  396

Query  682  GSLYFKKMFEKLYQADWKPESPDKF  608
            G + + +   +LY   W+P+SP+  
Sbjct  397  GGIMYNEDMIELYNVIWRPQSPESI  421



>emb|CDR40825.1| CYFA0S05e04918g1_1 [Cyberlindnera fabianii]
Length=607

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXK-KELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G +  +D   K  ++++ +A  +   +WSPDGR+ +TATT+PRL+VDNG+K+++  
Sbjct  336  GNLQGTVDVYDRLAKFTKVSSFEAPNTSVCQWSPDGRFILTATTSPRLRVDNGVKIWYAT  395

Query  682  GSLYFKKMFEKLYQADWKPESPDKFGEISEFLKAVD  575
            G L F K F+++Y  DW+P   + F      LKA+D
Sbjct  396  GKLVFTKDFKEVYSVDWRPRPLELFPP----LKALD  427



>gb|KIY51856.1| translation initiation factor eIF-2A [Fistulina hepatica ATCC 
64428]
Length=614

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL G +  +D     ++ T  A  +   EWSPDGR+ +TAT +PRL+VDNG+K++H  G
Sbjct  329  GNLAGKIDIFDRKTLNKVCTIDAPNTSHCEWSPDGRFLLTATLSPRLRVDNGLKIWHCTG  388

Query  679  SLYFKKMFEKLYQADWKP  626
            +L   +  E+LYQ  W+P
Sbjct  389  ALVHVQHTEELYQTSWRP  406



>gb|EUD71096.1| hypothetical protein YYG_03729 [Plasmodium vinckei petteri]
Length=620

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKKELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHNG  680
            GNL GD++ W+   KKE+  TK+  +V  E+  DG++F+TATT PRL+VDN IK++ +NG
Sbjct  448  GNLSGDISIWNTINKKEITKTKSSCAVICEFFNDGKHFLTATTHPRLRVDNNIKIYKYNG  507

Query  679  SLYFKKMFEKLYQADWKP  626
             +  K  F++LY     P
Sbjct  508  LIVSKIDFDELYNVIILP  525



>ref|XP_002384212.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Aspergillus flavus NRRL3357]
 gb|EED46676.1| eukaryotic translation initiation factor subunit eIF2A, putative 
[Aspergillus flavus NRRL3357]
Length=682

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKK-ELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG+Y +TATT+PRL+VDNG++++H +
Sbjct  356  GNLAGQMDIYDLEKNYFKIATVEASNASVCEWSPDGKYILTATTSPRLRVDNGVRLWHVS  415

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G+L + +   +LY   W+P+S
Sbjct  416  GALVYNEEMHELYDVFWRPQS  436



>gb|KJJ33530.1| Eukaryotic translation initiation factor eIF2A [Aspergillus flavus 
AF70]
Length=940

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  859  GNLPGDMAXWDYGXKK-ELATTKAELSVTSEWSPDGRYFMTATTAPRLQVDNGIKVFHHN  683
            GNL G M  +D      ++AT +A  +   EWSPDG+Y +TATT+PRL+VDNG++++H +
Sbjct  614  GNLAGQMDIYDLEKNYFKIATVEASNASVCEWSPDGKYILTATTSPRLRVDNGVRLWHVS  673

Query  682  GSLYFKKMFEKLYQADWKPES  620
            G+L + +   +LY   W+P+S
Sbjct  674  GALVYNEEMHELYDVFWRPQS  694



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587