BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8551

Length=1168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603855.1|  PREDICTED: uncharacterized protein LOC104098749    259   7e-81   Nicotiana tomentosiformis
ref|XP_009802919.1|  PREDICTED: uncharacterized protein LOC104248366    258   1e-80   Nicotiana sylvestris
ref|XP_011098066.1|  PREDICTED: transcription elongation factor B...    256   2e-79   Sesamum indicum [beniseed]
ref|XP_007048788.1|  Nucleus, subunit A, putative isoform 2             255   5e-79   Theobroma cacao [chocolate]
gb|KHF97908.1|  Elongin-A                                               254   9e-79   Gossypium arboreum [tree cotton]
gb|KJB33266.1|  hypothetical protein B456_006G004800                    252   5e-78   Gossypium raimondii
ref|XP_006348930.1|  PREDICTED: uncharacterized protein LOC102593...    252   5e-77   Solanum tuberosum [potatoes]
ref|XP_011008966.1|  PREDICTED: transcription elongation factor B...    246   7e-76   Populus euphratica
ref|XP_002317925.1|  hypothetical protein POPTR_0012s05560g             246   8e-76   
ref|XP_004243240.1|  PREDICTED: uncharacterized protein LOC101258385    248   1e-75   Solanum lycopersicum
ref|XP_002282527.1|  PREDICTED: transcription elongation factor B...    244   7e-75   Vitis vinifera
ref|XP_007048787.1|  Nucleus, subunit A, putative isoform 1             244   1e-74   
ref|XP_008229385.1|  PREDICTED: elongin-A                               241   6e-74   Prunus mume [ume]
gb|KHM99611.1|  Elongin-A                                               239   8e-73   Glycine soja [wild soybean]
ref|XP_010053019.1|  PREDICTED: transcription elongation factor B...    239   1e-72   
ref|XP_007146389.1|  hypothetical protein PHAVU_006G036100g             236   5e-72   Phaseolus vulgaris [French bean]
gb|ACU16340.1|  unknown                                                 235   1e-71   Glycine max [soybeans]
ref|XP_008456387.1|  PREDICTED: uncharacterized protein LOC103496337    235   2e-71   
ref|XP_012070201.1|  PREDICTED: elongin-A                               235   2e-71   Jatropha curcas
gb|AFK36819.1|  unknown                                                 234   3e-71   Lotus japonicus
ref|XP_007215918.1|  hypothetical protein PRUPE_ppa010897mg             234   3e-71   Prunus persica
ref|XP_004143189.1|  PREDICTED: transcription elongation factor B...    233   7e-71   Cucumis sativus [cucumbers]
ref|XP_011471042.1|  PREDICTED: elongin-A-like                          233   2e-70   Fragaria vesca subsp. vesca
ref|XP_006448014.1|  hypothetical protein CICLE_v10016502mg             233   2e-70   Citrus clementina [clementine]
gb|KDO58600.1|  hypothetical protein CISIN_1g028495mg                   231   3e-70   Citrus sinensis [apfelsine]
ref|XP_010272725.1|  PREDICTED: transcription elongation factor B...    231   5e-70   Nelumbo nucifera [Indian lotus]
ref|XP_008342397.1|  PREDICTED: transcription elongation factor B...    231   6e-70   
ref|XP_009339540.1|  PREDICTED: transcription elongation factor B...    231   1e-69   Pyrus x bretschneideri [bai li]
ref|XP_009350012.1|  PREDICTED: transcription elongation factor B...    230   2e-69   Pyrus x bretschneideri [bai li]
gb|KJB33267.1|  hypothetical protein B456_006G004800                    228   2e-69   Gossypium raimondii
ref|XP_008380250.1|  PREDICTED: transcription elongation factor B...    229   3e-69   
ref|XP_004500002.1|  PREDICTED: uncharacterized protein LOC101508994    229   3e-69   Cicer arietinum [garbanzo]
gb|EYU30739.1|  hypothetical protein MIMGU_mgv1a013329mg                228   7e-69   Erythranthe guttata [common monkey flower]
emb|CDP18735.1|  unnamed protein product                                228   1e-68   Coffea canephora [robusta coffee]
ref|XP_003599918.1|  Elongin-A                                          224   3e-67   Medicago truncatula
ref|XP_010689946.1|  PREDICTED: uncharacterized protein LOC104903...    222   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689945.1|  PREDICTED: uncharacterized protein LOC104903...    222   3e-66   
ref|XP_002525894.1|  Protein pof4, putative                             220   3e-66   
ref|XP_010524075.1|  PREDICTED: elongin-A-like                          216   7e-64   Tarenaya hassleriana [spider flower]
ref|XP_009133550.1|  PREDICTED: uncharacterized protein LOC103858028    219   8e-64   Brassica rapa
emb|CDY42819.1|  BnaC03g23870D                                          221   1e-63   Brassica napus [oilseed rape]
emb|CDX83518.1|  BnaA03g19880D                                          219   1e-63   
gb|KCW89687.1|  hypothetical protein EUGRSUZ_A01953                     213   8e-63   Eucalyptus grandis [rose gum]
gb|EPS68581.1|  hypothetical protein M569_06188                         211   1e-62   Genlisea aurea
ref|XP_010525255.1|  PREDICTED: elongin-A-like isoform X2               213   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010525240.1|  PREDICTED: elongin-A-like isoform X1               212   2e-62   Tarenaya hassleriana [spider flower]
gb|KCW89688.1|  hypothetical protein EUGRSUZ_A01953                     212   3e-62   Eucalyptus grandis [rose gum]
ref|XP_006827203.1|  PREDICTED: uncharacterized protein LOC18421929     209   2e-61   Amborella trichopoda
ref|XP_007146388.1|  hypothetical protein PHAVU_006G036000g             205   2e-60   Phaseolus vulgaris [French bean]
ref|XP_009416869.1|  PREDICTED: transcription elongation factor B...    206   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010506116.1|  PREDICTED: transcription elongation factor B...    202   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010506117.1|  PREDICTED: transcription elongation factor B...    202   8e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006294725.1|  hypothetical protein CARUB_v10023771mg             201   1e-57   Capsella rubella
ref|XP_010939513.1|  PREDICTED: uncharacterized protein LOC105058328    199   2e-57   Elaeis guineensis
ref|XP_010508529.1|  PREDICTED: transcription elongation factor B...    200   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010517819.1|  PREDICTED: transcription elongation factor B...    199   6e-57   Camelina sativa [gold-of-pleasure]
gb|ABR16496.1|  unknown                                                 202   6e-57   Picea sitchensis
gb|AES99821.2|  RNA polymerase II transcription factor SIII (elon...    197   8e-57   Medicago truncatula
ref|XP_003616863.1|  hypothetical protein MTR_5g085090                  197   1e-56   
ref|XP_003626793.1|  hypothetical protein MTR_8g009140                  194   6e-56   Medicago truncatula
ref|XP_006411547.1|  hypothetical protein EUTSA_v10017014mg             197   7e-56   Eutrema salsugineum [saltwater cress]
ref|XP_008807727.1|  PREDICTED: uncharacterized protein LOC103720002    191   2e-54   Phoenix dactylifera
ref|XP_007048789.1|  Nucleus, subunit A, putative isoform 3             183   5e-52   
gb|KEH17891.1|  RNA polymerase II transcription factor SIII (elon...    180   3e-51   Medicago truncatula
gb|KGN47016.1|  hypothetical protein Csa_6G169320                       180   3e-50   Cucumis sativus [cucumbers]
gb|KHN18125.1|  hypothetical protein glysoja_020898                     179   8e-50   Glycine soja [wild soybean]
ref|XP_007146384.1|  hypothetical protein PHAVU_006G035800g             174   2e-49   Phaseolus vulgaris [French bean]
ref|NP_001189736.1|  uncharacterized protein                            177   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565984.1|  uncharacterized protein                               177   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KEH17889.1|  RNA polymerase II transcription factor SIII (elon...    168   6e-46   Medicago truncatula
ref|XP_001772530.1|  predicted protein                                  164   2e-44   
ref|XP_001774521.1|  predicted protein                                  156   1e-41   
ref|XP_002968045.1|  hypothetical protein SELMODRAFT_440234             154   8e-41   Selaginella moellendorffii
ref|XP_004308816.1|  PREDICTED: elongin-A-like                          153   1e-40   Fragaria vesca subsp. vesca
ref|XP_004972743.1|  PREDICTED: uncharacterized protein LOC101777...    150   5e-39   Setaria italica
ref|XP_006659167.1|  PREDICTED: uncharacterized protein LOC102702307    151   3e-38   Oryza brachyantha
ref|XP_009605240.1|  PREDICTED: uncharacterized protein LOC104099829    139   4e-36   Nicotiana tomentosiformis
ref|XP_011470590.1|  PREDICTED: uncharacterized protein LOC105353271    142   4e-36   Fragaria vesca subsp. vesca
ref|XP_008370883.1|  PREDICTED: uncharacterized protein LOC103434322    143   5e-36   
ref|XP_009598074.1|  PREDICTED: uncharacterized protein LOC104093937    138   7e-36   
ref|NP_001167798.1|  uncharacterized protein LOC100381492               140   8e-36   
ref|XP_008661732.1|  PREDICTED: uncharacterized protein LOC100276...    142   9e-36   
gb|ACR37802.1|  unknown                                                 142   9e-36   Zea mays [maize]
ref|XP_003573427.1|  PREDICTED: uncharacterized protein LOC100825...    141   2e-35   Brachypodium distachyon [annual false brome]
gb|KEH17893.1|  RNA polymerase II transcription factor SIII (elon...    137   3e-35   Medicago truncatula
ref|XP_008661731.1|  PREDICTED: uncharacterized protein LOC100276...    142   3e-35   
ref|XP_010234351.1|  PREDICTED: uncharacterized protein LOC100825...    139   5e-35   
ref|XP_004308778.1|  PREDICTED: uncharacterized protein LOC101292648    138   9e-35   Fragaria vesca subsp. vesca
ref|NP_001143804.1|  uncharacterized protein LOC100276576               138   3e-34   
ref|XP_002443929.1|  hypothetical protein SORBIDRAFT_07g004520          131   1e-31   
ref|XP_004308629.1|  PREDICTED: uncharacterized protein LOC101315004    126   6e-31   Fragaria vesca subsp. vesca
gb|KGN49034.1|  hypothetical protein Csa_6G511010                       129   9e-30   Cucumis sativus [cucumbers]
gb|EEE68118.1|  hypothetical protein OsJ_26193                          120   8e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82966.1|  hypothetical protein OsI_27971                          120   8e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009364598.1|  PREDICTED: uncharacterized protein LOC103954489    115   4e-26   Pyrus x bretschneideri [bai li]
gb|AFW57163.1|  hypothetical protein ZEAMMB73_845066                    112   6e-26   
ref|NP_001061087.1|  Os08g0169600                                       104   1e-23   
ref|XP_007146385.1|  hypothetical protein PHAVU_006G035900g             103   3e-23   Phaseolus vulgaris [French bean]
ref|XP_008359981.1|  PREDICTED: uncharacterized protein LOC103423674    106   3e-23   
gb|EMS51051.1|  Transcription elongation factor B polypeptide 3         106   7e-23   Triticum urartu
ref|XP_008370881.1|  PREDICTED: uncharacterized protein LOC103434320    101   7e-22   
ref|XP_008349647.1|  PREDICTED: uncharacterized protein LOC103412918  98.6    3e-21   Malus domestica [apple tree]
ref|XP_011463641.1|  PREDICTED: uncharacterized protein LOC105351343  97.1    1e-20   Fragaria vesca subsp. vesca
gb|ACU14646.1|  unknown                                               92.4    2e-19   Glycine max [soybeans]
ref|XP_003600485.1|  hypothetical protein MTR_3g061710                78.6    7e-14   
ref|XP_007372398.1|  hypothetical protein SPAPADRAFT_58109            69.3    1e-09   Spathaspora passalidarum NRRL Y-27907
ref|XP_011008965.1|  PREDICTED: uncharacterized protein LOC105114188  65.5    1e-09   Populus euphratica
gb|EPX75006.1|  elongin-A                                             66.6    4e-09   Schizosaccharomyces octosporus yFS286
dbj|GAC99885.1|  pof4 protein                                         68.6    4e-09   Pseudozyma hubeiensis SY62
gb|ETS64518.1|  hypothetical protein PaG_00983                        65.1    5e-08   Moesziomyces aphidis DSM 70725
dbj|GAC75749.1|  RNA polymerase II transcription elongation facto...  65.1    5e-08   Moesziomyces antarcticus T-34
emb|CDX95539.1|  BnaC01g34310D                                        60.8    1e-06   
ref|XP_001526874.1|  hypothetical protein LELG_01702                  59.3    2e-06   Lodderomyces elongisporus NRRL YB-4239
ref|XP_007877059.1|  hypothetical protein PFL1_01366                  59.7    2e-06   Anthracocystis flocculosa PF-1
emb|CCE40692.1|  hypothetical protein CPAR2_107270                    58.5    4e-06   Candida parapsilosis
ref|XP_001385834.2|  hypothetical protein PICST_48306                 57.0    4e-06   Scheffersomyces stipitis CBS 6054
gb|KGN47017.1|  hypothetical protein Csa_6G169330                     55.1    6e-06   Cucumis sativus [cucumbers]
gb|EDK37916.2|  hypothetical protein PGUG_02014                       57.0    1e-05   Meyerozyma guilliermondii ATCC 6260
emb|CDI54908.1|  hypothetical protein BN887_03112                     57.4    1e-05   Melanopsichium pennsylvanicum 4
sp|O59671.3|POF4_SCHPO  RecName: Full=Elongin-A; AltName: Full=Pr...  55.8    2e-05   Schizosaccharomyces pombe 972h-
gb|EPY49632.1|  elongin-A                                             55.8    2e-05   Schizosaccharomyces cryophilus OY26
ref|XP_003867987.1|  Ela1 protein                                     55.8    3e-05   Candida orthopsilosis Co 90-125
ref|NP_595836.2|  elongin-A, F-box protein Pof4 (predicted)           53.9    3e-05   Schizosaccharomyces pombe
gb|KIK59590.1|  hypothetical protein GYMLUDRAFT_60129                 55.5    4e-05   Gymnopus luxurians FD-317 M1
ref|XP_002171819.1|  elongin-A                                        54.7    4e-05   Schizosaccharomyces japonicus yFS275
ref|XP_011390759.1|  hypothetical protein UMAG_10405                  55.5    6e-05   Ustilago maydis 521
dbj|GAM24360.1|  hypothetical protein SAMD00019534_075350             52.8    1e-04   Acytostelium subglobosum LB1
ref|XP_713678.1|  hypothetical protein CaO19.8630                     53.9    1e-04   
gb|KGU14719.1|  hypothetical protein MEQ_00363                        53.9    1e-04   Candida albicans P87
gb|KGR03584.1|  hypothetical protein MG1_00366                        53.9    1e-04   Candida albicans GC75
ref|XP_456749.2|  DEHA2A09614p                                        53.9    2e-04   Debaryomyces hansenii CBS767
emb|CBQ68825.1|  conserved hypothetical protein                       53.9    2e-04   Sporisorium reilianum SRZ2
emb|CCF50758.1|  uncharacterized protein UHOR_06336                   53.9    2e-04   Ustilago hordei
ref|XP_008329245.1|  PREDICTED: transcription elongation factor B...  53.9    2e-04   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KHC68548.1|  Ela1p-like protein                                    53.1    2e-04   Candida albicans P75010
gb|KHC57342.1|  Ela1p-like protein                                    53.1    2e-04   Candida albicans P60002
ref|XP_008329247.1|  PREDICTED: transcription elongation factor B...  53.5    2e-04   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001486343.1|  hypothetical protein PGUG_02014                  52.8    2e-04   Meyerozyma guilliermondii ATCC 6260
gb|EJW72673.1|  hypothetical protein WUBG_16420                       50.4    3e-04   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KGQ91646.1|  hypothetical protein MEO_00370                        53.1    3e-04   Candida albicans P94015
gb|KGT72565.1|  hypothetical protein MEK_00370                        52.8    3e-04   Candida albicans 12C
gb|KGR23435.1|  hypothetical protein MG9_00370                        52.8    3e-04   Candida albicans P37037
ref|XP_004201945.1|  Piso0_001411                                     52.8    3e-04   
ref|XP_004202570.1|  Piso0_001411                                     52.8    4e-04   
ref|XP_003386815.1|  PREDICTED: transcription elongation factor B...  52.4    4e-04   
gb|EEQ42788.1|  conserved hypothetical protein                        52.4    4e-04   Candida albicans WO-1
ref|XP_008384426.1|  PREDICTED: uncharacterized protein LOC103447028  50.1    4e-04   
gb|KHC43211.1|  hypothetical protein MGQ_00362                        52.4    4e-04   Candida albicans P76067
gb|KGU36560.1|  hypothetical protein MGM_00363                        52.4    5e-04   Candida albicans P75063
gb|KGR15511.1|  hypothetical protein MG5_00364                        52.4    5e-04   Candida albicans P57072
gb|EPB81267.1|  hypothetical protein HMPREF1544_12033                 51.6    5e-04   Mucor circinelloides f. circinelloides 1006PhL
gb|KGU33756.1|  hypothetical protein MG7_00362                        52.4    5e-04   Candida albicans P34048
ref|XP_008549497.1|  PREDICTED: transcription elongation factor B...  52.8    5e-04   
gb|KHC40420.1|  hypothetical protein MGO_00365                        52.4    5e-04   Candida albicans P76055
gb|KIL69948.1|  hypothetical protein M378DRAFT_719541                 52.0    5e-04   Amanita muscaria Koide BX008
ref|XP_008549498.1|  PREDICTED: transcription elongation factor B...  52.8    5e-04   Microplitis demolitor
ref|XP_002417027.1|  conserved hypothetical protein                   52.0    6e-04   Candida dubliniensis CD36
ref|XP_001898153.1|  RNA polymerase II:SUBUNIT=110kD                  51.6    7e-04   Brugia malayi [agent of lymphatic filariasis]
emb|CDP96024.1|  Protein Bm9930                                       51.6    0.001   Brugia malayi [agent of lymphatic filariasis]



>ref|XP_009603855.1| PREDICTED: uncharacterized protein LOC104098749 [Nicotiana tomentosiformis]
Length=221

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            R  PSLVDLCVQ AID+VRY+GDVG TD HLLER LPHCT++QL  +E STQGRDLS VT
Sbjct  3    RMIPSLVDLCVQTAIDNVRYLGDVGETDSHLLERILPHCTLEQLIHVENSTQGRDLSQVT  62

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D++WK+FY+ +FG+KS + V+ERMKQKKVTFKW  LYEAK KEVEETQQ+SF+RI++LY+
Sbjct  63   DRLWKRFYQIQFGEKSTNQVVERMKQKKVTFKWKLLYEAKSKEVEETQQRSFERIKELYQ  122

Query  566  KHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K DA++QSRQ+++CTKVPPSS+KRS    G  S+  NTKST+MKKAK++F+ S EVKNLA
Sbjct  123  KEDAKRQSRQVRVCTKVPPSSNKRSFWGSGPGSSFCNTKSTLMKKAKIEFVNSREVKNLA  182

Query  392  AIKNKAVQRTN  360
            A+KNKAVQR +
Sbjct  183  AMKNKAVQRNH  193



>ref|XP_009802919.1| PREDICTED: uncharacterized protein LOC104248366 [Nicotiana sylvestris]
Length=221

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            R  PSLVDLCVQ AID+VRY+GDVG TD HLLER LPHC+++QL  +E STQGRDLS VT
Sbjct  3    RMVPSLVDLCVQTAIDNVRYLGDVGETDSHLLERILPHCSLEQLIHVENSTQGRDLSQVT  62

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D++WK+FY+ +FG+KS + V+ERMKQKKVTFKW  LYEAK KEVEETQQ+SF+RI++LY+
Sbjct  63   DRLWKRFYQIQFGEKSTNQVVERMKQKKVTFKWKLLYEAKSKEVEETQQRSFERIKELYQ  122

Query  566  KHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K DA++QSRQ+++CTKVPPSS+KRS    G  S+  NTKST+MKKAK++F+ S EVKNLA
Sbjct  123  KEDAKRQSRQVRVCTKVPPSSNKRSFWGSGPGSSFCNTKSTLMKKAKIEFVNSREVKNLA  182

Query  392  AIKNKAVQRTN  360
            A+KNKAVQR +
Sbjct  183  AMKNKAVQRNH  193



>ref|XP_011098066.1| PREDICTED: transcription elongation factor B polypeptide 3 [Sesamum 
indicum]
Length=226

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RKAPSLVDLCVQ+AID+VRY+GDVG TDFHLL+R L HCT+DQL  IE  T+GRDLSPVT
Sbjct  3    RKAPSLVDLCVQLAIDNVRYLGDVGETDFHLLDRILSHCTLDQLTHIENKTEGRDLSPVT  62

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+FY+ +FG  S + V+ERM+Q+KVTFKW QLYEAK+KE EE  QKS DRI+  Y+
Sbjct  63   DKLWKKFYKLQFGVDSTNTVVERMRQRKVTFKWRQLYEAKVKEREEATQKSLDRIKQRYQ  122

Query  566  KHDAEKQSRQIKLCTKVPP--ssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            + DA KQSRQ++LC+KVPP            +SNIYNTKS ++KKAK++F+ S EVKN+A
Sbjct  123  EEDARKQSRQVQLCSKVPPPSKKRSFYGGVAASNIYNTKSGLLKKAKLEFINSREVKNIA  182

Query  392  AIKNKAVQRTN  360
            A+KNK V R +
Sbjct  183  AMKNKVVHRNH  193



>ref|XP_007048788.1| Nucleus, subunit A, putative isoform 2 [Theobroma cacao]
 gb|EOX92945.1| Nucleus, subunit A, putative isoform 2 [Theobroma cacao]
Length=237

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLC++ AID+VRY+GDVG TD HLLER LPHCT+DQL  +EKST+GRDLSPVT
Sbjct  17   RKPPSLVDLCIRTAIDNVRYLGDVGETDSHLLERILPHCTMDQLIHVEKSTKGRDLSPVT  76

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE +FG+ S +LVIERMK KKV+F+W QLYEAKLK+V+E + K+ DR++ LYK
Sbjct  77   DKLWKNFYELQFGRASTNLVIERMKLKKVSFRWRQLYEAKLKDVQEAENKAIDRLKQLYK  136

Query  566  KHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K DA KQSRQ++LCTKVPPSS +   +  G   N+   KS +MKKAK+D ++S EVKNLA
Sbjct  137  KEDARKQSRQVQLCTKVPPSSKRSFFAGSGPGYNLSYVKSNIMKKAKIDLMKSQEVKNLA  196

Query  392  AIKNKAVQ  369
            A+K KAVQ
Sbjct  197  AMKKKAVQ  204



>gb|KHF97908.1| Elongin-A [Gossypium arboreum]
Length=237

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+  ID+VRY+GDVG TD HLLER LPHCTVDQL  +EKST+GRDLS VT
Sbjct  17   RKTPSLVDLCVRTVIDNVRYLGDVGETDSHLLERILPHCTVDQLLHVEKSTKGRDLSSVT  76

