BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8547

Length=934
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO52089.1|  hypothetical protein CISIN_1g0107852mg                  207   2e-63   Citrus sinensis [apfelsine]
ref|XP_006469972.1|  PREDICTED: serine/threonine protein phosphat...    212   2e-60   Citrus sinensis [apfelsine]
ref|XP_006447169.1|  hypothetical protein CICLE_v10014898mg             212   3e-60   
ref|XP_009590023.1|  PREDICTED: serine/threonine protein phosphat...    212   4e-60   Nicotiana tomentosiformis
ref|XP_011012347.1|  PREDICTED: serine/threonine protein phosphat...    210   1e-59   Populus euphratica
ref|XP_009772668.1|  PREDICTED: serine/threonine protein phosphat...    210   1e-59   Nicotiana sylvestris
ref|XP_011010241.1|  PREDICTED: serine/threonine protein phosphat...    210   1e-59   Populus euphratica
ref|XP_011097329.1|  PREDICTED: serine/threonine protein phosphat...    209   3e-59   Sesamum indicum [beniseed]
ref|XP_006338659.1|  PREDICTED: serine/threonine protein phosphat...    209   4e-59   Solanum tuberosum [potatoes]
emb|CDP16651.1|  unnamed protein product                                208   6e-59   Coffea canephora [robusta coffee]
ref|XP_002323997.1|  serine/threonine protein phosphatase 2A regu...    208   1e-58   
ref|XP_006357177.1|  PREDICTED: serine/threonine protein phosphat...    207   1e-58   Solanum tuberosum [potatoes]
ref|XP_010660823.1|  PREDICTED: serine/threonine protein phosphat...    207   3e-58   
ref|XP_010250854.1|  PREDICTED: serine/threonine protein phosphat...    207   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009762457.1|  PREDICTED: serine/threonine protein phosphat...    206   3e-58   Nicotiana sylvestris
ref|XP_012071218.1|  PREDICTED: serine/threonine protein phosphat...    206   6e-58   Jatropha curcas
ref|XP_007031732.1|  Serine/threonine protein phosphatase 2A 59 k...    205   1e-57   
ref|XP_010111637.1|  Serine/threonine protein phosphatase 2A 59 k...    204   2e-57   Morus notabilis
ref|XP_009762455.1|  PREDICTED: serine/threonine protein phosphat...    204   2e-57   Nicotiana sylvestris
ref|XP_009625334.1|  PREDICTED: serine/threonine protein phosphat...    204   4e-57   Nicotiana tomentosiformis
ref|XP_010029046.1|  PREDICTED: serine/threonine protein phosphat...    204   4e-57   Eucalyptus grandis [rose gum]
gb|EYU34778.1|  hypothetical protein MIMGU_mgv1a004809mg                202   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_010248839.1|  PREDICTED: serine/threonine protein phosphat...    201   5e-56   Nelumbo nucifera [Indian lotus]
gb|KJB33915.1|  hypothetical protein B456_006G038500                    201   5e-56   Gossypium raimondii
gb|KJB40702.1|  hypothetical protein B456_007G074200                    198   5e-55   Gossypium raimondii
gb|KHG13833.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    196   2e-54   Gossypium arboreum [tree cotton]
ref|XP_008799955.1|  PREDICTED: serine/threonine protein phosphat...    187   4e-54   
ref|XP_004231808.1|  PREDICTED: serine/threonine protein phosphat...    195   5e-54   Solanum lycopersicum
ref|XP_010317069.1|  PREDICTED: serine/threonine protein phosphat...    194   1e-53   Solanum lycopersicum
ref|XP_011098814.1|  PREDICTED: serine/threonine protein phosphat...    194   1e-53   
ref|XP_004138464.2|  PREDICTED: serine/threonine protein phosphat...    193   3e-53   Cucumis sativus [cucumbers]
ref|XP_008378369.1|  PREDICTED: serine/threonine protein phosphat...    184   5e-53   
ref|XP_010682883.1|  PREDICTED: serine/threonine protein phosphat...    192   5e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003555155.1|  PREDICTED: serine/threonine protein phosphat...    192   9e-53   Glycine max [soybeans]
ref|XP_010910784.1|  PREDICTED: serine/threonine protein phosphat...    179   4e-52   
ref|XP_007215087.1|  hypothetical protein PRUPE_ppa004318mg             190   5e-52   Prunus persica