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE +FG++S  +VIERMK KKV+F+W QLYEAKLK+V+E + K+ DR++ LYK
Sbjct  77   DKLWKNFYELQFGRESMKIVIERMKLKKVSFRWRQLYEAKLKDVQEAENKAIDRLKQLYK  136

Query  566  KHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K DA KQSRQ++LCTKVPPSS +   +  G   N+ N KS +MKKAK+D ++S EVKNLA
Sbjct  137  KEDARKQSRQVQLCTKVPPSSKRSFFAGSGPGYNMSNVKSNIMKKAKIDLMKSQEVKNLA  196

Query  392  AIKNKAVQ  369
            A+K KAVQ
Sbjct  197  AMKKKAVQ  204



>gb|KJB33266.1| hypothetical protein B456_006G004800 [Gossypium raimondii]
Length=237

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+  ID+VRY+GDVG TD HLLER LPHCTVDQL  +E ST+GRDLS VT
Sbjct  17   RKTPSLVDLCVRTVIDNVRYLGDVGETDSHLLERILPHCTVDQLLHVETSTKGRDLSSVT  76

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE +FG++S  +VIERMK KKV+F+W QLYEAKLK+V+E + K+ DR++ LYK
Sbjct  77   DKLWKNFYELQFGRESMQIVIERMKLKKVSFRWRQLYEAKLKDVQEAENKAIDRLKQLYK  136

Query  566  KHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K DA KQSRQ++LCTKVPPSS +   +  G   N+ N KS +MKKAK+D ++S EVKNLA
Sbjct  137  KEDARKQSRQVQLCTKVPPSSKRSFFAGSGPGYNMSNVKSNIMKKAKIDLMKSQEVKNLA  196

Query  392  AIKNKAVQ  369
            A+K KAVQ
Sbjct  197  AMKKKAVQ  204



>ref|XP_006348930.1| PREDICTED: uncharacterized protein LOC102593806 isoform X1 [Solanum 
tuberosum]
 ref|XP_006348931.1| PREDICTED: uncharacterized protein LOC102593806 isoform X2 [Solanum 
tuberosum]
 ref|XP_006348932.1| PREDICTED: uncharacterized protein LOC102593806 isoform X3 [Solanum 
tuberosum]
Length=303

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            K PSLVDLCVQ A+D+VRY+GDVG TD HLLER LPHC+++QL  +E ST+GRDLS VTD
Sbjct  4    KVPSLVDLCVQTAVDNVRYLGDVGETDTHLLERILPHCSLEQLTHVENSTEGRDLSQVTD  63

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            ++WK+FY+ EFG KS + V+ERMK+ KVTFKW QLYEAK +E+EETQQ+SF+RI++LY+ 
Sbjct  64   RLWKRFYQIEFGDKSINQVVERMKKVKVTFKWKQLYEAKTEEMEETQQRSFERIKELYQN  123

Query  563  HDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
             +A++QSRQ+++CTKVPPSS+KRS    G  SN  NTKS +MKKAK++F+ S EVKNLAA
Sbjct  124  ENAKRQSRQVRVCTKVPPSSNKRSFYGSGLGSNFGNTKSPLMKKAKIEFVNSREVKNLAA  183

Query  389  IKNKAVQR  366
            +KNK+VQR
Sbjct  184  MKNKSVQR  191



>ref|XP_011008966.1| PREDICTED: transcription elongation factor B polypeptide 3 [Populus 
euphratica]
Length=227

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV +A+++V+Y+GDVG TD HLL+R LPHCTVDQL  IEKST GRDLS VT
Sbjct  6    RKVPSLVDLCVSLAVENVKYLGDVGETDLHLLDRILPHCTVDQLMHIEKSTVGRDLSSVT  65

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE++FG++S  LVI+RM+QKKV+F+W QLYEAKLKE+ E + K   RIR LYK
Sbjct  66   DKLWKTFYEKQFGERSTDLVIQRMRQKKVSFRWLQLYEAKLKEIAEAENKLGSRIRQLYK  125

Query  566  KHDAEKQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNL  396
            K D  KQSRQ++LC+KVPPSS+KRS     G   N+ N KS +MKKAKMDFL+S EV+N+
Sbjct  126  KEDDRKQSRQVRLCSKVPPSSNKRSFCGGSGPGYNLSNGKSNLMKKAKMDFLKSREVQNI  185

Query  395  AAIKNKAVQRT  363
            AA++  A+QR 
Sbjct  186  AAMRKNALQRN  196



>ref|XP_002317925.1| hypothetical protein POPTR_0012s05560g [Populus trichocarpa]
 gb|ABK92704.1| unknown [Populus trichocarpa]
 gb|EEE96145.1| hypothetical protein POPTR_0012s05560g [Populus trichocarpa]
Length=227

 Score =   246 bits (628),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 167/224 (75%), Gaps = 5/224 (2%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV +A+++V+Y+GDVG TD HLL+R LPHCT+DQL  IEKST GRDLS VT
Sbjct  6    RKVPSLVDLCVSLAVENVKYLGDVGETDLHLLDRILPHCTLDQLMHIEKSTVGRDLSSVT  65

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE++FG++S  LVI+RM+QKKV+F+W QLYEAKLK++ E + K   RIR LYK
Sbjct  66   DKLWKTFYEKQFGERSTDLVIQRMRQKKVSFRWLQLYEAKLKDIAEAENKLAARIRQLYK  125

Query  566  KHDAEKQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNL  396
            K D  KQSRQ++LC+KVPPSS+KRS     G   N+ N KS +MKKAKMDFL+S EV+N+
Sbjct  126  KEDDRKQSRQVRLCSKVPPSSNKRSFCGGSGPGYNLSNGKSNLMKKAKMDFLKSREVQNI  185

Query  395  AAIKNKAVQRTNsvsvsspkkpggpSALAASSRPKPMNPPMKRF  264
            AA+K  A+QR +S S         P   +ASS   PM P  +RF
Sbjct  186  AAMKKNALQRNSSSSSMMKPPGSFPGKSSASS--NPMKPRERRF  227



>ref|XP_004243240.1| PREDICTED: uncharacterized protein LOC101258385 [Solanum lycopersicum]
 ref|XP_010323647.1| PREDICTED: uncharacterized protein LOC101258385 [Solanum lycopersicum]
 ref|XP_010323648.1| PREDICTED: uncharacterized protein LOC101258385 [Solanum lycopersicum]
 ref|XP_010323649.1| PREDICTED: uncharacterized protein LOC101258385 [Solanum lycopersicum]
 ref|XP_010323650.1| PREDICTED: uncharacterized protein LOC101258385 [Solanum lycopersicum]
Length=311

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            K PSLVDLCV+ A+D++RY+GDVG TD +LLER LPHC+++QL  +E ST+GRDLS VTD
Sbjct  4    KVPSLVDLCVRTAVDNLRYLGDVGETDTYLLERILPHCSLEQLTHVENSTEGRDLSQVTD  63

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            ++WK+FY+ EFG KS + V+ERMKQ KVTFKW QLYEAK +E+EETQQ+SF+RI++LY+ 
Sbjct  64   RLWKRFYQIEFGDKSINQVVERMKQVKVTFKWKQLYEAKTQEMEETQQRSFERIKELYQN  123

Query  563  HDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
             +A++QSRQ+++CTKVPPSS+KRS    G  SN  NTKS +MKKAK++F+ S EVKNLAA
Sbjct  124  ENAKRQSRQVQVCTKVPPSSNKRSFYGSGLGSNFGNTKSPLMKKAKIEFVNSREVKNLAA  183

Query  389  IKNKAVQR  366
            +KNK+VQR
Sbjct  184  MKNKSVQR  191



>ref|XP_002282527.1| PREDICTED: transcription elongation factor B polypeptide 3 [Vitis 
vinifera]
 emb|CBI22048.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLC++ AID+VRY+GDVG TD +LL+  LPHCTVDQL  IEK T+ RDLS VT
Sbjct  7    RKVPSLVDLCIRTAIDNVRYLGDVGETDINLLDHILPHCTVDQLMHIEKCTEERDLSEVT  66

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+FYE+EFG KS +LV+ERMK KKV+FKW++LYEAKLK+ +E Q+KSFDRI+ LY+
Sbjct  67   DKLWKKFYEKEFGVKSTNLVVERMKLKKVSFKWSKLYEAKLKDRDEAQKKSFDRIKQLYQ  126

Query  566  KHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAI  387
            K DA KQSRQ+K+CTKVPP SS +  + G     N KS +MKKAK++ L SPEVKNLAA+
Sbjct  127  KEDARKQSRQVKICTKVPP-SSNKRCFYGGPGTSNLKSNLMKKAKVECLNSPEVKNLAAM  185

Query  386  KNKAVQ  369
            K +A+Q
Sbjct  186  KKQALQ  191



>ref|XP_007048787.1| Nucleus, subunit A, putative isoform 1 [Theobroma cacao]
 gb|EOX92944.1| Nucleus, subunit A, putative isoform 1 [Theobroma cacao]
Length=254

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 153/205 (75%), Gaps = 19/205 (9%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLC++ AID+VRY+GDVG TD HLLER LPHCT+DQL  +EKST+GRDLSPVT
Sbjct  17   RKPPSLVDLCIRTAIDNVRYLGDVGETDSHLLERILPHCTMDQLIHVEKSTKGRDLSPVT  76

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE +FG+ S +LVIERMK KKV+F+W QLYEAKLK+V+E + K+ DR++ LYK
Sbjct  77   DKLWKNFYELQFGRASTNLVIERMKLKKVSFRWRQLYEAKLKDVQEAENKAIDRLKQLYK  136

Query  566  KHDA-----------------EKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVM  444
            K DA                  KQSRQ++LCTKVPPSS +   +  G   N+   KS +M
Sbjct  137  KEDARVITREMVPQALSCKHSRKQSRQVQLCTKVPPSSKRSFFAGSGPGYNLSYVKSNIM  196

Query  443  KKAKMDFLRSPEVKNLAAIKNKAVQ  369
            KKAK+D ++S EVKNLAA+K KAVQ
Sbjct  197  KKAKIDLMKSQEVKNLAAMKKKAVQ  221



>ref|XP_008229385.1| PREDICTED: elongin-A [Prunus mume]
Length=230

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSLVDLC+  AID++R++GDVG T+ + LER LPHCTVDQL  +EKST+GRDLSP+TD +
Sbjct  11   PSLVDLCINTAIDNIRHLGDVGETELYFLERILPHCTVDQLRHVEKSTKGRDLSPITDNL  70

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHD  558
            W++ Y++EFG +  +LVIERMK+KKV+F+WNQLYEAKL+EV+E + K  DR++ LY+K D
Sbjct  71   WRKLYQKEFGIERTNLVIERMKKKKVSFRWNQLYEAKLREVDEAENKVADRLKSLYQKED  130

Query  557  AEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNK  378
            A KQSRQ+++CTKVPPSS+KRSF  G  N+   KS++MKK+K+DFL+S EV+NLAA+K  
Sbjct  131  ARKQSRQVRICTKVPPSSNKRSFGNGGYNV-TAKSSLMKKSKIDFLKSHEVRNLAAMKKN  189

Query  377  AVQRTNsvsvsspkkpggpSALAASSR-PKPMNPPMKRF  264
            ++Q++ S               A+SS+ PKP+   +KR+
Sbjct  190  SLQKSYSAPPVKRPGEFSGKDSASSSKQPKPIERNLKRY  228



>gb|KHM99611.1| Elongin-A [Glycine soja]
Length=230

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            + PSLVDLCVQ  ID+VRY+G+VG+ D HLLE+ LPHCT DQL  +EKST+GR+LSPVTD
Sbjct  13   RTPSLVDLCVQKVIDNVRYLGNVGSLDQHLLEQILPHCTADQLMHVEKSTKGRNLSPVTD  72

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+FYE++FG  + + VI+RMK+K+V F+W QLYEAK KE  + + ++ DRIR LYKK
Sbjct  73   KLWKKFYEKQFGTNNTNEVIKRMKEKRVNFRWMQLYEAKGKERAQAENEALDRIRQLYKK  132

Query  563  HDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
             DA KQSRQ++ CTKVPPSS +R     G   N+ N KS +MKKAK++FL+S EVKNLAA
Sbjct  133  EDARKQSRQVRTCTKVPPSSKRRFWGDNGPGYNVSNVKSNIMKKAKIEFLKSHEVKNLAA  192

Query  389  IKNKAVQRT  363
            +KNK++QR 
Sbjct  193  MKNKSIQRN  201



>ref|XP_010053019.1| PREDICTED: transcription elongation factor B polypeptide 3 [Eucalyptus 
grandis]
 ref|XP_010053025.1| PREDICTED: transcription elongation factor B polypeptide 3 [Eucalyptus 
grandis]
 ref|XP_010053032.1| PREDICTED: transcription elongation factor B polypeptide 3 [Eucalyptus 
grandis]
 gb|KCW89685.1| hypothetical protein EUGRSUZ_A01953 [Eucalyptus grandis]
 gb|KCW89686.1| hypothetical protein EUGRSUZ_A01953 [Eucalyptus grandis]
Length=239

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 157/208 (75%), Gaps = 15/208 (7%)
 Frame = -3

Query  947  MRSAVGNRK--------------APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHC  810
            MRS VG+R+               PSLVDLCV+  ID++RY+GDVG TD  LL R LPHC
Sbjct  1    MRSEVGSRRIGCEFGRNMLMKSEPPSLVDLCVRTVIDNLRYLGDVGGTDPQLLARILPHC  60

Query  809  TVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEA  630
            TVDQL  IEKST+GRDL+P+TD +WK FYE+EFG ++  LV ERM+ K V+F+W+QLYEA
Sbjct  61   TVDQLMHIEKSTKGRDLTPITDDLWKNFYEKEFGIRNTKLVNERMEDKGVSFRWSQLYEA  120

Query  629  KLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKST  450
            KLK++E+ Q+KS DR++  YK+ DA KQSRQ++LCTKVPP SS +  +GGS N+   KS 
Sbjct  121  KLKDIEQAQKKSLDRMKQRYKETDARKQSRQVRLCTKVPP-SSNKRSFGGSYNVSYLKSN  179

Query  449  VMKKAKMDFLRSPEVKNLAAIKNKAVQR  366
            +MKKAK++ L+SPEVKN+AA+K  A+QR
Sbjct  180  IMKKAKIEALKSPEVKNIAAMKKNAIQR  207



>ref|XP_007146389.1| hypothetical protein PHAVU_006G036100g [Phaseolus vulgaris]
 gb|ESW18383.1| hypothetical protein PHAVU_006G036100g [Phaseolus vulgaris]
Length=228

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            K P+LVDLCVQ  ID+VRY+G+VG  D HLLER LPHCTVDQL  +EKST+GRDLSPVTD
Sbjct  11   KIPTLVDLCVQKVIDNVRYLGNVGYVDQHLLERILPHCTVDQLMHVEKSTKGRDLSPVTD  70

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+F+E++FG  S + VI+RMK+KKV+F+W QLYEAK KE+ + + ++ DRI+ LYKK
Sbjct  71   KLWKKFFEKQFGTNSTNEVIKRMKEKKVSFRWAQLYEAKGKEMAQAENEALDRIKQLYKK  130

Query  563  HDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
             DA KQSRQ++ CTKVPPSS KR     G   N+ N KS +MKKAK++F++S EVKN+AA
Sbjct  131  EDARKQSRQVRPCTKVPPSSKKRFWGDNGPGYNVSNLKSNIMKKAKIEFMKSQEVKNIAA  190

Query  389  IKNKAVQRT  363
            +K   +QR+
Sbjct  191  MKKNCIQRS  199



>gb|ACU16340.1| unknown [Glycine max]
Length=230

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            + PSLVDLCVQ  ID+VRY+G+VG+ D HLLE+ LPHCT DQL  +EKST+GR+ SPVTD
Sbjct  13   RTPSLVDLCVQKVIDNVRYLGNVGSLDQHLLEQILPHCTADQLMHVEKSTKGRNPSPVTD  72

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+FYE++FG  + + VI+RMK+K+V F+W QLYEAK KE  + + ++ DRIR LYKK
Sbjct  73   KLWKKFYEKQFGTNNTNEVIKRMKKKRVNFRWMQLYEAKGKERAQAENEALDRIRQLYKK  132

Query  563  HDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
             DA KQSRQ++ CTKVPPSS +R     G   N+ N KS +MKKAK++FL+S EVKNLAA
Sbjct  133  EDARKQSRQVRTCTKVPPSSKRRFWGDNGPGYNVSNVKSNIMKKAKIEFLKSHEVKNLAA  192

Query  389  IKNKAVQRT  363
            +KNK++QR 
Sbjct  193  MKNKSIQRN  201



>ref|XP_008456387.1| PREDICTED: uncharacterized protein LOC103496337 [Cucumis melo]
Length=225

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV  AID++R++GDVG TD HLLER LPHCTVDQL  +EKS++GRDL+PVT
Sbjct  5    RKIPSLVDLCVNKAIDNIRFLGDVGETDIHLLERILPHCTVDQLMHVEKSSEGRDLTPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+FYER+FGK+S + VIERM+QK+V F+W QLYEAK++++E+ + K+ DRI+  Y 
Sbjct  65   DKLWKKFYERQFGKESTTTVIERMRQKRVAFRWIQLYEAKMQDIEKNESKAADRIKQSYL  124

Query  566  KHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K +A KQSRQI++C+KVPPSS+KRS    G   N+ NTK+ ++KKAK++ L+S E+KN+ 
Sbjct  125  KENARKQSRQIQICSKVPPSSNKRSFGGSGYGYNVANTKNKILKKAKIEVLQSQEMKNIK  184

Query  392  AIKNKAVQRTN  360
            A +  AVQ+++
Sbjct  185  AWRRNAVQKSS  195



>ref|XP_012070201.1| PREDICTED: elongin-A [Jatropha curcas]
 gb|KDP39805.1| hypothetical protein JCGZ_03941 [Jatropha curcas]
Length=226

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            KAPSLVDLCV VAI +VRY+GDVG TD HLL+R LPHCT+DQL  IEK T+GRDLSPVTD
Sbjct  7    KAPSLVDLCVDVAISNVRYLGDVGETDLHLLDRILPHCTMDQLIHIEKRTEGRDLSPVTD  66

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+F+EREFG    + VIE+M++ KV+F+W +LYEAKLK++ + + ++  R+R  Y+K
Sbjct  67   KLWKRFFEREFGVSKTNDVIEKMRRLKVSFRWKELYEAKLKDIAQEEDRTGSRLRQSYQK  126

Query  563  HDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
             +A+KQSRQ++LCTKVPPSS +      G   N+ N KS +MKK+K+DFL+S EV+N+AA
Sbjct  127  ENAKKQSRQVRLCTKVPPSSKRSFYGGSGPGCNLSNVKSNIMKKSKIDFLKSREVQNIAA  186

Query  389  IKNKAVQRTN  360
            +K  +VQR N
Sbjct  187  MKKISVQRNN  196



>gb|AFK36819.1| unknown [Lotus japonicus]
Length=222

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = -3

Query  944  RSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGR  765
            R  V  RK PSLVDLCV+  ID++RY+G+VG+ D HLLER LPHCT++QL  +EK++ G 
Sbjct  4    RDQVPVRKLPSLVDLCVEKVIDNLRYLGNVGSVDHHLLERILPHCTLEQLMHVEKASVGC  63

Query  764  DLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDR  585
            DLSPVTDK+WK+F+E++FG  S + VI+RM++KKV+FKW QLYEAK+KE+ E + ++  R
Sbjct  64   DLSPVTDKLWKKFFEKQFGTHSTNEVIKRMREKKVSFKWMQLYEAKVKEIAEAENEAVAR  123

Query  584  IRDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEV  405
            I+  Y+K DA KQSRQ++LCTK PPSS KR +     N+ N KS +MKK++++ L+S EV
Sbjct  124  IKQRYQKEDARKQSRQVQLCTKTPPSSKKRFWGDNGYNVSNLKSNIMKKSRIELLKSHEV  183

Query  404  KNLAAIKNKAVQRTN  360
            KNLAA+KNK++QR N
Sbjct  184  KNLAAMKNKSIQRNN  198



>ref|XP_007215918.1| hypothetical protein PRUPE_ppa010897mg [Prunus persica]
 ref|XP_007215919.1| hypothetical protein PRUPE_ppa010897mg [Prunus persica]
 gb|EMJ17117.1| hypothetical protein PRUPE_ppa010897mg [Prunus persica]
 gb|EMJ17118.1| hypothetical protein PRUPE_ppa010897mg [Prunus persica]
Length=231

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 166/219 (76%), Gaps = 1/219 (0%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSLVDLC+  AID++R++GDVG T+ + LER LPHCTVDQL  +EKST+GRDLSP+TD +
Sbjct  11   PSLVDLCINTAIDNIRHLGDVGETELYFLERILPHCTVDQLRHVEKSTKGRDLSPITDNL  70

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHD  558
            W++ Y++EFG +  +LVIERMK+KKV+F+WNQLYEAKL+EV+  + K  D ++ LY+K D
Sbjct  71   WRKLYQKEFGIERTNLVIERMKKKKVSFRWNQLYEAKLREVDVAENKVADLLKSLYQKED  130

Query  557  AEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNK  378
            A KQSRQ+++CTKVPPSS+KRSF  G       KS +MKK+K+DFL+S EV+NLAA+K K
Sbjct  131  ARKQSRQVRICTKVPPSSNKRSFGNGPGYNVTAKSNLMKKSKIDFLKSHEVRNLAAMKKK  190

Query  377  AVQRTNsvsvsspkkpggpSALAASSR-PKPMNPPMKRF  264
            ++Q++ SV              A+SS+ PKP+   +KR+
Sbjct  191  SLQKSYSVPPVKRPGEFSGKDSASSSKQPKPIERNLKRY  229



>ref|XP_004143189.1| PREDICTED: transcription elongation factor B polypeptide 3 [Cucumis 
sativus]
Length=225

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV  AID++R++GDVG TD HLL+R LPHCTVDQL  +EKS++GRDL+PVT
Sbjct  5    RKIPSLVDLCVNKAIDNLRFLGDVGETDIHLLDRILPHCTVDQLMHVEKSSEGRDLTPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+FYER+FGK+S + VIERM+QK+V F+W QLYEAK++++E+ + K+ DRI+  Y 
Sbjct  65   DKLWKKFYERQFGKESTTTVIERMRQKRVAFRWIQLYEAKMEDIEKNESKAADRIKQSYL  124

Query  566  KHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K +A KQSRQI++C+KVPPSS+KRS    G   N+ NTK+ ++KKAK++ L+S E+KN+ 
Sbjct  125  KENARKQSRQIQICSKVPPSSNKRSFGGSGYGYNVANTKNKILKKAKIEVLQSQEMKNIK  184

Query  392  AIKNKAVQRTN  360
            A +  AVQ+++
Sbjct  185  AWRRNAVQKSS  195



>ref|XP_011471042.1| PREDICTED: elongin-A-like [Fragaria vesca subsp. vesca]
Length=237

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSLVDLC+ VAID++RY+GDVG TDF  LE+ LPH T DQL  IEKST+GRDLSPVTDK+
Sbjct  16   PSLVDLCIHVAIDNIRYLGDVGETDFDFLEQILPHSTKDQLMHIEKSTKGRDLSPVTDKL  75

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHD  558
            W++FYE++FG +  +LVIERMK+KKV F+W QLY+AKL+EV+E + ++ DR+++ YKK  
Sbjct  76   WRKFYEKDFGIERTNLVIERMKKKKVNFRWLQLYQAKLREVDEAENEAADRLKNSYKKEV  135

Query  557  AEKQSRQIKLCTKVPPssskrs-fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKN  381
            A KQSRQ+++C KVPPSS+KRS   GG+ N+ NTKS ++KKAK+D+L+SPEV+N A ++ 
Sbjct  136  ARKQSRQVRICEKVPPSSNKRSWGGGGNYNVSNTKSNLLKKAKLDYLKSPEVRNAAVMRR  195

Query  380  KAVQRT  363
             A+QR+
Sbjct  196  TAIQRS  201



>ref|XP_006448014.1| hypothetical protein CICLE_v10016502mg [Citrus clementina]
 ref|XP_006492250.1| PREDICTED: RNA polymerase II transcription factor SIII subunit 
A3-like [Citrus sinensis]
 ref|XP_006495225.1| PREDICTED: RNA polymerase II transcription factor SIII subunit 
A3-like [Citrus sinensis]
 gb|ESR61254.1| hypothetical protein CICLE_v10016502mg [Citrus clementina]
Length=237

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 153/196 (78%), Gaps = 1/196 (1%)
 Frame = -3

Query  947  MRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQG  768
            M  +V  R APSLVDLCV+V I ++RY+GDVG TD HLLE+ LPHCT DQL  +E ST G
Sbjct  11   MPGSVERRPAPSLVDLCVKVVIGNIRYLGDVGETDSHLLEQILPHCTRDQLMHVENSTIG  70

Query  767  RDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFD  588
            RDLSPVTD++W +FY+++FG+K+ +LVIERMK+KKV F+W QLYEAK K+V E +  + +
Sbjct  71   RDLSPVTDELWMKFYKKDFGEKNFNLVIERMKKKKVAFRWKQLYEAKTKDVFEAENVAAN  130

Query  587  RIRDLYKKHDAEKQSRQIKLCTKVPPssskrs-fyggsSNIYNTKSTVMKKAKMDFLRSP  411
            R++ LY+K DA+KQSRQI++C KVPPSS+KRS   G    I   KS++MKKAK+D L+S 
Sbjct  131  RLKQLYQKADAQKQSRQIRICEKVPPSSNKRSWGNGPGYGISGGKSSLMKKAKLDLLKSQ  190

Query  410  EVKNLAAIKNKAVQRT  363
            E KNLAA+K  AVQRT
Sbjct  191  EFKNLAAMKKNAVQRT  206



>gb|KDO58600.1| hypothetical protein CISIN_1g028495mg [Citrus sinensis]
Length=208

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 153/196 (78%), Gaps = 1/196 (1%)
 Frame = -3

Query  947  MRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQG  768
            M  +V  R APSLVDLCV+V I ++RY+GDVG TD HLLE+ LPHCT DQL  +E ST G
Sbjct  11   MPGSVERRPAPSLVDLCVKVVIGNIRYLGDVGETDSHLLEQILPHCTRDQLMHVENSTIG  70

Query  767  RDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFD  588
            RDLSPVTD++W +FY+++FG+K+ +LVIERMK+KKV F+W QLYEAK K+V E +  + +
Sbjct  71   RDLSPVTDELWMKFYKKDFGEKNFNLVIERMKKKKVAFRWKQLYEAKTKDVFEAENVAAN  130

Query  587  RIRDLYKKHDAEKQSRQIKLCTKVPPssskrs-fyggsSNIYNTKSTVMKKAKMDFLRSP  411
            R++ LY+K DA+KQSRQI++C KVPPSS+KRS   G    I   KS++MKKAK+D L+S 
Sbjct  131  RLKQLYQKADAQKQSRQIRICEKVPPSSNKRSWGNGPGYGISGGKSSLMKKAKLDLLKSQ  190

Query  410  EVKNLAAIKNKAVQRT  363
            E KNLAA+K  AVQRT
Sbjct  191  EFKNLAAMKKNAVQRT  206



>ref|XP_010272725.1| PREDICTED: transcription elongation factor B polypeptide 3 [Nelumbo 
nucifera]
Length=225

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 165/221 (75%), Gaps = 8/221 (4%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLC++ AID+VRY+GDVG TD +LL+  LPHCTVDQL  IEKST+GRDLSPVT
Sbjct  5    RKPPSLVDLCIRTAIDNVRYLGDVGETDINLLKEILPHCTVDQLMHIEKSTEGRDLSPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D +WK+FYE++FG KSA+LVIERMKQ+KV+FKW  LY+AKLK+ +E Q+KS DR++ LY+
Sbjct  65   DSLWKKFYEQQFGAKSANLVIERMKQRKVSFKWRDLYDAKLKDWDEAQKKSVDRLKQLYE  124

Query  566  KHDAEKQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNL  396
            K    KQSRQI++CTKVPPSS+KR+     G SS++ N K  +MKKAK++FL S E+K  
Sbjct  125  KEVVRKQSRQIQICTKVPPSSNKRNFNWGSGSSSSVSNLKGNLMKKAKLEFLNSHEMKVH  184

Query  395  AAIKNKAVQRTNsvsvsspkkpggpSALAASSR-----PKP  288
            AA++  A+QR   VS +           A+SSR     P+P
Sbjct  185  AAMRKNALQRNQGVSRTIKPGGIIGRESASSSRVTRPLPRP  225



>ref|XP_008342397.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Malus domestica]
Length=231

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 161/219 (74%), Gaps = 2/219 (1%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G   APSLVDLC+  AID++R +GDVG TD HLL+R LPHCTVDQL  +EKST+GRDL+P
Sbjct  10   GQAVAPSLVDLCINTAIDNLRRLGDVGETDSHLLKRILPHCTVDQLMHVEKSTKGRDLTP  69

Query  752  VTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDL  573
            +TDK+WK+FYE+EFG    + VIERMKQKKV F+W+QLYEAKLKEV+  +    D+++  
Sbjct  70   ITDKLWKKFYEKEFGTTRVNEVIERMKQKKVAFRWSQLYEAKLKEVDMAENLIGDKLKSR  129

Query  572  YKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            Y++ +A KQSRQ+++CTKVPPSS+KRS+  G       KS +MKKAK+DFL+S EVKNLA
Sbjct  130  YQEANARKQSRQVQICTKVPPSSNKRSWGNGPGYNVXGKSNLMKKAKLDFLKSNEVKNLA  189

Query  392  AIKNKAVQRTNsvsvsspkkpggpSALAASSRPKPMNPP  276
            A+K  A+Q++ S            +A A+SS  K + PP
Sbjct  190  AMKRNALQKSYSAPPMKRPAAFSGNASASSS--KQIKPP  226



>ref|XP_009339540.1| PREDICTED: transcription elongation factor B polypeptide 3 [Pyrus 
x bretschneideri]
Length=231

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 161/219 (74%), Gaps = 2/219 (1%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G   APSLVDLC+  AID++R +GDVG TD HLL+R LPHCTVDQL  +EKST+GRDL+P
Sbjct  10   GQAVAPSLVDLCINTAIDNLRRLGDVGETDSHLLKRILPHCTVDQLMHVEKSTKGRDLTP  69

Query  752  VTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDL  573
            +TDK+WK+FYE+EFG    + VIERMKQKKV F+W+QLYEAKLKEV+  +    D+++  
Sbjct  70   ITDKLWKKFYEKEFGTTRVNEVIERMKQKKVAFRWSQLYEAKLKEVDMAENLIGDKLKSR  129

Query  572  YKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            Y++ +A +QSRQ+++CTKVPPSS+KRS+  G       KS +MKKAK+DFL+S EVKNLA
Sbjct  130  YQEANARRQSRQVQICTKVPPSSNKRSWGNGPGYNVTGKSNLMKKAKLDFLKSNEVKNLA  189

Query  392  AIKNKAVQRTNsvsvsspkkpggpSALAASSRPKPMNPP  276
            A+K  A+Q++ S            +A A+SS  K + PP
Sbjct  190  AMKRNALQKSYSAPPMKRPAACSGNASASSS--KQIRPP  226



>ref|XP_009350012.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Pyrus x bretschneideri]
Length=231

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G   APSLVDLC+  AID++R +GDVG TD HLL+R LPHCTVDQL  IEKST+GRDL+P
Sbjct  10   GQAIAPSLVDLCINTAIDNLRRLGDVGETDSHLLKRILPHCTVDQLMHIEKSTKGRDLTP  69

Query  752  VTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDL  573
            +TDK+WK+FYE+EFG K  + VIERMKQKKV F+W QLYEAKLKEV+  +    D+++  
Sbjct  70   ITDKLWKKFYEKEFGTKRVNEVIERMKQKKVAFRWIQLYEAKLKEVDMAENLMADKLKSR  129

Query  572  YKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            Y++ +A KQSRQ+++CTKVPPSS+KRS+  G       KS +MKKAK+DFL+S EVKNLA
Sbjct  130  YQEANARKQSRQVQICTKVPPSSNKRSWGNGPGCNVTGKSNLMKKAKLDFLKSNEVKNLA  189

Query  392  AIKNKAVQRT  363
            A+K  A+Q++
Sbjct  190  AMKRNALQKS  199



>gb|KJB33267.1| hypothetical protein B456_006G004800 [Gossypium raimondii]
Length=189

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+  ID+VRY+GDVG TD HLLER LPHCTVDQL  +E ST+GRDLS VT
Sbjct  17   RKTPSLVDLCVRTVIDNVRYLGDVGETDSHLLERILPHCTVDQLLHVETSTKGRDLSSVT  76

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK FYE +FG++S  +VIERMK KKV+F+W QLYEAKLK+V+E + K+ DR++ LYK
Sbjct  77   DKLWKNFYELQFGRESMQIVIERMKLKKVSFRWRQLYEAKLKDVQEAENKAIDRLKQLYK  136

Query  566  KHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLR  417
            K DA KQSRQ++LCTKVPPSS +   +  G   N+ N KS +MKKAK+D ++
Sbjct  137  KEDARKQSRQVQLCTKVPPSSKRSFFAGSGPGYNMSNVKSNIMKKAKIDLMK  188



>ref|XP_008380250.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Malus domestica]
 ref|XP_008380251.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Malus domestica]
Length=231

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  920  APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
            APSLVDLC+  AID++R +GDVG TD HLL+R LPHCTVDQL  +EKST+GRDL+P+TDK
Sbjct  14   APSLVDLCINTAIDNLRRLGDVGETDSHLLKRILPHCTVDQLMHVEKSTKGRDLTPITDK  73

Query  740  IWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKH  561
            +WK+FYE+EFG K  + VIERMKQKKV F+W QLYEAKLKEV+  +    D+++  Y++ 
Sbjct  74   LWKKFYEKEFGTKRVNEVIERMKQKKVAFRWIQLYEAKLKEVDMAENLMADKLKSRYQEA  133

Query  560  DAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKN  381
            +A KQSRQ+++CTKVPPSS+KRS+  G       KS +MKKAK+DFL+S EVKNLAA+K 
Sbjct  134  NARKQSRQVQICTKVPPSSNKRSWGNGPGYNVTGKSNLMKKAKLDFLKSNEVKNLAAMKR  193

Query  380  KAVQRT  363
             A+Q++
Sbjct  194  NALQKS  199



>ref|XP_004500002.1| PREDICTED: uncharacterized protein LOC101508994 [Cicer arietinum]
Length=228

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -3

Query  935  VGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLS  756
            + +RK  SLVDLCVQ AID+VRY+G+VG  D HLLER LPHCT+DQL  +EK+++G DLS
Sbjct  7    LSSRKKLSLVDLCVQKAIDNVRYLGNVGPVDHHLLERILPHCTLDQLMHVEKASEGTDLS  66

Query  755  PVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            PVTDK+WK+F+E++FG    + VI+RM++KKV+FKW QLYEAK+KE+ + + ++ DRI+ 
Sbjct  67   PVTDKLWKKFFEKQFGSNCTNEVIKRMREKKVSFKWLQLYEAKVKEMAQAENEALDRIKQ  126

Query  575  LYKKHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVK  402
             YKK DA KQSRQ+++CTKVPPSS KR     G   N+ N KS +MKK+K+DFL+S EVK
Sbjct  127  RYKKEDARKQSRQVRICTKVPPSSKKRLWGDNGPGYNVSNLKSNIMKKSKIDFLKSREVK  186

Query  401  NLAAIKNKAVQR  366
            N+AA+   ++QR
Sbjct  187  NIAAMNKNSIQR  198



>gb|EYU30739.1| hypothetical protein MIMGU_mgv1a013329mg [Erythranthe guttata]
Length=223

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+ AID+++Y+GDVG TD HLL+R L HC +D+L  IE STQG DLSPVT
Sbjct  3    RKVPSLVDLCVRTAIDNIKYLGDVGETDHHLLDRILSHCNLDELKHIEDSTQGSDLSPVT  62

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+FY+  FG  S  +V+ERM+++K T  W  LYEAKL E+E+ +++S DR+   Y+
Sbjct  63   DKMWKKFYKVRFGADSTDMVVERMRKRKTTVLWRLLYEAKLSEMEQAEKESVDRMTQRYR  122

Query  566  KHDAEKQSRQIKLCTKVPPssskrsf---yggsSNIYNTKSTVMKKAKMDFLRSPEVKNL  396
            +  A KQSRQ+KLC+KVPPSSS++       G+SNIYNTKS++MKKAK++F+ S EVKN+
Sbjct  123  EETARKQSRQVKLCSKVPPSSSRKRSFCGGVGASNIYNTKSSLMKKAKIEFVNSREVKNI  182

Query  395  AAIKNKAVQRTN  360
            AA+KNK V R +
Sbjct  183  AAMKNKMVHRNH  194



>emb|CDP18735.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSLVDLCVQ+A+ +VRY+G+VG T+FHLLER LPHCT+DQL  +E  T+GRDLSPVT+K+
Sbjct  5    PSLVDLCVQIAVLNVRYLGNVGETEFHLLERILPHCTMDQLIHVENCTEGRDLSPVTNKL  64

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHD  558
            WK+F+ER+FG +SA LV+ RMK+++V FKW +LY+AK +E+EE ++K  +R++  Y    
Sbjct  65   WKKFFERQFGAESAELVVARMKKRRVEFKWRELYKAKSQELEEKEKKISERLKQRYANEA  124

Query  557  AEKQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAI  387
            AEKQ R++++CTKVPPSS KRS     G  ++  N KS++MKKAK++FL S EVKNLAA+
Sbjct  125  AEKQKRRVQICTKVPPSSFKRSFFGAAGPYNSTSNGKSSIMKKAKLEFLNSREVKNLAAV  184

Query  386  KNKAVQRTNsvsvsspkkpggpSALAASSRPKPM  285
            KNKAVQ + SVS S         A +++ +PKP+
Sbjct  185  KNKAVQTSYSVSSSRKPSGFSSVASSSTCKPKPV  218



>ref|XP_003599918.1| Elongin-A [Medicago truncatula]
 gb|AES70169.1| RNA polymerase II transcription factor SIII (elongin) subunit 
A [Medicago truncatula]
Length=232

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = -3

Query  944  RSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGR  765
            R  +  RK PSLVDLCVQ AID++RY+G+VG  D HLLER LPHCT+DQL  IEK+++G 
Sbjct  4    RGQISARKTPSLVDLCVQTAIDNLRYLGNVGPVDHHLLERILPHCTLDQLTHIEKASEGM  63

Query  764  DLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDR  585
            DLSPVTDK+WK+F+E++FG    + +I RM +K+V+F+W QLYEAK KEV + + ++ DR
Sbjct  64   DLSPVTDKLWKKFFEKQFGISCTNEIIRRMTEKRVSFRWLQLYEAKGKEVAQAENEAIDR  123

Query  584  IRDLYKKHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSP  411
            +R+ YK  DA+KQSRQ+K CTK+PPSS +R     G   N+ N KS +MKK+K++FL+S 
Sbjct  124  LRERYKNADAKKQSRQVKTCTKLPPSSKRRFWGDNGPGYNVSNVKSNIMKKSKIEFLKSR  183

Query  410  EVKNLAAIK  384
            EVKN+AA+K
Sbjct  184  EVKNIAAMK  192



>ref|XP_010689946.1| PREDICTED: uncharacterized protein LOC104903581 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=230

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 147/195 (75%), Gaps = 2/195 (1%)
 Frame = -3

Query  944  RSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGR  765
            R+ V N KAPSLVDLCVQ AID++RYIG+VG TD HLLER LPHCTV+QL  IE  T  R
Sbjct  11   RNRVANGKAPSLVDLCVQTAIDNIRYIGNVGPTDSHLLERILPHCTVEQLMHIENVTAER  70

Query  764  DLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDR  585
            DLSPVTDK+WK+FYE +FG KS  +V+ERM Q KV + W QLY+AKLK+ +E Q++S +R
Sbjct  71   DLSPVTDKLWKKFYEAKFGVKSVEVVVERMGQFKVKYNWRQLYQAKLKDQDEAQKQSLER  130

Query  584  IRDLYKKHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSP  411
            +   +K  +A KQSRQI++C KVPPSS +RS   +G SS   N KS++MKKAK++   S 
Sbjct  131  LAQSFKNENARKQSRQIQICGKVPPSSKRRSFGAFGESSTFSNVKSSIMKKAKVEHFNSA  190

Query  410  EVKNLAAIKNKAVQR  366
            EVKN AA++  AVQ+
Sbjct  191  EVKNRAAVRKIAVQQ  205



>ref|XP_010689945.1| PREDICTED: uncharacterized protein LOC104903581 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=250

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 153/208 (74%), Gaps = 5/208 (2%)
 Frame = -3

Query  974  SGENRSEH---RMRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTV  804
            SG+ RS +     R+ V N KAPSLVDLCVQ AID++RYIG+VG TD HLLER LPHCTV
Sbjct  18   SGDMRSGYIHFSNRNRVANGKAPSLVDLCVQTAIDNIRYIGNVGPTDSHLLERILPHCTV  77

Query  803  DQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKL  624
            +QL  IE  T  RDLSPVTDK+WK+FYE +FG KS  +V+ERM Q KV + W QLY+AKL
Sbjct  78   EQLMHIENVTAERDLSPVTDKLWKKFYEAKFGVKSVEVVVERMGQFKVKYNWRQLYQAKL  137

Query  623  KEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKST  450
            K+ +E Q++S +R+   +K  +A KQSRQI++C KVPPSS +RS   +G SS   N KS+
Sbjct  138  KDQDEAQKQSLERLAQSFKNENARKQSRQIQICGKVPPSSKRRSFGAFGESSTFSNVKSS  197

Query  449  VMKKAKMDFLRSPEVKNLAAIKNKAVQR  366
            +MKKAK++   S EVKN AA++  AVQ+
Sbjct  198  IMKKAKVEHFNSAEVKNRAAVRKIAVQQ  225



>ref|XP_002525894.1| Protein pof4, putative [Ricinus communis]
 gb|EEF36498.1| Protein pof4, putative [Ricinus communis]
Length=195

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 142/180 (79%), Gaps = 2/180 (1%)
 Frame = -3

Query  950  RMRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQ  771
            R  +++  RKAPSLVDLCV VAI HVRY+GDVG TD HLL++ LPHCT+DQL  +EKSTQ
Sbjct  6    RNGTSLIERKAPSLVDLCVSVAISHVRYLGDVGETDLHLLDQILPHCTMDQLMHVEKSTQ  65

Query  770  GRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSF  591
            GRDLSP+TDK+WK FYE++FG++ A++ IERM++ KV+F+W +LY+AKL E+ + + ++ 
Sbjct  66   GRDLSPITDKLWKTFYEKQFGEREANVAIERMRRYKVSFRWKKLYQAKLNEIAKKEDEAV  125

Query  590  DRIRDLYKKHDAEKQSRQIKLCTKVPPssskrsfygg--sSNIYNTKSTVMKKAKMDFLR  417
             R+R  YKK D +KQSRQI+LCTKVPPSS + SF       N+ N KS +MKK+K+DFL+
Sbjct  126  ARLRQSYKKEDDKKQSRQIRLCTKVPPSSKRSSFGSSGPGYNLSNVKSNIMKKSKIDFLK  185



>ref|XP_010524075.1| PREDICTED: elongin-A-like [Tarenaya hassleriana]
Length=247

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLV+LC+  AID+VR+IG VG  DF LL++ L HCTV+QL  +E  T   DLSP+T
Sbjct  8    RKPPSLVELCIMTAIDNVRFIGYVGGLDFQLLDQILQHCTVEQLMHVEDCTADTDLSPIT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            +K+WK+FYE++FG +  ++VIERMK+ +VTFKW  LYEAKLK+VE+ ++++ DR++ LY+
Sbjct  68   NKLWKRFYEKQFGYQKMNVVIERMKRNRVTFKWRHLYEAKLKDVEQDEERAADRLKQLYE  127

Query  566  KHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAI  387
            K  A+KQ+R+ KLC KVPP + +  + G   N+   KS +MKKAK+D L+S E+KNLAA+
Sbjct  128  KEVAKKQNRKTKLCAKVPPGNKRGFWGGPGHNLSGVKSNIMKKAKLDLLKSQEMKNLAAM  187

Query  386  KNKAVQRT  363
            K KAVQ++
Sbjct  188  KRKAVQKS  195



>ref|XP_009133550.1| PREDICTED: uncharacterized protein LOC103858028 [Brassica rapa]
Length=340

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            ++K PSLVDLCV++AID+VRYIG VG  DF LLE+ L HCT++QL  IE ST   DLSPV
Sbjct  7    SKKPPSLVDLCVRLAIDNVRYIGYVGGVDFQLLEKILQHCTLEQLMHIEDSTPDTDLSPV  66

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            T+++WK+FYE+++G K+ S V+E+M++ KV+FKW +LYEAKLK VEE ++++ DR++  Y
Sbjct  67   TNELWKRFYEKQYGAKNLSFVMEKMERSKVSFKWRELYEAKLKVVEEDEKEAVDRLKQRY  126

Query  569  KKHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K  DA KQSRQ KLC K PP         G S N+ N KS +MKKAK+D L+S EVKNL 
Sbjct  127  KNEDARKQSRQTKLCAKTPPMKKPFWGNSGTSYNLSNVKSNIMKKAKLDVLKSQEVKNLT  186

Query  392  AIKNKAVQR  366
            AIK  ++Q+
Sbjct  187  AIKRNSIQK  195



>emb|CDY42819.1| BnaC03g23870D [Brassica napus]
Length=417

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            ++K PSLVDLCV++AID+VRYIG VG  DF LLE+ L HCT++QL  IE STQ  DLSPV
Sbjct  83   SKKPPSLVDLCVRLAIDNVRYIGYVGGVDFQLLEKILQHCTLEQLMHIEDSTQDTDLSPV  142

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            T+++WK+FYE+++G K+ S V+E+M++ KV+FKW +LYEAKLK VEE ++++ DR++  Y
Sbjct  143  TNELWKRFYEKQYGAKNLSFVMEKMERSKVSFKWRELYEAKLKVVEEDEKEAVDRLKQRY  202

Query  569  KKHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K  DA KQSRQ KLC K PP         G S N+ N KS +MKKAK+D L+S EVKNL 
Sbjct  203  KNEDARKQSRQTKLCAKAPPVKKPFWGNSGTSYNLSNVKSNIMKKAKLDVLKSQEVKNLT  262

Query  392  AIKNKAVQR  366
            AIK   +Q+
Sbjct  263  AIKRNTIQK  271



>emb|CDX83518.1| BnaA03g19880D [Brassica napus]
Length=374

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            ++K PSLVDLCV++AID+VRYIG VG  DF LLE+ L HCT++QL  IE STQ  DLSPV
Sbjct  41   SKKPPSLVDLCVRLAIDNVRYIGYVGGVDFQLLEKILQHCTLEQLMHIEDSTQDTDLSPV  100

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            T+++WK+FYE+++G K+ S V+E+M++ KV+FKW +LYEAKLK VEE ++++ DR++  Y
Sbjct  101  TNELWKRFYEKQYGAKNLSFVMEKMERSKVSFKWRELYEAKLKVVEEDEKEAVDRLKQRY  160

Query  569  KKHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K  DA KQSRQ KLC K PP         G S N+ N KS +MKKAK+D L+S EVKNL 
Sbjct  161  KNEDARKQSRQTKLCAKTPPMKKPFWGNSGTSYNLSNVKSNIMKKAKLDVLKSQEVKNLT  220

Query  392  AIKNKAVQRT  363
            AIK   ++++
Sbjct  221  AIKRNTIRKS  230



>gb|KCW89687.1| hypothetical protein EUGRSUZ_A01953 [Eucalyptus grandis]
Length=227

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 143/194 (74%), Gaps = 15/194 (8%)
 Frame = -3

Query  947  MRSAVGNRK--------------APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHC  810
            MRS VG+R+               PSLVDLCV+  ID++RY+GDVG TD  LL R LPHC
Sbjct  1    MRSEVGSRRIGCEFGRNMLMKSEPPSLVDLCVRTVIDNLRYLGDVGGTDPQLLARILPHC  60

Query  809  TVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEA  630
            TVDQL  IEKST+GRDL+P+TD +WK FYE+EFG ++  LV ERM+ K V+F+W+QLYEA
Sbjct  61   TVDQLMHIEKSTKGRDLTPITDDLWKNFYEKEFGIRNTKLVNERMEDKGVSFRWSQLYEA  120

Query  629  KLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKST  450
            KLK++E+ Q+KS DR++  YK+ DA KQSRQ++LCTKVPP SS +  +GGS N+   KS 
Sbjct  121  KLKDIEQAQKKSLDRMKQRYKETDARKQSRQVRLCTKVPP-SSNKRSFGGSYNVSYLKSN  179

Query  449  VMKKAKMDFLRSPE  408
            +MKKAK++ L+  E
Sbjct  180  IMKKAKIEALKRGE  193



>gb|EPS68581.1| hypothetical protein M569_06188, partial [Genlisea aurea]
Length=194

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 150/197 (76%), Gaps = 7/197 (4%)
 Frame = -3

Query  947  MRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQG  768
            MRS+V     PSLVDLCVQ+AID++R++GDVG T+FHLL+R L HCT DQL  IE  T+ 
Sbjct  1    MRSSV-----PSLVDLCVQLAIDNIRFLGDVGVTEFHLLDRILSHCTPDQLMHIENCTED  55

Query  767  RDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFD  588
            RDLSPVTDK+WK+F++ +FG  S + V+E+MKQK V F W +LY+AKL+E EE  +KS  
Sbjct  56   RDLSPVTDKLWKKFFKLQFGADSMNFVVEKMKQKNVNFSWRRLYKAKLQEREEATEKSLA  115

Query  587  RIRDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSN-IYNTKSTVMKKAKMDFLRSP  411
            RI+  Y++ +A+KQSRQ+++C KVPPSS +  + G S++ +Y+TKS++MKKA+ +F+   
Sbjct  116  RIKKRYEEENAKKQSRQVQVCMKVPPSSKRSFYGGFSADSMYDTKSSLMKKARKEFVNCR  175

Query  410  EVKNLAAIKNKAVQRTN  360
            EVKNLA++K   V R N
Sbjct  176  EVKNLASMKT-MVHRNN  191



>ref|XP_010525255.1| PREDICTED: elongin-A-like isoform X2 [Tarenaya hassleriana]
Length=243

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            + PSLV+LC+  AID+VR+IG VG  DF LL++ LPHCTV+QL  +E  T+  DLSP+T+
Sbjct  7    QPPSLVELCITTAIDNVRFIGYVGGIDFQLLDQILPHCTVEQLMHVEDCTEDTDLSPITN  66

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+FYE++FG +   +VIERMKQ +VTFKW  LYEAKLK+VE+ ++++ DR++ LY  
Sbjct  67   KLWKRFYEKQFGYEKMKIVIERMKQNRVTFKWRHLYEAKLKDVEQDEKRAADRLKQLYDN  126

Query  563  HDAEKQSRQIKLCTKVPPssskrs-fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAI  387
              A+KQ+R+ KLC KVPPS  +     G   N+ N KS +MKKAK D L+S E+KNLAA+
Sbjct  127  EVAKKQNRKTKLCAKVPPSGKRSFWANGPGYNLSNVKSNIMKKAKSDLLKSQEMKNLAAM  186

Query  386  KNKAVQRT  363
            K  AVQ++
Sbjct  187  KRNAVQKS  194



>ref|XP_010525240.1| PREDICTED: elongin-A-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010525247.1| PREDICTED: elongin-A-like isoform X1 [Tarenaya hassleriana]
Length=247

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            + PSLV+LC+  AID+VR+IG VG  DF LL++ LPHCTV+QL  +E  T+  DLSP+T+
Sbjct  11   QPPSLVELCITTAIDNVRFIGYVGGIDFQLLDQILPHCTVEQLMHVEDCTEDTDLSPITN  70

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+FYE++FG +   +VIERMKQ +VTFKW  LYEAKLK+VE+ ++++ DR++ LY  
Sbjct  71   KLWKRFYEKQFGYEKMKIVIERMKQNRVTFKWRHLYEAKLKDVEQDEKRAADRLKQLYDN  130

Query  563  HDAEKQSRQIKLCTKVPPssskrs-fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAI  387
              A+KQ+R+ KLC KVPPS  +     G   N+ N KS +MKKAK D L+S E+KNLAA+
Sbjct  131  EVAKKQNRKTKLCAKVPPSGKRSFWANGPGYNLSNVKSNIMKKAKSDLLKSQEMKNLAAM  190

Query  386  KNKAVQRT  363
            K  AVQ++
Sbjct  191  KRNAVQKS  198



>gb|KCW89688.1| hypothetical protein EUGRSUZ_A01953 [Eucalyptus grandis]
Length=245

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 142/191 (74%), Gaps = 15/191 (8%)
 Frame = -3

Query  947  MRSAVGNRK--------------APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHC  810
            MRS VG+R+               PSLVDLCV+  ID++RY+GDVG TD  LL R LPHC
Sbjct  1    MRSEVGSRRIGCEFGRNMLMKSEPPSLVDLCVRTVIDNLRYLGDVGGTDPQLLARILPHC  60

Query  809  TVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEA  630
            TVDQL  IEKST+GRDL+P+TD +WK FYE+EFG ++  LV ERM+ K V+F+W+QLYEA
Sbjct  61   TVDQLMHIEKSTKGRDLTPITDDLWKNFYEKEFGIRNTKLVNERMEDKGVSFRWSQLYEA  120

Query  629  KLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKST  450
            KLK++E+ Q+KS DR++  YK+ DA KQSRQ++LCTKVPP SS +  +GGS N+   KS 
Sbjct  121  KLKDIEQAQKKSLDRMKQRYKETDARKQSRQVRLCTKVPP-SSNKRSFGGSYNVSYLKSN  179

Query  449  VMKKAKMDFLR  417
            +MKKAK++ L+
Sbjct  180  IMKKAKIEALK  190



>ref|XP_006827203.1| PREDICTED: uncharacterized protein LOC18421929 [Amborella trichopoda]
 gb|ERM94440.1| hypothetical protein AMTR_s00010p00258630 [Amborella trichopoda]
Length=225

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            K PSL+DLC+Q AID+++Y+GDVG TD ++L+  L HCT DQL  IEK ++GRDLSPVTD
Sbjct  3    KVPSLLDLCIQNAIDNIKYLGDVGETDLNILKLILTHCTADQLMHIEKCSEGRDLSPVTD  62

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
             +WK FYE+ FG +SA++VI+RMKQK   FKW  LY+AKLKE +E Q+KS DR++ LY +
Sbjct  63   SLWKTFYEQHFGTESANIVIKRMKQKGRYFKWKLLYQAKLKERDEAQKKSVDRMKQLYAE  122

Query  563  HDAEKQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
                KQSRQI+LC+KVPP+S KRS     G  +++ N K  +MKKA+M++L S EVK   
Sbjct  123  ESNRKQSRQIQLCSKVPPASKKRSFCGGSGSCNSLSNVKGNLMKKARMEYLNSHEVKMHT  182

Query  392  AIKNKAVQRTN  360
             ++ +A QR++
Sbjct  183  VMRRQATQRSS  193



>ref|XP_007146388.1| hypothetical protein PHAVU_006G036000g [Phaseolus vulgaris]
 gb|ESW18382.1| hypothetical protein PHAVU_006G036000g [Phaseolus vulgaris]
Length=181

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            K P+LVDLC+Q  ID+VRY+G+VG  D +LLER LPHCTVDQL  +EKST+GRDLSPVTD
Sbjct  11   KIPTLVDLCIQKVIDNVRYLGNVGYFDEYLLERILPHCTVDQLMNVEKSTKGRDLSPVTD  70

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+F+E+++G  S + VI+RMK+KKV+FKW QLYEAK KE+ + + ++ DRI+ LYKK
Sbjct  71   KLWKKFFEKQYGTNSTNEVIKRMKEKKVSFKWAQLYEAKGKEMAQAENEALDRIKQLYKK  130

Query  563  HDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKM  429
             DA KQSRQ++LCTKV PSS +R     G   N+ N KS +MKKAK+
Sbjct  131  EDARKQSRQVRLCTKVSPSSKRRFWGDNGPGYNVSNFKSNIMKKAKI  177



>ref|XP_009416869.1| PREDICTED: transcription elongation factor B polypeptide 3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416870.1| PREDICTED: transcription elongation factor B polypeptide 3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416872.1| PREDICTED: transcription elongation factor B polypeptide 3 [Musa 
acuminata subsp. malaccensis]
Length=228

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK P+LV+LC+Q AI ++RYIGDVG  D +LL+  LPHC +DQL  IE STQGRDLSPVT
Sbjct  5    RKVPTLVELCLQTAISNLRYIGDVGEVDLYLLKDILPHCNIDQLTHIEDSTQGRDLSPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D +WK+FYE++FG +SA+ VI+RMKQKK+ FKW QL+EAK KE EE Q K  ++++  Y 
Sbjct  65   DALWKRFYEQQFGVESANTVIKRMKQKKIVFKWRQLFEAKTKEREEAQNKMGEKLKQRYA  124

Query  566  KHDAEKQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            +  A+KQSRQI++C+K+PPS+ KRS     G S + N K  +MKKAK+++L S E K  A
Sbjct  125  ETQAKKQSRQIQICSKIPPSAGKRSYWGGSGPSGMSNVKGNLMKKAKLEYLNSHEAKVHA  184

Query  392  AIKNKAVQRTN  360
             ++  A Q+ +
Sbjct  185  LMRRNASQQNS  195



>ref|XP_010506116.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
isoform X1 [Camelina sativa]
Length=301

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 1/190 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+ AID+V+YIG VG  DFHLLE+ + HCT++QL  IE STQ  DLSPVT
Sbjct  18   RKPPSLVDLCVRKAIDNVKYIGYVGGVDFHLLEQIMQHCTLEQLKHIEDSTQDTDLSPVT  77

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D  WK FYE+ FG+++ +  +E MK+ KV FKW  LYEAK+  V+E +++  DR++  YK
Sbjct  78   DNFWKGFYEKHFGEEALNDTMEGMKRNKVNFKWRDLYEAKVISVQEKEKEVVDRLKQRYK  137

Query  566  KHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
              D  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL A
Sbjct  138  NEDERKQSRQTKVCSKAPPSKRPFWGNTASGYNLGHVKSNIMKKAKIDLLKSQEVKNLTA  197

Query  389  IKNKAVQRTN  360
            IK   + +++
Sbjct  198  IKRNTIHKSS  207



>ref|XP_010506117.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
isoform X2 [Camelina sativa]
Length=291

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (69%), Gaps = 1/190 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+ AID+V+YIG VG  DFHLLE+ + HCT++QL  IE STQ  DLSPVT
Sbjct  8    RKPPSLVDLCVRKAIDNVKYIGYVGGVDFHLLEQIMQHCTLEQLKHIEDSTQDTDLSPVT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D  WK FYE+ FG+++ +  +E MK+ KV FKW  LYEAK+  V+E +++  DR++  YK
Sbjct  68   DNFWKGFYEKHFGEEALNDTMEGMKRNKVNFKWRDLYEAKVISVQEKEKEVVDRLKQRYK  127

Query  566  KHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
              D  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL A
Sbjct  128  NEDERKQSRQTKVCSKAPPSKRPFWGNTASGYNLGHVKSNIMKKAKIDLLKSQEVKNLTA  187

Query  389  IKNKAVQRTN  360
            IK   + +++
Sbjct  188  IKRNTIHKSS  197



>ref|XP_006294725.1| hypothetical protein CARUB_v10023771mg [Capsella rubella]
 gb|EOA27623.1| hypothetical protein CARUB_v10023771mg [Capsella rubella]
Length=289

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 130/189 (69%), Gaps = 1/189 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            +K PSLVDLCV+ AID+V+YIG VG  DF LLE+ + HCT++QL  IE STQ  DLSPVT
Sbjct  8    KKPPSLVDLCVRKAIDNVKYIGYVGGVDFQLLEQIMQHCTLEQLKHIEDSTQDTDLSPVT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK WK FYE+ FG+++ +  +E MK  KV FKW  LYEAK+  +EE ++K  DR++  YK
Sbjct  68   DKFWKGFYEKHFGEEALNDTMEGMKLNKVNFKWRDLYEAKVIHIEEKEKKVVDRLKQRYK  127

Query  566  KHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
              D  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL A
Sbjct  128  NEDERKQSRQTKVCSKAPPSKRPFWGNNATGYNLGHVKSNIMKKAKIDLLKSQEVKNLTA  187

Query  389  IKNKAVQRT  363
            IK   +Q++
Sbjct  188  IKRNTIQKS  196



>ref|XP_010939513.1| PREDICTED: uncharacterized protein LOC105058328 [Elaeis guineensis]
Length=230

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            R+APSL++LC Q+AID+VRYIG+V A D HLLE  LPHCT+DQL  IE +T GRDLSPVT
Sbjct  5    REAPSLLELCKQLAIDNVRYIGNVEAVDLHLLEDILPHCTIDQLTRIEDATIGRDLSPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            + +WK+FYE++FG  + + VI RMKQKKV FKW +LYEAK+K +EE Q +   +I+  Y+
Sbjct  65   NNLWKRFYEKQFGVDNTNNVIRRMKQKKVVFKWRRLYEAKMKVIEEEQNQIAKKIKQRYE  124

Query  566  KHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNT---KSTVMKKAKMDFLRSPEVKNL  396
            + +A++QSRQ++LC KVPPSSSKRSF GGS +  +    K  +MKKAKM++L S E K  
Sbjct  125  ESEAKRQSRQVRLCNKVPPSSSKRSFCGGSGSSNSFSNLKGNLMKKAKMEYLNSHEAKIH  184

Query  395  AAIKNKAVQR  366
            A ++  A+ R
Sbjct  185  ATMRKNALGR  194



>ref|XP_010508529.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Camelina sativa]
Length=286

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+ AID+V+YIG VG  DFHLLE+ + HCT++QL  IE STQ  DLSPVT
Sbjct  8    RKPPSLVDLCVRKAIDNVKYIGYVGGVDFHLLEQIMQHCTLEQLKHIEDSTQDTDLSPVT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D  WK FYE+ FG+++ +  IE MK  KV FKW  LYEAK+  V+E +++  DR++  YK
Sbjct  68   DNFWKGFYEKHFGEEALNDTIEGMKWNKVNFKWRDLYEAKVISVQEKEKEVVDRLKQRYK  127

Query  566  KHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
              D  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL A
Sbjct  128  NEDERKQSRQTKVCSKAPPSKRPFWGNTASGYNLGHVKSNIMKKAKIDVLKSQEVKNLTA  187

Query  389  IKNKAVQRTN  360
            IK   + +++
Sbjct  188  IKRNTIHKSS  197



>ref|XP_010517819.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Camelina sativa]
Length=291

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV+ AID+V+YIG VG  D HLLE+ + HCT++QL  IE STQ  DLSPVT
Sbjct  8    RKPPSLVDLCVRKAIDNVKYIGYVGGVDLHLLEQIMQHCTLEQLKHIEDSTQDTDLSPVT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D  WK FYE+ FG+++ +  +E MK+ KV FKW  LYEAK+  V+E +++  DR++  YK
Sbjct  68   DNFWKGFYEKHFGEEALNDTMEGMKRNKVNFKWRDLYEAKVISVQEKEKEVVDRLKQRYK  127

Query  566  KHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
              D  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL A
Sbjct  128  NEDERKQSRQTKVCSKAPPSKRPFWGNTASGYNLGHVKSNIMKKAKIDLLKSQEVKNLTA  187

Query  389  IKNKAVQRTN  360
            IK   + +++
Sbjct  188  IKRNTIHKSS  197



>gb|ABR16496.1| unknown [Picea sitchensis]
Length=382

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 138/189 (73%), Gaps = 6/189 (3%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSLVDLC++ AID+++YIGDVG TDF LL+  L HCT DQL  IE ST+GRDLSPVTD +
Sbjct  5    PSLVDLCIRSAIDNIQYIGDVGETDFGLLKVILAHCTSDQLLFIENSTEGRDLSPVTDDL  64

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQK----SFDRIRDLY  570
            W+ FY R FG++SA LV +RMK KKV+FKW+ L++AK KE EE QQK    S +R++ LY
Sbjct  65   WQNFYARRFGEESADLVRKRMKLKKVSFKWSLLFQAKAKEQEEQQQKSVERSLNRLKQLY  124

Query  569  KKHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNL  396
             + D+EKQSRQI++C+ +PP   KR  ++ G SS+  N K  +MKKAKM+F+ S + +  
Sbjct  125  AQADSEKQSRQIQICSTIPPVGKKRKFTYGGSSSDFSNVKGRLMKKAKMEFVASCDARRN  184

Query  395  AAIKNKAVQ  369
            A +   ++Q
Sbjct  185  ATVNKNSLQ  193



>gb|AES99821.2| RNA polymerase II transcription factor SIII (elongin) subunit 
A [Medicago truncatula]
Length=237

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SLVDLCV+ AID+V+Y+GDV   D H+LER LPHCT+DQL  IEK+++G DLSP+TDK+W
Sbjct  30   SLVDLCVEKAIDNVKYLGDVSHVDHHMLERILPHCTLDQLMHIEKASEGMDLSPITDKLW  89

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            K+F+E++FG    + V+++MK+K+V+F W QLYEAK+K++ + + ++ DR+   YK+ DA
Sbjct  90   KKFFEKQFGINCTNEVVKKMKEKRVSFTWLQLYEAKVKKMAQAENEAVDRLAQRYKEEDA  149

Query  554  EKQSRQIKLCTKVPPssskrsfyggsSNIYNTKST-VMKKAKMDFLRSPEVKNLAAIKNK  378
             KQSR+IK CT VPP+  + S   G  +  N KS+ +MKK+K DFL S EVKN+ A+KN 
Sbjct  150  RKQSRKIKTCTIVPPNKRRFSGDNGPGS--NVKSSNIMKKSKKDFLNSFEVKNITAMKNN  207

Query  377  AVQR  366
              Q+
Sbjct  208  CNQK  211



>ref|XP_003616863.1| hypothetical protein MTR_5g085090 [Medicago truncatula]
Length=255

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SLVDLCV+ AID+V+Y+GDV   D H+LER LPHCT+DQL  IEK+++G DLSP+TDK+W
Sbjct  48   SLVDLCVEKAIDNVKYLGDVSHVDHHMLERILPHCTLDQLMHIEKASEGMDLSPITDKLW  107

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            K+F+E++FG    + V+++MK+K+V+F W QLYEAK+K++ + + ++ DR+   YK+ DA
Sbjct  108  KKFFEKQFGINCTNEVVKKMKEKRVSFTWLQLYEAKVKKMAQAENEAVDRLAQRYKEEDA  167

Query  554  EKQSRQIKLCTKVPPssskrsfyggsSNIYNTKST-VMKKAKMDFLRSPEVKNLAAIKNK  378
             KQSR+IK CT VPP+  + S   G  +  N KS+ +MKK+K DFL S EVKN+ A+KN 
Sbjct  168  RKQSRKIKTCTIVPPNKRRFSGDNGPGS--NVKSSNIMKKSKKDFLNSFEVKNITAMKNN  225

Query  377  AVQR  366
              Q+
Sbjct  226  CNQK  229



>ref|XP_003626793.1| hypothetical protein MTR_8g009140 [Medicago truncatula]
 gb|AET01269.1| RNA polymerase II transcription factor SIII (elongin) subunit 
A [Medicago truncatula]
Length=223

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 1/185 (1%)
 Frame = -3

Query  911  LVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWK  732
            LVDLCV+  ID+V+Y+GDV   D  +LER LPHCT+DQL  IEKSTQG DLSP+TD++W+
Sbjct  34   LVDLCVEKGIDNVKYLGDVSHVDHDMLERILPHCTLDQLMHIEKSTQGMDLSPITDQLWR  93

Query  731  QFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAE  552
            +F+E++FG    + V+++MK+K+V+F W QLYEAK+K V +T+ ++ DR+   YK+ DA 
Sbjct  94   KFFEKQFGINCTNEVVKKMKEKRVSFTWLQLYEAKVKRVAQTENEAVDRLAQRYKEEDAR  153

Query  551  KQSRQIKLCTKVPPsssk-rsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNKA  375
            KQSR+IK CTK+PPS  +     G   N+    S +MKK+K DFL S EVKN  A+K + 
Sbjct  154  KQSRKIKTCTKLPPSERRFCGDNGSGYNLSVKSSNIMKKSKKDFLNSLEVKNNTAMKRRG  213

Query  374  VQRTN  360
            +  T+
Sbjct  214  IGSTS  218



>ref|XP_006411547.1| hypothetical protein EUTSA_v10017014mg [Eutrema salsugineum]
 gb|ESQ53000.1| hypothetical protein EUTSA_v10017014mg [Eutrema salsugineum]
Length=295

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 134/192 (70%), Gaps = 3/192 (2%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            ++K PSLVDLC++  ID+VRYIG VG  DFHLLE+ L HCT++QL  IE  T   DLSPV
Sbjct  7    SKKPPSLVDLCLRTLIDNVRYIGYVGGVDFHLLEQILQHCTLEQLMHIEDCTHDTDLSPV  66

Query  749  TDKIWKQFYEREFGKKSAS--LVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            T+K WK++ E+ +G       LV++ +K++K+ F W QLYEAKLK V+E ++++ D+++ 
Sbjct  67   TNKFWKRYCEKLYGANVEDLILVVKELKREKINFTWRQLYEAKLKAVKEGEKEAVDKLKQ  126

Query  575  LYKKHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKN  399
             YK  DA KQSRQ KLC+K PP+     +  G   N+ N KS +MKKAK+D L+S EVKN
Sbjct  127  RYKAEDARKQSRQTKLCSKAPPTKKAFWANSGSGYNLSNVKSNIMKKAKLDLLKSQEVKN  186

Query  398  LAAIKNKAVQRT  363
            L AIK   +Q++
Sbjct  187  LTAIKRNTIQKS  198



>ref|XP_008807727.1| PREDICTED: uncharacterized protein LOC103720002 [Phoenix dactylifera]
 ref|XP_008807728.1| PREDICTED: uncharacterized protein LOC103720002 [Phoenix dactylifera]
 ref|XP_008807729.1| PREDICTED: uncharacterized protein LOC103720002 [Phoenix dactylifera]
Length=228

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            R+AP+L++LC Q+AI +VRYIG+V A D HLL+  LPHCT+DQL  IE +T+GRDLSPVT
Sbjct  5    REAPTLLELCKQLAIYNVRYIGNVEALDLHLLKDILPHCTIDQLTRIEDATKGRDLSPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D +WK+FYE +FG  + + VI +MKQK++ FKW +LYEAK+K +EE Q +   +I+  Y+
Sbjct  65   DDLWKRFYENQFGVDNTNNVIRKMKQKRIVFKWRRLYEAKMKVIEEEQNQIAKKIKQRYE  124

Query  566  KHDAEKQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNL  396
            + +A++QSRQI+LC KVPPSS KRS     G S++  N +  +MKKAKM++L S E +  
Sbjct  125  ESEAKRQSRQIRLCNKVPPSSGKRSFYGGSGSSNSCSNLRGNLMKKAKMEYLNSHEARIH  184

Query  395  AAIKNKAVQR  366
            AA++  A++R
Sbjct  185  AAMRKNALER  194



>ref|XP_007048789.1| Nucleus, subunit A, putative isoform 3 [Theobroma cacao]
 gb|EOX92946.1| Nucleus, subunit A, putative isoform 3 [Theobroma cacao]
Length=181

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 118/148 (80%), Gaps = 2/148 (1%)
 Frame = -3

Query  806  VDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAK  627
            +DQL  +EKST+GRDLSPVTDK+WK FYE +FG+ S +LVIERMK KKV+F+W QLYEAK
Sbjct  1    MDQLIHVEKSTKGRDLSPVTDKLWKNFYELQFGRASTNLVIERMKLKKVSFRWRQLYEAK  60

Query  626  LKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPPssskr--sfyggsSNIYNTKS  453
            LK+V+E + K+ DR++ LYKK DA KQSRQ++LCTKVPPSS +   +  G   N+   KS
Sbjct  61   LKDVQEAENKAIDRLKQLYKKEDARKQSRQVQLCTKVPPSSKRSFFAGSGPGYNLSYVKS  120

Query  452  TVMKKAKMDFLRSPEVKNLAAIKNKAVQ  369
             +MKKAK+D ++S EVKNLAA+K KAVQ
Sbjct  121  NIMKKAKIDLMKSQEVKNLAAMKKKAVQ  148



>gb|KEH17891.1| RNA polymerase II transcription factor SIII (elongin) subunit 
A [Medicago truncatula]
Length=147

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  911  LVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWK  732
            LVDLCV+ AID+V+Y+GDV   D H+LER LPHCT++QL  IEKSTQG DLSP+TDK+WK
Sbjct  9    LVDLCVEKAIDNVKYLGDVSHVDHHMLERILPHCTLEQLMHIEKSTQGMDLSPITDKLWK  68

Query  731  QFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAE  552
            +F+E++FG    + V+++MK+K+V+F W QLYEAK+K+V +T+ ++ DR+   YK+ DA 
Sbjct  69   KFFEKQFGINCTNEVVKKMKEKRVSFTWLQLYEAKVKKVAQTENEAVDRLAQRYKEEDAR  128

Query  551  KQSRQIKLCTKVPP  510
            KQSRQIK CTK+PP
Sbjct  129  KQSRQIKTCTKLPP  142



>gb|KGN47016.1| hypothetical protein Csa_6G169320 [Cucumis sativus]
Length=230

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSLVDLCV  AID++R++GDVG TD HLL+R LPHCTVDQL  +EKS++GRDL+PVT
Sbjct  5    RKIPSLVDLCVNKAIDNLRFLGDVGETDIHLLDRILPHCTVDQLMHVEKSSEGRDLTPVT  64

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+FYER+FGK+S + VIERM+QK+V F+W QLYEAK++++E+ + K+ DRI+  Y 
Sbjct  65   DKLWKKFYERQFGKESTTTVIERMRQKRVAFRWIQLYEAKMEDIEKNESKAADRIKQSYL  124

Query  566  KHDAE  552
            K +A+
Sbjct  125  KENAQ  129



>gb|KHN18125.1| hypothetical protein glysoja_020898 [Glycine soja]
Length=240

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 116/170 (68%), Gaps = 21/170 (12%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            R  P+LVDLCVQ  I +VRY+G+VG+ D H+LE+ LPHCT DQL  +EKST+GRDLSPVT
Sbjct  12   RPTPTLVDLCVQKVIHNVRYLGNVGSFDQHMLEQILPHCTADQLMHVEKSTKGRDLSPVT  71

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            DK+WK+F+E++FG  S   VI+RMK+K+V+F+W QL+E K KE+ + + ++ DRIR LYK
Sbjct  72   DKLWKKFFEKQFGTNSTDEVIKRMKEKRVSFRWMQLFETKGKEMAQAENEALDRIRQLYK  131

Query  566  KHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLR  417
            K DA    R                      N+ N KS +MKKAK++FL+
Sbjct  132  KEDANNGPR---------------------YNVSNVKSNIMKKAKIEFLK  160



>ref|XP_007146384.1| hypothetical protein PHAVU_006G035800g, partial [Phaseolus vulgaris]
 gb|ESW18378.1| hypothetical protein PHAVU_006G035800g, partial [Phaseolus vulgaris]
Length=133

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            K P+LVDLCVQ  ID+VRY+G+VG  D HLLER LPHCTVDQL  +EKST+GRDLSPVTD
Sbjct  11   KIPTLVDLCVQKVIDNVRYLGNVGYVDQHLLERILPHCTVDQLMNVEKSTKGRDLSPVTD  70

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK+F+E++FG  S + VI++MK+KKV+FKW QLYEAK KE+ + + ++ DRI+ LY+K
Sbjct  71   KLWKKFFEKQFGTNSTNEVIKKMKEKKVSFKWVQLYEAKGKEMAQAENEALDRIKQLYQK  130

Query  563  HDA  555
             DA
Sbjct  131  EDA  133



>ref|NP_001189736.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10168.1| uncharacterized protein AT2G42780 [Arabidopsis thaliana]
Length=253

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            +K PSLVDLCV+ AID+V+YIG VG  DF LLE+ L HCT++QL  IE +T   DLSP+T
Sbjct  8    KKPPSLVDLCVRKAIDNVKYIGYVGGVDFQLLEQILQHCTLEQLKHIEDATDDTDLSPIT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVT-FKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            DK WK FY++ +G++    +IE ++  KV  FKW  LYE K+  V++ +++   R+++ Y
Sbjct  68   DKFWKGFYKKHYGEEDMKDLIEDLEWNKVNDFKWRNLYELKVIAVQQKEKELGGRLKERY  127

Query  569  KKHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K  +  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL 
Sbjct  128  KDENERKQSRQTKVCSKAPPSKRPFWGNSASGYNLGHVKSNIMKKAKIDLLKSQEVKNLT  187

Query  392  AIKNKAVQRT  363
            AIK   +Q++
Sbjct  188  AIKRNTIQKS  197



>ref|NP_565984.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK43872.1|AF370495_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL16136.1|AF428304_1 At2g42780/F7D19.22 [Arabidopsis thaliana]
 gb|AAM10245.1| unknown protein [Arabidopsis thaliana]
 gb|AAD21730.2| expressed protein [Arabidopsis thaliana]
 gb|AAM61179.1| unknown [Arabidopsis thaliana]
 gb|AEC10167.1| uncharacterized protein AT2G42780 [Arabidopsis thaliana]
Length=293

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 127/190 (67%), Gaps = 2/190 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            +K PSLVDLCV+ AID+V+YIG VG  DF LLE+ L HCT++QL  IE +T   DLSP+T
Sbjct  8    KKPPSLVDLCVRKAIDNVKYIGYVGGVDFQLLEQILQHCTLEQLKHIEDATDDTDLSPIT  67

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVT-FKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            DK WK FY++ +G++    +IE ++  KV  FKW  LYE K+  V++ +++   R+++ Y
Sbjct  68   DKFWKGFYKKHYGEEDMKDLIEDLEWNKVNDFKWRNLYELKVIAVQQKEKELGGRLKERY  127

Query  569  KKHDAEKQSRQIKLCTKVPPssskr-sfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
            K  +  KQSRQ K+C+K PPS            N+ + KS +MKKAK+D L+S EVKNL 
Sbjct  128  KDENERKQSRQTKVCSKAPPSKRPFWGNSASGYNLGHVKSNIMKKAKIDLLKSQEVKNLT  187

Query  392  AIKNKAVQRT  363
            AIK   +Q++
Sbjct  188  AIKRNTIQKS  197



>gb|KEH17889.1| RNA polymerase II transcription factor SIII (elongin) subunit 
A [Medicago truncatula]
Length=208

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 121/185 (65%), Gaps = 17/185 (9%)
 Frame = -3

Query  911  LVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWK  732
            LVDLCV+ AID+V+Y+GDV   D H+LER LPHCT++QL  IEK+ +G DLSP+TD++WK
Sbjct  35   LVDLCVEKAIDNVKYLGDVSHVDHHMLERILPHCTLEQLMHIEKTNKGMDLSPITDQLWK  94

Query  731  QFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAE  552
            +F+E++FG                    N+LYEAK+K++   + ++ DR+   YK+ DA 
Sbjct  95   KFFEKQFGINCT----------------NELYEAKVKKMARAENEAVDRLTKRYKEEDAR  138

Query  551  KQSRQIKLCTKVPPsssk-rsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNKA  375
            KQSRQIK CTK+PPS  +     G   N+    S +MKK+K DFL S EVKN+ A+K + 
Sbjct  139  KQSRQIKTCTKLPPSERRFCGDNGSGYNLSVKSSNIMKKSKKDFLNSFEVKNITAMKRRG  198

Query  374  VQRTN  360
            +  T+
Sbjct  199  IGSTS  203



>ref|XP_001772530.1| predicted protein [Physcomitrella patens]
 gb|EDQ62572.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 124/187 (66%), Gaps = 7/187 (4%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL++ CV+ AID+++Y+ DVG TD  LL+R LPHC  DQL  IE ST+GRDLSP+TD++W
Sbjct  4    SLLEFCVRSAIDNLQYLSDVGETDIQLLKRILPHCNADQLNHIETSTKGRDLSPITDELW  63

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            ++ Y R FG+ +  +V ERM  +K  FKW QLY+AK++E +E Q+K  +R+R+LYK+ ++
Sbjct  64   RKCYGRRFGEDAVEMVKERMSSRKCKFKWRQLYQAKVREQDEIQRKGVNRLRELYKEQNS  123

Query  554  EKQSRQIKLCTKVPPssskrsfyggsSNIYN------TKSTVMKKAKMDFLRSPEVKNLA  393
            +K+ +QI+     PP S +    G   +          K  +M+K++MDF +S E    A
Sbjct  124  QKERKQIQPIDLKPPESKRVKRTGPGGSFRGPSSKAPAKGRLMQKSRMDFAKSNEAARQA  183

Query  392  AI-KNKA  375
            ++ KN++
Sbjct  184  SLAKNRS  190



>ref|XP_001774521.1| predicted protein [Physcomitrella patens]
 gb|EDQ60589.1| predicted protein [Physcomitrella patens]
Length=205

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 116/181 (64%), Gaps = 5/181 (3%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL++LCV+ AID+++YI DVG TD  LL+R LPHC  +QL  IE ST+GRDLSP+TD +W
Sbjct  4    SLLELCVRSAIDNLQYISDVGETDIQLLKRILPHCNAEQLNHIESSTKGRDLSPITDDLW  63

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            ++ Y R+FG  +  +V ERM  +K  FKW QLY+AK +E +E Q+K   R+R+LYK+ ++
Sbjct  64   RKCYGRKFGNDAVEMVKERMSDRKCKFKWRQLYQAKCREQDEIQRKGVSRLRELYKEQNS  123

Query  554  EKQSRQIKLCTKVPPssskrsfyggsSNIYN-----TKSTVMKKAKMDFLRSPEVKNLAA  390
            +K+ +QI      PP S +    G   +         K  +M+KA+M+F +S      A+
Sbjct  124  QKERKQIVPIDLKPPESKRIKRTGPGGSSGPSSKAPAKGRLMQKARMEFAKSNAASRQAS  183

Query  389  I  387
            +
Sbjct  184  M  184



>ref|XP_002968045.1| hypothetical protein SELMODRAFT_440234 [Selaginella moellendorffii]
 ref|XP_002992596.1| hypothetical protein SELMODRAFT_448831 [Selaginella moellendorffii]
 gb|EFJ06298.1| hypothetical protein SELMODRAFT_448831 [Selaginella moellendorffii]
 gb|EFJ31392.1| hypothetical protein SELMODRAFT_440234 [Selaginella moellendorffii]
Length=191

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 115/184 (63%), Gaps = 2/184 (1%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            +APSL +LC+  AID++   GDVG TD  LL   LPHCT DQL  IE  ++ RDL+PVT+
Sbjct  4    RAPSLQELCIHTAIDNLHRFGDVGDTDLDLLRIILPHCTTDQLRHIENCSKDRDLAPVTN  63

Query  743  KIWKQFYEREFGKKSASLVIERMKQ-KKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            ++WK+ Y R+FG  S  LV  ++K   K  FKW  LYEAKLK  EE QQK  + ++ L+ 
Sbjct  64   ELWKKCYGRDFGPHSLELVESKLKHASKSQFKWRDLYEAKLKHREEKQQKGVELLQRLHM  123

Query  566  KHDAEKQSRQIKLCTKVPPs-sskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
            + +++KQSRQ+K C K PP         G S    N K  +M+KA+++   S E K +A+
Sbjct  124  EEESKKQSRQLKRCYKSPPEPKRSFGSGGSSGAFSNVKGRLMRKARVEHAASREAKMMAS  183

Query  389  IKNK  378
            I+ K
Sbjct  184  IRKK  187



>ref|XP_004308816.1| PREDICTED: elongin-A-like [Fragaria vesca subsp. vesca]
Length=190

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 126/188 (67%), Gaps = 13/188 (7%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            KAPSLV+LC++ AID+ +Y+GDVG  DF  LE+ L HC+ +QL  IEK T+GRDLSPVTD
Sbjct  5    KAPSLVELCIETAIDNRKYLGDVGDVDFKFLEQILSHCSKEQLMHIEKRTKGRDLSPVTD  64

Query  743  KIWKQFYEREFGKKSASLVIE------RMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRI  582
            K WK+ + +EFG K+   +I+      +MKQKK+++ W +LY+AKLK++EE + +  +R+
Sbjct  65   KFWKRIFRQEFGSKATDELIQNIEEAKKMKQKKISYTWLKLYQAKLKKLEEEENEVGERV  124

Query  581  RDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVK  402
            + LY+K  A KQSRQ+++C KV PS  ++S        +  ++  M K +  F    EV+
Sbjct  125  KRLYEKDGARKQSRQVRVCNKVEPSRKRKSN-------FGGQNQPMSKVRKRFQNCLEVR  177

Query  401  NLAAIKNK  378
            N  A+K K
Sbjct  178  NARAMKTK  185



>ref|XP_004972743.1| PREDICTED: uncharacterized protein LOC101777071 isoform X1 [Setaria 
italica]
 ref|XP_004972744.1| PREDICTED: uncharacterized protein LOC101777071 isoform X2 [Setaria 
italica]
 ref|XP_004972745.1| PREDICTED: uncharacterized protein LOC101777071 isoform X3 [Setaria 
italica]
 ref|XP_004972746.1| PREDICTED: uncharacterized protein LOC101777071 isoform X4 [Setaria 
italica]
Length=238

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 126/195 (65%), Gaps = 8/195 (4%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLVDLCVQ  ID++RY+G V   +  LL+R LPHCT++QL  IE  TQ  DLSP+
Sbjct  4    GRKPRSLVDLCVQKVIDNLRYVGHVDGIETELLKRILPHCTLEQLTRIENRTQ-MDLSPI  62

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY++EFG+   +LVI+RMK+   K  + W +L++AK +  +E + +  ++I  
Sbjct  63   TDPLWRRFYQKEFGEDHTNLVIKRMKEAKGKARYTWKELFKAKTERQKEVEDRMLEKITK  122

Query  575  LYKKHDAEKQSRQIKLCTKVPPssskr---sfyggsSNIYNTKSTVMKKAKMDFLRSPEV  405
             ++   AEKQS+QIKLC+KVPPSS +         S +  N KS ++KKA+M+   +   
Sbjct  123  KFQAEKAEKQSKQIKLCSKVPPSSKRSFFGGGGPSSLSNSNYKSPILKKARMEA--NSRA  180

Query  404  KNLAAIKNKAVQRTN  360
            +  +AI+    QR++
Sbjct  181  RLQSAIQKNTFQRSS  195



>ref|XP_006659167.1| PREDICTED: uncharacterized protein LOC102702307 [Oryza brachyantha]
Length=331

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 125/189 (66%), Gaps = 4/189 (2%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK PSL++LC++  +D++RY+ +V   + +LLER LPHC ++ L  IE +T+  DLSP+T
Sbjct  5    RKPPSLLELCIRTTMDNLRYVDNVDGVEMNLLERILPHCKLEDLTRIESNTK-MDLSPIT  63

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            +K+WK FY R+FG+   + VI+RMK     + W +L+EAK ++ +E + K   R+ + Y+
Sbjct  64   NKLWKLFYRRQFGEDCVNGVIKRMKTSGARYTWKELFEAKTEKQKEFEDKMGQRLAEKYE  123

Query  566  KHDAEKQSRQIKLCTKVPPssskrs-fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAA  390
               AE+QS+QIK+CTKVPPSS +      G SN+ + KS ++KKA+M+   +   K  AA
Sbjct  124  LAKAERQSKQIKICTKVPPSSKRSFWGGSGPSNLSSYKSPMLKKARMEV--NSHAKMQAA  181

Query  389  IKNKAVQRT  363
            I+   + RT
Sbjct  182  IQRNTIART  190



>ref|XP_009605240.1| PREDICTED: uncharacterized protein LOC104099829 [Nicotiana tomentosiformis]
Length=120

 Score =   139 bits (350),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 60/96 (63%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  920  APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
            AP LVDLCVQ A+D+VR++GDVG T+FHLL+R LP+C+++QL  +E  TQGRDLSPVTDK
Sbjct  7    APYLVDLCVQKAMDNVRFLGDVGETEFHLLQRILPYCSLEQLMHVENLTQGRDLSPVTDK  66

Query  740  IWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYE  633
            +WK+FY+ +FG+KS + V++ MK +  TFKW QLYE
Sbjct  67   LWKRFYKIQFGEKSINQVVQDMKLRNGTFKWKQLYE  102



>ref|XP_011470590.1| PREDICTED: uncharacterized protein LOC105353271 [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = -3

Query  896  VQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYER  717
            V VAI+ +   G+V   DF  L++ LPHC  +QLA IE ST+G DL+P+TDK+WK F++R
Sbjct  14   VSVAINSLDSFGNVKGYDFWFLDQVLPHCNKNQLAHIENSTKGVDLTPITDKLWKNFFKR  73

Query  716  EFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQ  537
            +FG ++    +E+MK KKV+F+W++LY+AK + +E+ +++  +R++ +Y+K DA KQSRQ
Sbjct  74   DFGDRALDETMEKMKMKKVSFRWSELYQAKSRSLEKKEKEVGERLKKMYEKEDARKQSRQ  133

Query  536  IKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNK  378
            +K+  KVPPS+ +        +     + +M K K  +  S   +NL  +K K
Sbjct  134  VKVLDKVPPSNKRIGVINKGLSKGRKSNPIMNKLKKQYENSLAKRNLDFVKMK  186



>ref|XP_008370883.1| PREDICTED: uncharacterized protein LOC103434322 [Malus domestica]
Length=252

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (62%), Gaps = 20/190 (11%)
 Frame = -3

Query  872  RYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSAS  693
            R+ GDV   D +LLE+ LP CTVD+L+ IEKST GRDLSPVTDK+W++FY  EFG   A 
Sbjct  22   RHGGDVSGIDSNLLEKILPQCTVDELSRIEKSTGGRDLSPVTDKLWRKFYIEEFGASMAD  81

Query  692  LVIERMK-QKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCT--  522
             V+E  K      F+W +L+E K++EV + + K+ +R++  Y+   A K+SR++ +CT  
Sbjct  82   QVVENXKTNTNAAFRWKELFEKKVEEVNKKENKAAERLKSRYQMEAARKESRRVVICTEA  141

Query  521  ---------------KVP--PssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
                           +VP  PS+ +RS  G + +++   S +MKKAK DFL   EVKNLA
Sbjct  142  EAPSSTGNHKRRRSEEVPSSPSNKRRSSSGSNVSVHKKASLIMKKAKRDFLNCLEVKNLA  201

Query  392  AIKNKAVQRT  363
            A+    +Q++
Sbjct  202  AVAMAKLQKS  211



>ref|XP_009598074.1| PREDICTED: uncharacterized protein LOC104093937 [Nicotiana tomentosiformis]
Length=115

 Score =   138 bits (347),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 60/96 (63%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  920  APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
            AP LVDLCVQ A+D+VR++GDVG T+FHLL+R LPHC+++QL  +E  +QGRDLSPVTDK
Sbjct  7    APYLVDLCVQKAMDNVRFLGDVGETEFHLLQRILPHCSLEQLMHVENLSQGRDLSPVTDK  66

Query  740  IWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYE  633
            +WK+FY+ +FG+KS + V++ MK +  TFKW QLYE
Sbjct  67   LWKRFYKIQFGEKSINQVVQDMKLRNGTFKWKQLYE  102



>ref|NP_001167798.1| uncharacterized protein LOC100381492 [Zea mays]
 gb|ACN26097.1| unknown [Zea mays]
 gb|AFW57162.1| hypothetical protein ZEAMMB73_845066 [Zea mays]
Length=178

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLV+LCV+ AID++RY+G V   +  LL+R LPHCT++QL  +E ST+  DLS V
Sbjct  4    GRKPLSLVELCVRKAIDNLRYMGSVDGVEMDLLKRILPHCTMEQLTRVENSTE-MDLSLV  62

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY+REFG++  S VI R+K+  +K  + W +L+ AK ++ +E + K  D+   
Sbjct  63   TDPLWRRFYQREFGQEHTSKVIARLKELGQKTPYTWRELFAAKKEKQKEVEDKMLDKFTK  122

Query  575  LYKKHDAEKQSRQIKLCTKVPP  510
             ++   AEKQS+QIKLCTKVPP
Sbjct  123  KFQAERAEKQSKQIKLCTKVPP  144



>ref|XP_008661732.1| PREDICTED: uncharacterized protein LOC100276576 isoform X2 [Zea 
mays]
Length=242

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLV+LCV+ AID++RY+G V   +  LL+R LPHCT++QL  +E ST+  DLS V
Sbjct  7    GRKPLSLVELCVRKAIDNLRYMGSVDGVEMDLLKRILPHCTMEQLTRVENSTEM-DLSLV  65

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY+REFG++  S VI R+K+  +K  + W +L+ AK ++ +E + K  D+   
Sbjct  66   TDPLWRRFYQREFGQEHTSKVIARLKELGQKTPYTWRELFAAKKEKQKEVEDKMLDKFTK  125

Query  575  LYKKHDAEKQSRQIKLCTKVPP  510
             ++   AEKQS+QIKLCTKVPP
Sbjct  126  KFQAERAEKQSKQIKLCTKVPP  147



>gb|ACR37802.1| unknown [Zea mays]
 gb|AFW57160.1| hypothetical protein ZEAMMB73_845066 [Zea mays]
 gb|AFW57161.1| hypothetical protein ZEAMMB73_845066 [Zea mays]
Length=239

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLV+LCV+ AID++RY+G V   +  LL+R LPHCT++QL  +E ST+  DLS V
Sbjct  4    GRKPLSLVELCVRKAIDNLRYMGSVDGVEMDLLKRILPHCTMEQLTRVENSTE-MDLSLV  62

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY+REFG++  S VI R+K+  +K  + W +L+ AK ++ +E + K  D+   
Sbjct  63   TDPLWRRFYQREFGQEHTSKVIARLKELGQKTPYTWRELFAAKKEKQKEVEDKMLDKFTK  122

Query  575  LYKKHDAEKQSRQIKLCTKVPP  510
             ++   AEKQS+QIKLCTKVPP
Sbjct  123  KFQAERAEKQSKQIKLCTKVPP  144



>ref|XP_003573427.1| PREDICTED: uncharacterized protein LOC100825116 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234348.1| PREDICTED: uncharacterized protein LOC100825116 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234349.1| PREDICTED: uncharacterized protein LOC100825116 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234350.1| PREDICTED: uncharacterized protein LOC100825116 isoform X1 [Brachypodium 
distachyon]
Length=241

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK  SL++LC++  ID++RY+  +   +  LL+R LPHCT+DQL  IE  T+  D+SP T
Sbjct  5    RKPLSLLELCIRTVIDNLRYVSSMDGVEMQLLKRILPHCTLDQLTRIESCTE-MDISPAT  63

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D +WK FY+R+FG+   + V+++MKQ  V ++W  L+ AK ++ +E ++    R+   Y+
Sbjct  64   DVLWKTFYQRQFGEDHTNNVVKKMKQSGVNYQWKDLFNAKTEKQKELEEIMIQRLAKKYQ  123

Query  566  KHDAEKQSRQIKLCTKVPP  510
               AEKQS+QIKLCTKVPP
Sbjct  124  AEKAEKQSKQIKLCTKVPP  142



>gb|KEH17893.1| RNA polymerase II transcription factor SIII (elongin) subunit 
A [Medicago truncatula]
Length=136

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 16/126 (13%)
 Frame = -3

Query  887  AIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFG  708
            AID+V+Y+GDV   D H+LER LPHCT++QL  IEKSTQG DLSP+TD++WK+F+E++FG
Sbjct  12   AIDNVKYLGDVSHVDHHMLERILPHCTLEQLMHIEKSTQGMDLSPITDQLWKKFFEKQFG  71

Query  707  KKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKL  528
                                N+LYEAK+K++   + ++ DR+   YK+ DA KQSRQIK 
Sbjct  72   INCT----------------NELYEAKVKKMARAENEAVDRLTQRYKEEDARKQSRQIKT  115

Query  527  CTKVPP  510
            CTK+PP
Sbjct  116  CTKLPP  121



>ref|XP_008661731.1| PREDICTED: uncharacterized protein LOC100276576 isoform X1 [Zea 
mays]
Length=288

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 100/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLV+LCV+ AID++RY+G V   +  LL+R LPHCT++QL  +E ST+  DLS V
Sbjct  53   GRKPLSLVELCVRKAIDNLRYMGSVDGVEMDLLKRILPHCTMEQLTRVENSTE-MDLSLV  111

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY+REFG++  S VI R+K+  +K  + W +L+ AK ++ +E + K  D+   
Sbjct  112  TDPLWRRFYQREFGQEHTSKVIARLKELGQKTPYTWRELFAAKKEKQKEVEDKMLDKFTK  171

Query  575  LYKKHDAEKQSRQIKLCTKVPP  510
             ++   AEKQS+QIKLCTKVPP
Sbjct  172  KFQAERAEKQSKQIKLCTKVPP  193



>ref|XP_010234351.1| PREDICTED: uncharacterized protein LOC100825116 isoform X2 [Brachypodium 
distachyon]
Length=198

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK  SL++LC++  ID++RY+  +   +  LL+R LPHCT+DQL  IE  T+  D+SP T
Sbjct  5    RKPLSLLELCIRTVIDNLRYVSSMDGVEMQLLKRILPHCTLDQLTRIESCTE-MDISPAT  63

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D +WK FY+R+FG+   + V+++MKQ  V ++W  L+ AK ++ +E ++    R+   Y+
Sbjct  64   DVLWKTFYQRQFGEDHTNNVVKKMKQSGVNYQWKDLFNAKTEKQKELEEIMIQRLAKKYQ  123

Query  566  KHDAEKQSRQIKLCTKVPP  510
               AEKQS+QIKLCTKVPP
Sbjct  124  AEKAEKQSKQIKLCTKVPP  142



>ref|XP_004308778.1| PREDICTED: uncharacterized protein LOC101292648 [Fragaria vesca 
subsp. vesca]
Length=212

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = -3

Query  890  VAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREF  711
            VAID +   G+V   DF  L++ LPHC   QL  IE ST+G DL+P+TDK+WK F++R+F
Sbjct  16   VAIDSLDSFGNVEGYDFWFLDQLLPHCNKIQLTHIENSTKGVDLTPITDKLWKNFFKRDF  75

Query  710  GKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIK  531
            G ++    +E+MK KKV+F+W++LY+AK + +E  +++  +R++ +Y+K DA KQSRQ+K
Sbjct  76   GDRALDETMEKMKMKKVSFRWSELYQAKSRSLETKEKEVGERLKKMYEKEDARKQSRQVK  135

Query  530  LCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNK  378
            +  KVPPS+++        +     + +M K K  +  S   +NL  +K K
Sbjct  136  VLDKVPPSNTRIGVINKGLSKGRKSNQMMNKIKKQYENSLAKRNLDFVKMK  186



>ref|NP_001143804.1| uncharacterized protein LOC100276576 [Zea mays]
 gb|ACG35538.1| hypothetical protein [Zea mays]
Length=239

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 99/142 (70%), Gaps = 3/142 (2%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLV+LCV+ AID++RY+G V   +  LL+R LPHCT++QL  +E ST+  DLS V
Sbjct  4    GRKPLSLVELCVRKAIDNLRYMGSVDGVEMDLLKRILPHCTMEQLTRVENSTEM-DLSLV  62

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY+REF ++  S VI R+K+  +K  + W +L+ AK ++ +E + K  D+   
Sbjct  63   TDPLWRRFYQREFVQEHTSKVIARLKELGQKTPYTWRELFAAKKEKQKEVEDKMLDKFTK  122

Query  575  LYKKHDAEKQSRQIKLCTKVPP  510
             ++   AEKQS+QIKLCTKVPP
Sbjct  123  KFQAERAEKQSKQIKLCTKVPP  144



>ref|XP_002443929.1| hypothetical protein SORBIDRAFT_07g004520 [Sorghum bicolor]
 gb|EES13424.1| hypothetical protein SORBIDRAFT_07g004520 [Sorghum bicolor]
Length=267

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 118/184 (64%), Gaps = 9/184 (5%)
 Frame = -3

Query  944  RSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGR  765
            R   G RK  SL++LC++ AID++RYI  V   +  LL+R LPHCT++ L  IE++T+  
Sbjct  85   RMEFGRRKPMSLLELCIRKAIDNLRYIESVDGIEMDLLKRILPHCTLEHLTKIEENTK-M  143

Query  764  DLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVT-----FKWNQLYEAKLKEVEETQQ  600
            DLS VTD +WK+FY REFG++  + VI R+K  K T     + W +L+EA+ K+ ++ + 
Sbjct  144  DLSSVTDPLWKRFYFREFGEEHTNKVIARLKSLKETRSDTKYTWWKLFEARQKKQKQAED  203

Query  599  KSFDRIRDLYKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNT---KSTVMKKAKM  429
            +  ++    ++   AEKQS+QIKLCTKVPPSS +  F G   +  +    KS ++KKA+M
Sbjct  204  EMVEKFTKKFQAEKAEKQSKQIKLCTKVPPSSKRSFFGGSGPSSLSNCSYKSPMLKKARM  263

Query  428  DFLR  417
            +  R
Sbjct  264  EATR  267



>ref|XP_004308629.1| PREDICTED: uncharacterized protein LOC101315004 [Fragaria vesca 
subsp. vesca]
Length=166

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = -3

Query  923  KAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTD  744
            KA SL D  V  AI++ R++GDV   D  L+E+ LPHC+  QL  IEKST+ RDLSPVTD
Sbjct  13   KALSLAD--VSTAIENRRFLGDVSDMDLELVEQILPHCSKTQLIHIEKSTKNRDLSPVTD  70

Query  743  KIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            K+WK FYEREFG +S   V + MK+  + FKW++LY+ K K           R++   KK
Sbjct  71   KLWKSFYEREFGTESTESVSQIMKEWNLKFKWSELYQEKSK-----------RVKGAKKK  119

Query  563  HDAEKQSRQIKLCTKVPP  510
             D  K SRQ+++C KV P
Sbjct  120  EDDGKLSRQVRVCKKVSP  137



>gb|KGN49034.1| hypothetical protein Csa_6G511010 [Cucumis sativus]
Length=516

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 81/124 (65%), Gaps = 5/124 (4%)
 Frame = -3

Query  896  VQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYER  717
            V  AID V+++GDVG TD   LE  L HCT DQL  IE  ++GRDL+P+T+K+WK FYER
Sbjct  15   VNKAIDSVKFLGDVGDTDLRSLESILSHCTADQLLHIENCSKGRDLTPITNKLWKNFYER  74

Query  716  EFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQ  537
            +FGK    +V+     K  TFKW  LY AK+KE+E   +K  DRI   Y+K  A KQSRQ
Sbjct  75   KFGKDDVDIVV-----KNETFKWMDLYVAKMKELENRAKKIEDRIIQSYQKEKARKQSRQ  129

Query  536  IKLC  525
            I  C
Sbjct  130  IVFC  133



>gb|EEE68118.1| hypothetical protein OsJ_26193 [Oryza sativa Japonica Group]
Length=261

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 112/190 (59%), Gaps = 25/190 (13%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G RK  SL++LC++  +D++RY+ +V   +  LL+R LPHC ++ L  IE +T+  DL+P
Sbjct  4    GRRKPISLLELCIRTTMDNLRYVDNVDGVEMDLLQRILPHCKMEDLTRIENNTE-MDLTP  62

Query  752  VTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDL  573
            VTDK+WK FY R+FG+++A+ V++RM      +KW  L++AK K+ +E ++K   R   L
Sbjct  63   VTDKLWKLFYTRQFGEENANQVVKRMSMSGARYKWKDLFDAKTKKQKEYEEKMGQR---L  119

Query  572  YKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
             KK++A K                      G SN+ + KS ++KKA+M+   + + K  A
Sbjct  120  AKKYEAAKAG-------------------SGPSNLSSYKSPILKKARMEV--NSQAKMKA  158

Query  392  AIKNKAVQRT  363
            AI+   + RT
Sbjct  159  AIQRNTIART  168



>gb|EEC82966.1| hypothetical protein OsI_27971 [Oryza sativa Indica Group]
Length=261

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 112/190 (59%), Gaps = 25/190 (13%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G RK  SL++LC++  +D++RY+ +V   +  LL+R LPHC ++ L  IE +T+  DL+P
Sbjct  4    GRRKPISLLELCIRTTMDNLRYVDNVDGVEMDLLQRILPHCKMEDLTRIENNTE-MDLTP  62

Query  752  VTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDL  573
            VTDK+WK FY R+FG+++A+ V++RM      +KW  L++AK K+ +E ++K   R   L
Sbjct  63   VTDKLWKLFYTRQFGEENANQVVKRMSMSGARYKWKDLFDAKTKKQKEYEEKMGQR---L  119

Query  572  YKKHDAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLA  393
             KK++A K                      G SN+ + KS ++KKA+M+   + + K  A
Sbjct  120  AKKYEAAKAG-------------------SGPSNLSSYKSPILKKARMEV--NSQAKMKA  158

Query  392  AIKNKAVQRT  363
            AI+   + RT
Sbjct  159  AIQRNTIART  168



>ref|XP_009364598.1| PREDICTED: uncharacterized protein LOC103954489 [Pyrus x bretschneideri]
Length=234

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 108/188 (57%), Gaps = 26/188 (14%)
 Frame = -3

Query  872  RYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSAS  693
            R  G V   DF +LE+ L  CTV +L  +EKS+ GRDLSPVT+++W++FYE++FG     
Sbjct  20   RNGGKVSDIDFSVLEKILSQCTVGELRQVEKSSGGRDLSPVTEELWRKFYEQKFGPLRTD  79

Query  692  LVIERMKQKKVTFKWNQLYEAKLK-EVEETQQKSFDRIRDLYKKHDAEKQSRQIKLC--T  522
               +RMK++ V ++W +LY++K K E++E + K+ +R++  YK+    KQSR++ +C  T
Sbjct  80   AASKRMKKENVRYRWMELYDSKEKEELDEAETKAAERLKRRYKEEALRKQSRRVVICKET  139

Query  521  KVPPssskrsfyggsSNI--------YNTKST---------------VMKKAKMDFLRSP  411
            +VP  S  +      + +         NT S+               +MKKA+ DFL   
Sbjct  140  EVPSLSWNKRKRSEDNEVPSSSSNKGSNTGSSCGGDDGPVRKRRESWIMKKARKDFLNCI  199

Query  410  EVKNLAAI  387
            EVKN+ A+
Sbjct  200  EVKNITAM  207



>gb|AFW57163.1| hypothetical protein ZEAMMB73_845066 [Zea mays]
Length=139

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 87/129 (67%), Gaps = 6/129 (5%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
             RK  SLV+LCV+ AID++RY+G V   +  LL+R LPHCT++QL  +E ST+  DLS V
Sbjct  4    GRKPLSLVELCVRKAIDNLRYMGSVDGVEMDLLKRILPHCTMEQLTRVENSTE-MDLSLV  62

Query  749  TDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
            TD +W++FY+REFG++  S VI R+K+  +K  + W +L+ AK ++ +E + K  D+   
Sbjct  63   TDPLWRRFYQREFGQEHTSKVIARLKELGQKTPYTWRELFAAKKEKQKEVEDKMLDK---  119

Query  575  LYKKHDAEK  549
              KK  AE+
Sbjct  120  FTKKFQAER  128



>ref|NP_001061087.1| Os08g0169600 [Oryza sativa Japonica Group]
 dbj|BAF23001.1| Os08g0169600 [Oryza sativa Japonica Group]
Length=104

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G RK  SL++LC++  +D++RY+ +V   +  LL+R LPHC ++ L  IE +T+  DL+P
Sbjct  4    GRRKPISLLELCIRTTMDNLRYVDNVDGVEMDLLQRILPHCKMEDLTRIENNTE-MDLTP  62

Query  752  VTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAK  627
            VTDK+WK FY R+FG+++A+ V++RM      +KW  L++ K
Sbjct  63   VTDKLWKLFYTRQFGEENANQVVKRMSMSGARYKWKDLFDVK  104



>ref|XP_007146385.1| hypothetical protein PHAVU_006G035900g [Phaseolus vulgaris]
 ref|XP_007146386.1| hypothetical protein PHAVU_006G035900g [Phaseolus vulgaris]
 ref|XP_007146387.1| hypothetical protein PHAVU_006G035900g [Phaseolus vulgaris]
 gb|ESW18379.1| hypothetical protein PHAVU_006G035900g [Phaseolus vulgaris]
 gb|ESW18380.1| hypothetical protein PHAVU_006G035900g [Phaseolus vulgaris]
 gb|ESW18381.1| hypothetical protein PHAVU_006G035900g [Phaseolus vulgaris]
Length=124

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  788  IEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEE  609
            +EK T+GRDLSPVTDK+ K+F+E++FG  S + VI+RMK+KKV+FKW QLYEAK KE+ +
Sbjct  8    VEKFTKGRDLSPVTDKLRKKFFEKQFGTNSTNEVIKRMKEKKVSFKWVQLYEAKGKEMAQ  67

Query  608  TQQKSFDRIRDLYKKHDA  555
            T+ ++ DRI+ LYKK DA
Sbjct  68   TENEALDRIKQLYKKEDA  85



>ref|XP_008359981.1| PREDICTED: uncharacterized protein LOC103423674 [Malus domestica]
Length=232

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 110/184 (60%), Gaps = 26/184 (14%)
 Frame = -3

Query  863  GDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVI  684
            G+V   +F +LE+ LP CTV +L  +EKS+ GRDLSPVTDK+W++FYE++FG        
Sbjct  23   GNVSDIEFSVLEKILPQCTVGELRQVEKSSGGRDLSPVTDKLWRKFYEQKFGPLMTDAAS  82

Query  683  ERMKQKKVTFKWNQLYEAKLK-EVEETQQKSFDRIRDLYKKHDAEKQSRQIKLC------  525
            +RMK+ +  ++W +L+++K K E++E ++K+ +R++  YK+    KQSR++ +C      
Sbjct  83   KRMKENE-RYRWMELFDSKEKEELDEAEKKAAERLKRRYKEEALRKQSRRVVVCKETEVT  141

Query  524  -----------TKVPPssskrsfyggsSNIYNT-------KSTVMKKAKMDFLRSPEVKN  399
                        +VP SSS +    GSS   +        +S +MKKA+ DF+   EVKN
Sbjct  142  SSSRNKRKRSEDEVPSSSSNKGSNSGSSCGGDDGPVRKRKESLIMKKARKDFVNCIEVKN  201

Query  398  LAAI  387
            + A+
Sbjct  202  ITAM  205



>gb|EMS51051.1| Transcription elongation factor B polypeptide 3 [Triticum urartu]
Length=249

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 85/124 (69%), Gaps = 1/124 (1%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            RK  SL+DLC++ A+D++R +  V      LL+R LPHCT++QL  IE  T   DL+ VT
Sbjct  5    RKPLSLLDLCIRSAVDNLRTLNSVDIVPDELLKRILPHCTLEQLRHIESCTHA-DLTDVT  63

Query  746  DKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            D +WK+F++REFG+++ +L I+RMK+  V +KW +L+EA+ ++ ++ + +    +++ Y+
Sbjct  64   DVLWKRFFQREFGEENMNLAIKRMKENGVRYKWKKLFEARTEKQKQVEARMSAGLKNKYQ  123

Query  566  KHDA  555
              +A
Sbjct  124  AANA  127



>ref|XP_008370881.1| PREDICTED: uncharacterized protein LOC103434320 [Malus domestica]
Length=186

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 3/81 (4%)
 Frame = -3

Query  863  GDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVI  684
            GDV   DF++LER LPHCTVDQL  IEKST+GRDLSPVTDK+W++  E +FG   A   I
Sbjct  21   GDVSDVDFNILERILPHCTVDQLWTIEKSTRGRDLSPVTDKLWEKICEAKFG---ADPRI  77

Query  683  ERMKQKKVTFKWNQLYEAKLK  621
            E++K+  V F+W  +YEAKL+
Sbjct  78   EKIKRVNVVFRWVDVYEAKLE  98



>ref|XP_008349647.1| PREDICTED: uncharacterized protein LOC103412918 [Malus domestica]
Length=128

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -3

Query  806  VDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAK  627
            V+QL  +EKST+GRDLSPVTDK+W+ FY  EFG   A   +E  K+    FKW +LYE K
Sbjct  2    VEQLRCVEKSTRGRDLSPVTDKLWRNFYVEEFGASRADQAVENTKKSNAAFKWKELYETK  61

Query  626  LKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKV  516
            L+EV + ++K+ +R++  Y+   A KQSR++ +CT+ 
Sbjct  62   LEEVNKKEKKAAERLKSRYQMEAARKQSRRV-VCTEA  97



>ref|XP_011463641.1| PREDICTED: uncharacterized protein LOC105351343 [Fragaria vesca 
subsp. vesca]
Length=151

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 12/113 (11%)
 Frame = -3

Query  845  DFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQK  666
            D  L+E+ LPHC+  QL  IEKST+ RDLSPVTDK+WK FYE+EFG +S   V E MK+ 
Sbjct  2    DLELVEQILPHCSKTQLIHIEKSTKDRDLSPVTDKLWKTFYEKEFGIESTESVSEIMKEW  61

Query  665  KVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLC-TKVPP  510
             + FKW+ LY+ K K           R++   KK    K SRQ+++   +VPP
Sbjct  62   NLKFKWSDLYQEKSK-----------RVKGASKKESDGKLSRQVRVSKNQVPP  103



>gb|ACU14646.1| unknown [Glycine max]
Length=90

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = -3

Query  677  MKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPPsssk  498
            MK+K+V F+W QLYEAK KE  + + ++ DRIR LYKK DA KQSRQ++ CTKVPPSS +
Sbjct  1    MKEKRVNFRWMQLYEAKGKERAQAENEALDRIRQLYKKEDARKQSRQVRTCTKVPPSSKR  60

Query  497  r--sfyggsSNIYNTKSTVMKKAKMDFLR  417
            R     G   N+ N KS +MKKAK++FL+
Sbjct  61   RFWGDNGPGYNVSNVKSNIMKKAKIEFLK  89



>ref|XP_003600485.1| hypothetical protein MTR_3g061710 [Medicago truncatula]
 gb|AES70736.1| hypothetical protein MTR_3g061710 [Medicago truncatula]
Length=146

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 80/166 (48%), Gaps = 55/166 (33%)
 Frame = -3

Query  911  LVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIWK  732
            LVDLCV+ AID+V+Y+GDV   D H++                      DLS +++K+WK
Sbjct  19   LVDLCVEKAIDNVKYLGDVSHVDHHMM----------------------DLSHISNKLWK  56

Query  731  QFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDAE  552
            +F E++FG    + V++ MK+K V+F W                                
Sbjct  57   KFIEKQFGIICTNEVVKDMKEKIVSFTW-------------------------------L  85

Query  551  KQSRQIKLCTKVPPssskrsfygg-sSNIYNTKST-VMKKAKMDFL  420
            KQSR+IK CTK+PPS  +     G   N  N KS+ +MKK+K  FL
Sbjct  86   KQSRKIKTCTKIPPSKRRLCGGNGPRYNFSNVKSSNIMKKSKKYFL  131



>ref|XP_007372398.1| hypothetical protein SPAPADRAFT_58109 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34986.1| hypothetical protein SPAPADRAFT_58109 [Spathaspora passalidarum 
NRRL Y-27907]
Length=308

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 7/132 (5%)
 Frame = -3

Query  920  APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
             P+LV LC+     +   I DVG T +HLLE  L   +  QL  +E  T    L P +DK
Sbjct  17   VPTLVHLCISCLRKNTSQIQDVGPTPYHLLEPVLERMSAKQLNQLE--TASPQLIPFSDK  74

Query  740  IWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKH  561
            +W +  EREF  +   L ++     K +  +  L+E  +K+ EE +Q S  R+R++  K 
Sbjct  75   LWVKLIEREFPDRPGKLPLD----IKSSMPYKTLFERYVKDREEFKQDSAMRLRNITHKL  130

Query  560  DAEK-QSRQIKL  528
            + +K Q++ +KL
Sbjct  131  ERKKLQNKVVKL  142



>ref|XP_011008965.1| PREDICTED: uncharacterized protein LOC105114188 [Populus euphratica]
Length=107

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = -3

Query  551  KQSRQIKLCTKVPPssskrs---fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKN  381
            KQSRQ++LC+KVPPSS+KRS     G   N+ N KS +MKKAKMDFL+S EV+N+AA++ 
Sbjct  11   KQSRQVRLCSKVPPSSNKRSFCGGSGPGYNLSNGKSNLMKKAKMDFLKSREVQNIAAMRK  70

Query  380  KAVQRT  363
             A+QR 
Sbjct  71   NALQRN  76



>gb|EPX75006.1| elongin-A [Schizosaccharomyces octosporus yFS286]
Length=264

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (52%), Gaps = 17/174 (10%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALI-EKSTQGRDLSPVTDKI  738
            SL D+C+QVA  +V  I D+G   + LLE  L     D+L+L+ E+S   R  S     +
Sbjct  3    SLKDICIQVAQKYVNDIEDIGDYPYALLEPILERAPPDRLSLLEERSPHVRRES---QSL  59

Query  737  WKQFYEREFGKKSASLVIERMKQK-KVTFKWNQLYEAKLKEVEETQ-QKSFDRIRDLYKK  564
            WKQ   R+F      L +++ K     T  W  LYE +LK+   TQ  ++ +++R+ Y K
Sbjct  60   WKQHVLRDFA-----LELQQFKVPVPSTTDWRSLYE-RLKKRRHTQYNEASEKLRNAYTK  113

Query  563  HDAEKQSRQIKLCTKVPPssskrsfyggsSNI-----YNTKSTVMKKAKMDFLR  417
             +  KQ+++I    + P S+  +      +N      Y  KS++M KA+ DFL+
Sbjct  114  LEQTKQNKRIVPLEREPRSARPQKRLRPMNNYAPKSNYAPKSSLMTKARNDFLK  167



>dbj|GAC99885.1| pof4 protein [Pseudozyma hubeiensis SY62]
Length=586

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 79/139 (57%), Gaps = 8/139 (6%)
 Frame = -3

Query  941  SAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRD  762
            SA  N    SL  +C++V + ++  + D+G   +H  +  L  C +DQL L+E+++    
Sbjct  52   SAHRNTGVNSLYSMCLRVILRNISSVQDLGVLPYHHAKPILEECRIDQLILLEENSP--H  109

Query  761  LSPVTDKIWKQFYEREF---GKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSF  591
            L   +++IWK+   R+F    KK AS  ++ +K+ K    W +LY     E+E+ +  + 
Sbjct  110  LLKHSEEIWKRNCLRDFIDLRKKYASFSLDNVKEPK---SWRRLYFRTKGEIEQAKTDAA  166

Query  590  DRIRDLYKKHDAEKQSRQI  534
             RI+D Y++H AEK+++++
Sbjct  167  KRIKDKYEQHRAEKEAKKL  185



>gb|ETS64518.1| hypothetical protein PaG_00983 [Pseudozyma aphidis DSM 70725]
Length=476

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%), Gaps = 4/142 (3%)
 Frame = -3

Query  953  HRMRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKST  774
            H   +   +R+ PSL  +C++V + ++  + D+G   +      L  C +DQL L+E+++
Sbjct  49   HEPATDAASRRLPSLYSMCLRVIMRNISSVQDLGDMPYRNAAPILEECRIDQLILLEEAS  108

Query  773  QGRDLSPVTDKIWKQFYEREFG--KKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQ  600
                L   TD+IWK+   R+F   +K  S  I      +    W +LY     E+E+ + 
Sbjct  109  P--HLLGHTDEIWKRNCLRDFFELRKKYSEPIAGAAAPREPKSWRKLYFRTKGEIEQAKV  166

Query  599  KSFDRIRDLYKKHDAEKQSRQI  534
            ++  RI+D Y +H AEK ++++
Sbjct  167  EAAQRIKDKYAQHRAEKDAKKL  188



>dbj|GAC75749.1| RNA polymerase II transcription elongation factor Elongin/SIII, 
subunit elongin A [Pseudozyma antarctica T-34]
Length=476

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%), Gaps = 4/142 (3%)
 Frame = -3

Query  953  HRMRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKST  774
            H   +   +R+ PSL  +C++V + ++  + D+G   +      L  C +DQL L+E+++
Sbjct  49   HEPATDAASRRLPSLYSMCLRVIMRNISSVQDLGDMPYRNAAPILEECRIDQLILLEEAS  108

Query  773  QGRDLSPVTDKIWKQFYEREFG--KKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQ  600
                L   TD+IWK+   R+F   +K  S  I      +    W +LY     E+E+ + 
Sbjct  109  P--HLLGHTDEIWKRNCLRDFFELRKKYSEPIAGAAAPREPKSWRKLYFRTKGEIEQAKV  166

Query  599  KSFDRIRDLYKKHDAEKQSRQI  534
            ++  RI+D Y +H AEK ++++
Sbjct  167  EAAQRIKDKYAQHRAEKDAKKL  188



>emb|CDX95539.1| BnaC01g34310D [Brassica napus]
Length=485

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 12/103 (12%)
 Frame = -3

Query  926  RKAPSLVDLCVQV---AIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLS  756
            ++ PSL DL ++    ++ HV  + D       LLERFL  C  ++L  I+ +    D+ 
Sbjct  154  KETPSLRDLLLKPLTGSLTHVNSMPD------DLLERFLGLCNSEELLRIDINN---DIY  204

Query  755  PVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAK  627
             +TD +WK+FY+ EFG K A LV + +     +FKW++ +  K
Sbjct  205  KLTDPVWKRFYQHEFGSKEAELVHQNLGMCDTSFKWSECFHEK  247



>ref|XP_001526874.1| hypothetical protein LELG_01702 [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK43524.1| hypothetical protein LELG_01702 [Lodderomyces elongisporus NRRL 
YB-4239]
Length=341

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (49%), Gaps = 9/141 (6%)
 Frame = -3

Query  956  EHRMRSAVGNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKS  777
            E+R RS V     P+L+ L  Q    HV  + DVG T +HLLE  L   +  QL  +E S
Sbjct  6    ENRHRSGV-----PTLLHLSQQCIKRHVFQLLDVGTTPYHLLEPVLAMMSAKQLDQLESS  60

Query  776  TQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQK  597
            +    L P +DK+W+    ++F  +     I  ++    T  +  LY   +KE +E ++ 
Sbjct  61   ST--QLLPYSDKLWRSLIIKDFPDRPPD--IGPLEDVGETMPYKSLYNKYVKERDEFRKN  116

Query  596  SFDRIRDLYKKHDAEKQSRQI  534
            S  R++ + +    EKQ  Q+
Sbjct  117  SRKRLQHMQESLRKEKQKNQV  137



>ref|XP_007877059.1| hypothetical protein PFL1_01366 [Pseudozyma flocculosa PF-1]
 gb|EPQ31178.1| hypothetical protein PFL1_01366 [Pseudozyma flocculosa PF-1]
Length=563

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 70/131 (53%), Gaps = 14/131 (11%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL ++C +V + ++  + ++G   F + +  L  C VDQL  IE+++    L   TD+IW
Sbjct  56   SLTNMCRKVVLRNLHAVQNLGDMPFRIAKDILEQCRVDQLITIEEASP--HLLTDTDQIW  113

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFK----WNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            K+   R+F        +E  K+ +   K    W ++Y  K  E+EE + ++  RI+D Y 
Sbjct  114  KRNCLRDF--------VEVRKKYESDAKEPKSWRRVYFRKKGELEEQKAEAKQRIKDRYA  165

Query  566  KHDAEKQSRQI  534
             H AEK ++++
Sbjct  166  SHRAEKDAKKL  176



>emb|CCE40692.1| hypothetical protein CPAR2_107270 [Candida parapsilosis]
Length=332

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (52%), Gaps = 5/130 (4%)
 Frame = -3

Query  917  PSLVDLCVQVAID-HVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
            P+L+ L  QV I  H+  + DVG T +HLL   L   +  QL  IE  T    L+P +D+
Sbjct  16   PTLLHLS-QVCIKRHLSQLQDVGTTPYHLLASILSLMSAKQLDQIE--TLSTQLTPHSDE  72

Query  740  IWKQFYEREFGKKSASL-VIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
            +WKQ   ++F  + A L  +E  K K     +  LY   +K+ +E ++ S  R+R L + 
Sbjct  73   LWKQLIVKDFSDRPAELGPLELTKLKFEKMPYKSLYYKYVKQRDEFRKDSAKRLRQLNQS  132

Query  563  HDAEKQSRQI  534
             + EK   +I
Sbjct  133  MNKEKDKNKI  142



>ref|XP_001385834.2| hypothetical protein PICST_48306 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN67805.2| predicted protein, partial [Scheffersomyces stipitis CBS 6054]
Length=207

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (48%), Gaps = 5/134 (4%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
            G  K PSLV L  Q    H+  + D G T +HL+E  L      QL+ +E+ +    + P
Sbjct  13   GRPKFPSLVHLATQTISRHLTSLEDFGQTPYHLMEPILKRMNAKQLSSMEEKSP--HIVP  70

Query  752  VTDKIWKQFYEREFGKKSASL-VIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRD  576
             +D++W Q  E++F  +  +  V  R K     ++   LY   + E E  +Q S  R+R 
Sbjct  71   QSDRLWSQLIEKDFPDRPHTADVFSRTKPDATPYR--TLYHKYVTEREAFRQDSAKRLRR  128

Query  575  LYKKHDAEKQSRQI  534
            + ++   +K   +I
Sbjct  129  ITQQLQNKKSENKI  142



>gb|KGN47017.1| hypothetical protein Csa_6G169330 [Cucumis sativus]
Length=101

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = -3

Query  551  KQSRQIKLCTKVPPssskrs--fyggsSNIYNTKSTVMKKAKMDFLRSPEVKNLAAIKNK  378
            KQSRQI++C+KVPPSS+KRS    G   N+ NTK+ ++KKAK++ L+S E+KN+ A +  
Sbjct  6    KQSRQIQICSKVPPSSNKRSFGGSGYGYNVANTKNKILKKAKIEVLQSQEMKNIKAWRRN  65

Query  377  AVQRT  363
            AVQ++
Sbjct  66   AVQKS  70



>gb|EDK37916.2| hypothetical protein PGUG_02014 [Meyerozyma guilliermondii ATCC 
6260]
Length=288

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 14/130 (11%)
 Frame = -3

Query  911  LVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIE-KSTQGRDLSPVTDKIW  735
            L DL  Q  + +V  + DVG T +H+L+  L   +  QL  IE KS+Q   + P +D++W
Sbjct  6    LRDLAAQKCVSNVALLHDVGDTPYHILKPILCRMSARQLDQIESKSSQ---IIPYSDQLW  62

Query  734  KQFYEREFGKK---SASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
                 R+F  +   S SLV   M  K + FK+       L E E  Q+ S  R+R + ++
Sbjct  63   PNLISRDFPNRPLASRSLVDTPMPHKALYFKY-------LSEREALQRDSAQRLRSMTQR  115

Query  563  HDAEKQSRQI  534
               EK    I
Sbjct  116  LRQEKSKNAI  125



>emb|CDI54908.1| hypothetical protein BN887_03112 [Melanopsichium pennsylvanicum 
4]
Length=636

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 6/131 (5%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL  +C++V + +V  + D+G   +   +  L  C +DQL  IE+++    L   T++IW
Sbjct  77   SLYSMCLRVILRNVSSVQDLGDMPYRNAKPILEECRIDQLIGIEEASP--HLLEHTEEIW  134

Query  734  KQFYEREF----GKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYK  567
            K+   R+F     K + S  I      K    W +LY     E+E+   ++  RI+D Y 
Sbjct  135  KRNCLRDFIDLRKKYNPSNSISTTSPPKEPKSWRRLYFRSKGEIEQAVVEAAQRIKDKYA  194

Query  566  KHDAEKQSRQI  534
            +H AEK ++++
Sbjct  195  QHRAEKDAKKL  205



>sp|O59671.3|POF4_SCHPO RecName: Full=Elongin-A; AltName: Full=Protein pof4 [Schizosaccharomyces 
pombe 972h-]
Length=263

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (46%), Gaps = 8/166 (5%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL DLC+QVA  HV  I D+G   F L++  L     + L  +E+ +    +   T  +W
Sbjct  3    SLKDLCIQVAQKHVHDIDDIGDCPFELVKPILEKARPEHLIDLEEKSPHLKVD--TQPLW  60

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            K    R+FG     L +++         W  LY    K+       +  ++R  Y K + 
Sbjct  61   KDHVLRDFG-----LELQKRTILNNIDDWRGLYGKLKKKRNAHYNVASAKLRSAYTKLEQ  115

Query  554  EKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLR  417
             KQ+++I    + P ++         SN Y  KS++M +AK DFL+
Sbjct  116  SKQNKRIVPLEREPRAARPPKRPRPMSN-YCPKSSLMARAKSDFLK  160



>gb|EPY49632.1| elongin-A [Schizosaccharomyces cryophilus OY26]
Length=259

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 86/168 (51%), Gaps = 11/168 (7%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL ++C+QVA  ++  I D+G   + LLE  L     D+L L+E+  +   +   +  +W
Sbjct  3    SLKEICLQVAQKYINDIEDIGDYPYALLEPILERAPPDRLHLLEE--RSPHIKQESQSLW  60

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFK-WNQLYEAKLKEVEETQ-QKSFDRIRDLYKKH  561
            K    R+F      L +++ K    +   W  LY+ +LK+   TQ  ++ +++R+ Y K 
Sbjct  61   KLHVLRDFA-----LELQQFKAPLPSITDWRSLYQ-RLKKRRNTQYNEASEKLRNAYTKL  114

Query  560  DAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLR  417
            +  KQ+++I    +  P S++        N    KS++M KA+ DFL+
Sbjct  115  EQTKQTKRIVPLERE-PRSARPPKRLRPMNNCAPKSSLMTKARNDFLK  161



>ref|XP_003867987.1| Ela1 protein [Candida orthopsilosis Co 90-125]
 emb|CCG22552.1| Ela1 protein [Candida orthopsilosis]
Length=336

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 71/132 (54%), Gaps = 9/132 (7%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEK-STQGRDLSPVTDK  741
            P+L+ L       H+  + DVG T +HLL   L   +  QL  +E  STQ   L+P +D+
Sbjct  17   PTLLHLSQLCIKRHLSQLQDVGTTPYHLLASVLSLMSAKQLDQLESLSTQ---LTPHSDE  73

Query  740  IWKQFYEREFGKKS---ASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            +WKQ   ++F  +      L + ++K +K+ +K   LY   +K+ ++ ++ S  R+R L 
Sbjct  74   LWKQLIVKDFPDRPVELGPLELNKLKFEKMPYK--SLYYKYVKQRDDFRKDSAKRLRHLN  131

Query  569  KKHDAEKQSRQI  534
            +  + EK S++I
Sbjct  132  QSMNKEKDSKKI  143



>ref|NP_595836.2| elongin-A, F-box protein Pof4 (predicted) [Schizosaccharomyces 
pombe 972h-]
 emb|CAA18385.2| elongin-A, F-box protein Pof4 (predicted) [Schizosaccharomyces 
pombe]
Length=188

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (46%), Gaps = 8/166 (5%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL DLC+QVA  HV  I D+G   F L++  L     + L  +E+ +    +   T  +W
Sbjct  3    SLKDLCIQVAQKHVHDIDDIGDCPFELVKPILEKARPEHLIDLEEKSPHLKVD--TQPLW  60

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            K    R+FG     L +++         W  LY    K+       +  ++R  Y K + 
Sbjct  61   KDHVLRDFG-----LELQKRTILNNIDDWRGLYGKLKKKRNAHYNVASAKLRSAYTKLEQ  115

Query  554  EKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLR  417
             KQ+++I    + P ++         SN Y  KS++M +AK DFL+
Sbjct  116  SKQNKRIVPLEREPRAARPPKRPRPMSN-YCPKSSLMARAKSDFLK  160



>gb|KIK59590.1| hypothetical protein GYMLUDRAFT_60129 [Gymnopus luxurians FD-317 
M1]
Length=343

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 71/157 (45%), Gaps = 27/157 (17%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKS---------  777
            +R+  SLV LC +VA +H+  I  +G   F+L+   L  C+ +QL  +E S         
Sbjct  11   SRRIQSLVQLCQRVAGNHIESISSLGELPFNLVRPILERCSAEQLLRVEDSSPHLKRDSE  70

Query  776  --TQGRDLSPVTDKIWKQFYEREFGKKSASLVIERMKQ--KKVTFKWNQ----LYEAKLK  621
              + GR + P   ++WK    R F       ++ER       V   W      L EA+ K
Sbjct  71   GMSPGRFI-PAAAQLWKTLCLRTF-----PALLERHNDDTDAVPNFWRDHFFVLREAEAK  124

Query  620  EVEETQQKSFDRIRDLYKKHDAEKQSRQIKLCTKVPP  510
              EE       RIR   ++ D  K+ R++KL  ++PP
Sbjct  125  RFEEIGL----RIRSQRREADERKKEREVKLTDRLPP  157



>ref|XP_002171819.1| elongin-A [Schizosaccharomyces japonicus yFS275]
 gb|EEB05526.1| elongin-A [Schizosaccharomyces japonicus yFS275]
Length=242

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 74/168 (44%), Gaps = 10/168 (6%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEK-STQGRDLSPVTDK  741
            PSL DLCV+VA  +V+ I D+G   F L+E  L     D L  +E+ S   RD    T  
Sbjct  4    PSLQDLCVKVAQRYVQDIEDLGDHPFSLVEPILACARPDHLIRLEQNSPHLRD---DTQG  60

Query  740  IWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKH  561
            +WK    REFG     L I       +   W + YE   K        +  ++R  Y K 
Sbjct  61   LWKVHVYREFG-----LDITDQDTSNIQ-DWRRAYEDFKKRRNAQYNLASKKLRSAYTKL  114

Query  560  DAEKQSRQIKLCTKVPPssskrsfyggsSNIYNTKSTVMKKAKMDFLR  417
            +  KQ ++I      P S  +R         Y   S++M +AK DF++
Sbjct  115  EQNKQHKRIVSLEFDPKSIQQRKRGRTVLPTYTPTSSLMNRAKCDFMK  162



>ref|XP_011390759.1| hypothetical protein UMAG_10405 [Ustilago maydis 521]
 gb|KIS67722.1| hypothetical protein UMAG_10405 [Ustilago maydis 521]
Length=635

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 69/144 (48%), Gaps = 26/144 (18%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP----VT  747
            SL  +C++V + ++  + D+G   +H  +  L  C +DQL  +E      D SP     +
Sbjct  74   SLYSMCLRVILRNISSVQDLGVLPYHHAKPILEECRIDQLISLE------DASPHLLEHS  127

Query  746  DKIWKQFYEREF-------------GKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEET  606
            D+IWK+   R+F             G  ++       K+ K    W +LY     E E+ 
Sbjct  128  DEIWKRNCLRDFIELRKKYTPPSTCGSDASPSAKPPAKEPK---SWRRLYFRTKGESEQA  184

Query  605  QQKSFDRIRDLYKKHDAEKQSRQI  534
            +  +  RI+D Y++H AEK+++++
Sbjct  185  KVDAARRIKDKYEQHRAEKEAKKL  208



>dbj|GAM24360.1| hypothetical protein SAMD00019534_075350 [Acytostelium subglobosum 
LB1]
Length=206

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 62/133 (47%), Gaps = 11/133 (8%)
 Frame = -3

Query  920  APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
             P+L D+C+    +++  I ++G  +  LL R    CT  QL  +E+    R++   T  
Sbjct  22   VPTLQDICLNKIKENIDSIKNIGLINNELLIRVFEKCTPSQLGALERKLSHREID--TGF  79

Query  740  IWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKH  561
            IW++F   EF        +E ++       W   Y     + +E   +S   +R  Y + 
Sbjct  80   IWRRFCVVEFN-------VETLEHG--VGSWKAYYNKLQNDYQERTTRSIRALRSQYNEK  130

Query  560  DAEKQSRQIKLCT  522
            + EK+S+QIK+ +
Sbjct  131  ENEKKSKQIKVIS  143



>ref|XP_713678.1| hypothetical protein CaO19.8630 [Candida albicans SC5314]
 gb|EAK94574.1| hypothetical protein CaO19.8630 [Candida albicans SC5314]
 gb|KGQ98771.1| hypothetical protein MEU_00367 [Candida albicans P37005]
 gb|KGR21410.1| hypothetical protein MG3_00413 [Candida albicans P78048]
 gb|KHC48893.1| hypothetical protein W5O_00374 [Candida albicans Ca6]
 gb|KHC49710.1| hypothetical protein W5O_00367 [Candida albicans Ca6]
Length=392

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 17/148 (11%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLSTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREFGKK------SASLVIERMKQK---------KVTFKWNQLYEAKLKE  618
             +DK+W +   ++F  +      SA+    ++ QK          +   +  LY    ++
Sbjct  71   YSDKLWMKLILKDFPDRPPPPPPSAATSPIKLNQKHGGGSGGICGLDMPYKSLYYKYCQD  130

Query  617  VEETQQKSFDRIRDLYKKHDAEKQSRQI  534
             +E ++ S  R+R   K  + +K   +I
Sbjct  131  RDEFRKDSAKRLRHANKSLERQKSKNKI  158



>gb|KGU14719.1| hypothetical protein MEQ_00363 [Candida albicans P87]
Length=392

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 17/148 (11%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLSTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREFGKK------SASLVIERMKQK---------KVTFKWNQLYEAKLKE  618
             +DK+W +   ++F  +      SA+    ++ QK          +   +  LY    ++
Sbjct  71   YSDKLWMKLILKDFPDRPPPPPPSAATSPIKLNQKHGGGSGGICGLDMPYKSLYYKYCQD  130

Query  617  VEETQQKSFDRIRDLYKKHDAEKQSRQI  534
             +E ++ S  R+R   K  + +K   +I
Sbjct  131  RDEFRKDSAKRLRHANKSLERQKSKNKI  158



>gb|KGR03584.1| hypothetical protein MG1_00366 [Candida albicans GC75]
Length=392

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 17/148 (11%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLSTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREFGKK------SASLVIERMKQK---------KVTFKWNQLYEAKLKE  618
             +DK+W +   ++F  +      SA+    ++ QK          +   +  LY    ++
Sbjct  71   YSDKLWMKLILKDFPDRPPPPPPSAATSPIKLNQKHGGGSGGICGLDMPYKSLYYKYCQD  130

Query  617  VEETQQKSFDRIRDLYKKHDAEKQSRQI  534
             +E ++ S  R+R   K  + +K   +I
Sbjct  131  RDEFRKDSAKRLRHANKSLERQKSKNKI  158



>ref|XP_456749.2| DEHA2A09614p [Debaryomyces hansenii CBS767]
 emb|CAG84710.2| DEHA2A09614p [Debaryomyces hansenii CBS767]
Length=415

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (45%), Gaps = 18/143 (13%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SLV++ +   I HV  + DVGAT FHLL   L      QL  IE+ +    ++P +D++W
Sbjct  19   SLVEIAINKCIQHVAKLEDVGATPFHLLVPVLRRMNAKQLGQIEELSP--QITPDSDELW  76

Query  734  KQFYEREFGKK---SASLVIERMKQKKVTF-------------KWNQLYEAKLKEVEETQ  603
                 +EF  +   + S+   ++K K+                    LY     E E  +
Sbjct  77   TNLVSKEFPDRPILANSIRTSKVKSKRANLVAPAGRTLMFCNMPMKSLYFQYSDERESFR  136

Query  602  QKSFDRIRDLYKKHDAEKQSRQI  534
            Q S +R+R + ++   EK +  I
Sbjct  137  QDSAERLRKITQRLKKEKSANSI  159



>emb|CBQ68825.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=561

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 67/136 (49%), Gaps = 20/136 (15%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV----T  747
            SL  +C++V + ++  + D+G   +   +  L  C V+QL  +E      D SP     T
Sbjct  54   SLYTMCLRVVLRNISSVQDLGVLPYRHAKPILEECRVEQLIALE------DASPHLLAHT  107

Query  746  DKIWKQFYEREFGK-----KSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRI  582
            D+IW++   R+F +      SA  V+      K    W +LY     E+E+ +  +  RI
Sbjct  108  DEIWRRNCLRDFLELRRKYSSADAVVP-----KEPRSWRKLYLRTRGEIEQAKTDAAKRI  162

Query  581  RDLYKKHDAEKQSRQI  534
            +  Y++H AEK ++++
Sbjct  163  KHKYEQHRAEKDAKKL  178



>emb|CCF50758.1| uncharacterized protein UHOR_06336 [Ustilago hordei]
Length=621

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 70/132 (53%), Gaps = 10/132 (8%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL  +C++V + ++  + D+G   +   +  L  C V+QL  +E+++    L   T+++W
Sbjct  87   SLYSMCLRVILRNISSVQDLGEMPYRNAKPILEECRVEQLVTLEEASP--HLLEHTEEVW  144

Query  734  KQFYEREFGK-----KSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLY  570
            K+   R+F +       ++  I   K+ K    W +LY     E E+ + ++  RI+D Y
Sbjct  145  KRNCLRDFNELRKKYTPSTPCIALPKEPK---SWRRLYFRTKGETEQAKLEAAKRIKDKY  201

Query  569  KKHDAEKQSRQI  534
             +H AEK+++++
Sbjct  202  VQHRAEKEAKKL  213



>ref|XP_008329245.1| PREDICTED: transcription elongation factor B polypeptide 3 isoform 
X1 [Cynoglossus semilaevis]
Length=682

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 66/130 (51%), Gaps = 15/130 (12%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL D C++V  +++  I +VG   F +LE  L  CT +QL  IE+S Q    +  +D++W
Sbjct  458  SLYDQCIRVLQNNIDSIAEVGGVPFDILEPVLERCTPEQLYRIEQSNQC--FTEDSDELW  515

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            K+  +R+F  ++           +    W ++Y   L+  EE +++     +++   H  
Sbjct  516  KRHCQRDFKSETP----------QEYESWREMY---LRLHEEREERLRMLTQNISSAHAN  562

Query  554  EKQSRQIKLC  525
            + + RQ+KL 
Sbjct  563  KPKGRQVKLA  572



>gb|KHC68548.1| Ela1p-like protein [Candida albicans P75010]
Length=392

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLSTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREF  711
             +DK+W +   ++F
Sbjct  71   YSDKLWMKLILKDF  84



>gb|KHC57342.1| Ela1p-like protein [Candida albicans P60002]
Length=392

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLSTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREF  711
             +DK+W +   ++F
Sbjct  71   YSDKLWMKLILKDF  84



>ref|XP_008329247.1| PREDICTED: transcription elongation factor B polypeptide 3 isoform 
X2 [Cynoglossus semilaevis]
Length=661

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 66/130 (51%), Gaps = 15/130 (12%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SL D C++V  +++  I +VG   F +LE  L  CT +QL  IE+S Q    +  +D++W
Sbjct  437  SLYDQCIRVLQNNIDSIAEVGGVPFDILEPVLERCTPEQLYRIEQSNQC--FTEDSDELW  494

Query  734  KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKKHDA  555
            K+  +R+F  ++           +    W ++Y   L+  EE +++     +++   H  
Sbjct  495  KRHCQRDFKSETP----------QEYESWREMY---LRLHEEREERLRMLTQNISSAHAN  541

Query  554  EKQSRQIKLC  525
            + + RQ+KL 
Sbjct  542  KPKGRQVKLA  551



>ref|XP_001486343.1| hypothetical protein PGUG_02014 [Meyerozyma guilliermondii ATCC 
6260]
Length=288

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 62/130 (48%), Gaps = 14/130 (11%)
 Frame = -3

Query  911  LVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIE-KSTQGRDLSPVTDKIW  735
            L DL  Q  + +V  + DVG T +H+L+  L   +  QL  IE KS+Q   + P +D++W
Sbjct  6    LRDLAAQKCVLNVALLHDVGDTPYHILKPILCRMSARQLDQIESKSSQ---IIPYSDQLW  62

Query  734  KQFYEREFGKKSAS---LVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRIRDLYKK  564
                 R+F  +  +   LV   M  K + FK+       L E E  Q+ S  R+R + ++
Sbjct  63   PNLISRDFPNRPLASRLLVDTPMPHKALYFKY-------LSEREALQRDSAQRLRSMTQR  115

Query  563  HDAEKQSRQI  534
               EK    I
Sbjct  116  LRQEKSKNAI  125



>gb|EJW72673.1| hypothetical protein WUBG_16420 [Wuchereria bancrofti]
Length=133

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -3

Query  920  APSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDK  741
             P+L +LC+++ I ++  I +VG T + LL+  L  C+++QL LIE+  +   L   +D+
Sbjct  34   VPTLQNLCIKILIANINSIEEVGDTPYFLLKPVLEKCSLNQLCLIER--RNPQLMEDSDE  91

Query  740  IWKQFYEREFGK  705
            +W++   R F K
Sbjct  92   LWERIVNRAFPK  103



>gb|KGQ91646.1| hypothetical protein MEO_00370 [Candida albicans P94015]
Length=391

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (3%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P 
Sbjct  14   NKKLPSLVDISLSTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLPY  71

Query  749  TDKIWKQFYEREF  711
            +DK+W +   ++F
Sbjct  72   SDKLWMKLILKDF  84



>gb|KGT72565.1| hypothetical protein MEK_00370 [Candida albicans 12C]
Length=392

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 17/148 (11%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREFGKK------SASLVIERMKQK---------KVTFKWNQLYEAKLKE  618
             +DK+W +   ++F  +      SA+    ++ QK          +   +  LY    ++
Sbjct  71   YSDKLWMKLILKDFPDRPPPPPPSAATSPIKLNQKHGGGSGGICGLDMPYKSLYYKYCQD  130

Query  617  VEETQQKSFDRIRDLYKKHDAEKQSRQI  534
             +E ++ S  R+R   K  + +K   +I
Sbjct  131  RDEFRKDSAKRLRHANKSLERQKSKNKI  158



>gb|KGR23435.1| hypothetical protein MG9_00370 [Candida albicans P37037]
 gb|KHC75795.1| hypothetical protein MGI_00365 [Candida albicans P75016]
Length=392

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 17/148 (11%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREFGKK------SASLVIERMKQK---------KVTFKWNQLYEAKLKE  618
             +DK+W +   ++F  +      SA+    ++ QK          +   +  LY    ++
Sbjct  71   YSDKLWMKLILKDFPDRPPPPPPSAATSPIKLNQKHGGGSGGICGLDMPYKSLYYKYCQD  130

Query  617  VEETQQKSFDRIRDLYKKHDAEKQSRQI  534
             +E ++ S  R+R   K  + +K   +I
Sbjct  131  RDEFRKDSAKRLRHANKSLERQKSKNKI  158



>ref|XP_004201945.1| Piso0_001411 [Millerozyma farinosa CBS 7064]
 emb|CCE88639.1| Piso0_001411 [Millerozyma farinosa CBS 7064]
Length=373

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 66/141 (47%), Gaps = 20/141 (14%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIE-KSTQGRDLSPV  750
            RK P L ++C +  I  V ++ DVG T FHLL+  L      QL  +E KS Q   + P 
Sbjct  15   RKLPKLSEICTKQCIQSVNFLFDVGNTPFHLLKPILQKMNAKQLQQVEAKSPQ---IMPE  71

Query  749  TDKIWKQFYEREFGKKSASL---------VIERMKQKKVTFKWNQLYEAKLKEVEETQQK  597
            +D +W    E+EF  +  ++           + M  K + ++++   ++  K+ EE    
Sbjct  72   SDMLWSALVEKEFPDRPLTVRPRKLGGTKGFDSMPMKSLYYRYSDDRDSFRKDAEE----  127

Query  596  SFDRIRDLYKKHDAEKQSRQI  534
               R+R +  +   EK ++ I
Sbjct  128  ---RLRRITHRLKIEKSAKSI  145



>ref|XP_004202570.1| Piso0_001411 [Millerozyma farinosa CBS 7064]
 emb|CCE79354.1| Piso0_001411 [Millerozyma farinosa CBS 7064]
Length=374

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 67/141 (48%), Gaps = 20/141 (14%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIE-KSTQGRDLSPV  750
            RK P L ++C +  I  V ++ D+G+T FHLL+  L      QL  +E KS Q   + P 
Sbjct  15   RKLPKLSEICTKQCIQSVNFLFDIGSTPFHLLKPILQKMNAKQLQQVESKSPQ---IMPE  71

Query  749  TDKIWKQFYEREFGKKSASL---------VIERMKQKKVTFKWNQLYEAKLKEVEETQQK  597
            +D +W    E+EF  +  ++           + M  K + ++++   ++  K+ EE    
Sbjct  72   SDILWSALVEKEFPDRPLTVRPRKLGGTKGFDSMPMKSLYYRYSDDRDSFRKDAEE----  127

Query  596  SFDRIRDLYKKHDAEKQSRQI  534
               R+R +  +   EK ++ I
Sbjct  128  ---RLRRITHRLKIEKSAKSI  145



>ref|XP_003386815.1| PREDICTED: transcription elongation factor B polypeptide 3-like 
[Amphimedon queenslandica]
Length=329

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 26/130 (20%)
 Frame = -3

Query  1034  RFLNSDLSARWFPAP---------ITVCVSGENRSEHRMRSAVGNRKAPSLVDLCVQVAI  882
             R L+SD   R   AP         I++ +S  +R++     + G +  PSL D+C+ V +
Sbjct  112   RVLSSDAIQRKRKAPVLVADNSDSISMALSKRSRTKVYSGKSTGMKYVPSLFDMCMNVLV  171

Query  881   DHVRYIGDVGATDFHLLERFLPHCTVDQL---------------ALIEKSTQG--RDLSP  753
             +++  I +VG   F +LE  L  CT  QL               +L +K TQ   RD +P
Sbjct  172   NNIEAIYEVGGVPFFILEPVLVKCTPTQLMRLEELNPHFLEDSDSLWQKHTQKLFRDATP  231

Query  752   VTDKIWKQFY  723
                + W+  Y
Sbjct  232   SEGQSWRDLY  241



>gb|EEQ42788.1| conserved hypothetical protein [Candida albicans WO-1]
Length=391

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREF  711
             +DK+W +   ++F
Sbjct  71   YSDKLWMKLILKDF  84



>ref|XP_008384426.1| PREDICTED: uncharacterized protein LOC103447028 [Malus domestica]
 ref|XP_008349648.1| PREDICTED: uncharacterized protein LOC103412919 [Malus domestica]
Length=141

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -3

Query  761  LSPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFDRI  582
            +SPVT+K+W++FY  EFG   A   +E  K     F+W +L EA+++EV++ + K+ +++
Sbjct  1    MSPVTNKLWQKFYMEEFGASRADQAVENTKNANAAFRWKELLEAEVEEVKKNENKAAEKL  60

Query  581  RDLYKKHDAEKQSR  540
            +  Y+     KQSR
Sbjct  61   KSRYQMEADRKQSR  74



>gb|KHC43211.1| hypothetical protein MGQ_00362 [Candida albicans P76067]
Length=391

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREF  711
             +DK+W +   ++F
Sbjct  71   YSDKLWMKLILKDF  84



>gb|KGU36560.1| hypothetical protein MGM_00363 [Candida albicans P75063]
Length=390

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREF  711
             +DK+W +   ++F
Sbjct  71   YSDKLWMKLILKDF  84



>gb|KGR15511.1| hypothetical protein MG5_00364 [Candida albicans P57072]
Length=388

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 66/143 (46%), Gaps = 13/143 (9%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P 
Sbjct  14   NKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLPY  71

Query  749  TDKIW-----KQFYEREFGKKSASLVIERMKQK------KVTFKWNQLYEAKLKEVEETQ  603
            +DK+W     K F +R     SA+    ++ QK       +   +  LY    ++ +E +
Sbjct  72   SDKLWMKLILKDFPDRPPPPPSAATSPIKLNQKHGGGICGLDMPYKSLYYKYCQDRDEFR  131

Query  602  QKSFDRIRDLYKKHDAEKQSRQI  534
            + S  R+R   K  + +K   +I
Sbjct  132  KDSAKRLRHANKSLERQKSKNKI  154



>gb|EPB81267.1| hypothetical protein HMPREF1544_12033 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=273

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 63/146 (43%), Gaps = 27/146 (18%)
 Frame = -3

Query  914  SLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKIW  735
            SLV  C  +   H+  + +VG   + LL+  L H T  QL  IEK+    D++  +D++W
Sbjct  7    SLVASCQDILTKHLDVVSEVGCVPYSLLKNSLVHATPQQLYKIEKA--NPDIAAESDELW  64

Query  734  -----------KQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQQKSFD  588
                       + +Y+    + S               KW +LY  + KE E  +Q    
Sbjct  65   LKHCLTYTDIREDYYQHGLYRDST--------------KWRELYLNRYKETERKRQLIKQ  110

Query  587  RIRDLYKKHDAEKQSRQIKLCTKVPP  510
            +++  Y K   EK+ R IK+   V P
Sbjct  111  KVKSQYSKIQNEKEKRSIKVLHGVVP  136



>gb|KGU33756.1| hypothetical protein MG7_00362 [Candida albicans P34048]
 gb|KGU37589.1| hypothetical protein MGK_00366 [Candida albicans P57055]
 gb|KHC84992.1| hypothetical protein MGS_00385 [Candida albicans P78042]
Length=390

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -3

Query  932  GNRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSP  753
             N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P
Sbjct  13   SNKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLP  70

Query  752  VTDKIWKQFYEREF  711
             +DK+W +   ++F
Sbjct  71   YSDKLWMKLILKDF  84



>ref|XP_008549497.1| PREDICTED: transcription elongation factor B polypeptide 3 isoform 
X1 [Microplitis demolitor]
Length=813

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 19/118 (16%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSL +LC++V I+++  +   G   ++LL+  L   T DQL +IE       L   TD +
Sbjct  613  PSLYELCIRVLIENIEALECTGGVPYYLLKPVLERATADQLFMIEHYNPY--LIEDTDTL  670

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLY-------EAKLKEVEETQQKSFDR  585
            WK    REF          R K+++    W ++Y       EAKLK +    ++S D+
Sbjct  671  WKFHCNREF----------RNKEREEMESWREMYMRCLDEREAKLKTLTANIKQSIDK  718



>gb|KHC40420.1| hypothetical protein MGO_00365 [Candida albicans P76055]
Length=388

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 66/143 (46%), Gaps = 13/143 (9%)
 Frame = -3

Query  929  NRKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPV  750
            N+K PSLVD+ +     H+  I D+G T +HLLE  L      QL  +E +     L P 
Sbjct  14   NKKLPSLVDISLLTIKKHIHSITDIGTTPYHLLEPILQQIPAKQLNELELNCS--QLLPY  71

Query  749  TDKIW-----KQFYEREFGKKSASLVIERMKQK------KVTFKWNQLYEAKLKEVEETQ  603
            +DK+W     K F +R     SA+    ++ QK       +   +  LY    ++ +E +
Sbjct  72   SDKLWMKLILKDFPDRPPPPPSAATSPIKLNQKHGGGICGLDMPYKSLYYKYCQDRDEFR  131

Query  602  QKSFDRIRDLYKKHDAEKQSRQI  534
            + S  R+R   K  + +K   +I
Sbjct  132  KDSAKRLRHANKSLERQKSKNKI  154



>gb|KIL69948.1| hypothetical protein M378DRAFT_719541 [Amanita muscaria Koide 
BX008]
Length=311

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (50%), Gaps = 10/139 (7%)
 Frame = -3

Query  935  VGNRKAPSLVDLCVQVAIDHVRYIGDVGA-TDFHLLERFLPHCTVDQLALIEKSTQGRDL  759
             G R+ PSLV LC +VA+ HV  I ++G+   F L +  L  CT +QL  IE+S+    L
Sbjct  6    TGGRRIPSLVHLCQRVAVAHVDSICNLGSEITFDLAKPILERCTAEQLLRIEESSP--HL  63

Query  758  SPVTDKIWKQFYEREFGKKSASLVIERMKQKKVTFKWNQLYEAKLKEVEETQ--QKSFDR  585
               T  +W       + K +   ++   + ++    W + Y A   EV E +  ++  +R
Sbjct  64   QCETYDLWMVLCSHRYPKLTQRYLLGEEEDQET---WKERYFA--MEVAEARRLEELGNR  118

Query  584  IRDLYKKHDAEKQSRQIKL  528
            +R    + D  K+ R++KL
Sbjct  119  LRSQRAEADERKREREVKL  137



>ref|XP_008549498.1| PREDICTED: transcription elongation factor B polypeptide 3 isoform 
X2 [Microplitis demolitor]
 gb|EZA45083.1| elongin A-like protein [Microplitis demolitor]
Length=785

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 19/118 (16%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            PSL +LC++V I+++  +   G   ++LL+  L   T DQL +IE       L   TD +
Sbjct  585  PSLYELCIRVLIENIEALECTGGVPYYLLKPVLERATADQLFMIEHYNPY--LIEDTDTL  642

Query  737  WKQFYEREFGKKSASLVIERMKQKKVTFKWNQLY-------EAKLKEVEETQQKSFDR  585
            WK    REF          R K+++    W ++Y       EAKLK +    ++S D+
Sbjct  643  WKFHCNREF----------RNKEREEMESWREMYMRCLDEREAKLKTLTANIKQSIDK  690



>ref|XP_002417027.1| conserved hypothetical protein [Candida dubliniensis CD36]
 emb|CAX44615.1| conserved hypothetical protein [Candida dubliniensis CD36]
Length=378

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  926  RKAPSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVT  747
            +K PSLVD+ +     H+  + D+G T +HLLE  L      QL  +E + Q   L P +
Sbjct  15   KKLPSLVDISLLKIKKHIHSLTDIGTTPYHLLEPVLQQIPAKQLNELELNCQ--QLLPYS  72

Query  746  DKIWKQFYEREF  711
            DK+W +  +++F
Sbjct  73   DKLWMKLIQKDF  84



>ref|XP_001898153.1| RNA polymerase II:SUBUNIT=110kD. [Brugia malayi]
Length=421

 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            P+L +LC+++ I ++  I +VG T + LL+  L  C+++QL LIE+  +   L   +D++
Sbjct  215  PTLQNLCIKILIANINSIEEVGDTPYFLLKPVLEKCSLNQLCLIER--RNPQLMEDSDEL  272

Query  737  WKQFYEREFGK  705
            W++   R F K
Sbjct  273  WERIVNRAFPK  283



>emb|CDP96024.1| Protein Bm9930 [Brugia malayi]
Length=461

 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  917  PSLVDLCVQVAIDHVRYIGDVGATDFHLLERFLPHCTVDQLALIEKSTQGRDLSPVTDKI  738
            P+L +LC+++ I ++  I +VG T + LL+  L  C+++QL LIE+  +   L   +D++
Sbjct  255  PTLQNLCIKILIANINSIEEVGDTPYFLLKPVLEKCSLNQLCLIER--RNPQLMEDSDEL  312

Query  737  WKQFYEREFGK  705
            W++   R F K
Sbjct  313  WERIVNRAFPK  323



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3192469809513