ref|XP_008230444.1|  PREDICTED: serine/threonine protein phosphat...    189   6e-52   Prunus mume [ume]
gb|KJB11612.1|  hypothetical protein B456_001G268200                    186   7e-52   Gossypium raimondii
ref|XP_008797311.1|  PREDICTED: serine/threonine protein phosphat...    189   8e-52   Phoenix dactylifera
ref|XP_012080628.1|  PREDICTED: serine/threonine protein phosphat...    189   1e-51   Jatropha curcas
ref|XP_010025360.1|  PREDICTED: serine/threonine protein phosphat...    189   1e-51   Eucalyptus grandis [rose gum]
ref|XP_004142950.1|  PREDICTED: serine/threonine protein phosphat...    189   1e-51   Cucumis sativus [cucumbers]
ref|XP_006375537.1|  hypothetical protein POPTR_0014s15520g             179   2e-51   
gb|KHG26982.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    188   2e-51   Gossypium arboreum [tree cotton]
ref|XP_011457446.1|  PREDICTED: serine/threonine protein phosphat...    188   2e-51   Fragaria vesca subsp. vesca
ref|XP_006379947.1|  hypothetical protein POPTR_0008s18050g             179   2e-51   
ref|XP_010907764.1|  PREDICTED: serine/threonine protein phosphat...    188   3e-51   Elaeis guineensis
ref|XP_002514975.1|  protein phosphatase 2a, regulatory subunit, ...    188   3e-51   Ricinus communis
gb|KJB11609.1|  hypothetical protein B456_001G268200                    187   3e-51   Gossypium raimondii
ref|XP_008799952.1|  PREDICTED: serine/threonine protein phosphat...    187   3e-51   Phoenix dactylifera
ref|XP_010932304.1|  PREDICTED: serine/threonine protein phosphat...    187   4e-51   Elaeis guineensis
ref|XP_004304704.1|  PREDICTED: serine/threonine protein phosphat...    187   5e-51   Fragaria vesca subsp. vesca
ref|XP_008340161.1|  PREDICTED: serine/threonine protein phosphat...    187   8e-51   
ref|XP_010244149.1|  PREDICTED: serine/threonine protein phosphat...    187   9e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008389801.1|  PREDICTED: serine/threonine protein phosphat...    186   9e-51   
ref|XP_008441374.1|  PREDICTED: serine/threonine protein phosphat...    186   1e-50   Cucumis melo [Oriental melon]
gb|KCW62001.1|  hypothetical protein EUGRSUZ_H04680                     186   1e-50   Eucalyptus grandis [rose gum]
ref|XP_007163719.1|  hypothetical protein PHAVU_001G258400g             186   2e-50   Phaseolus vulgaris [French bean]
ref|XP_011021363.1|  PREDICTED: serine/threonine protein phosphat...    186   2e-50   Populus euphratica
ref|XP_009359296.1|  PREDICTED: serine/threonine protein phosphat...    185   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_007044975.1|  Phosphatase 2A regulatory B subunit family p...    185   3e-50   
ref|XP_002314559.1|  serine/threonine protein phosphatase 2A regu...    185   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006341761.1|  PREDICTED: serine/threonine protein phosphat...    184   5e-50   Solanum tuberosum [potatoes]
ref|XP_009365093.1|  PREDICTED: serine/threonine protein phosphat...    185   6e-50   
ref|XP_008363215.1|  PREDICTED: serine/threonine protein phosphat...    184   6e-50   
ref|XP_008379655.1|  PREDICTED: serine/threonine protein phosphat...    184   7e-50   
ref|XP_012085598.1|  PREDICTED: serine/threonine protein phosphat...    184   1e-49   Jatropha curcas
ref|XP_009780032.1|  PREDICTED: serine/threonine protein phosphat...    183   1e-49   Nicotiana sylvestris
ref|XP_007217254.1|  hypothetical protein PRUPE_ppa003902mg             183   2e-49   Prunus persica
ref|XP_002525315.1|  protein phosphatase 2a, regulatory subunit, ...    183   3e-49   Ricinus communis
gb|EYU44814.1|  hypothetical protein MIMGU_mgv1a004709mg                182   3e-49   Erythranthe guttata [common monkey flower]
ref|XP_004489571.1|  PREDICTED: serine/threonine protein phosphat...    182   3e-49   Cicer arietinum [garbanzo]
ref|XP_008230000.1|  PREDICTED: serine/threonine protein phosphat...    182   5e-49   Prunus mume [ume]
ref|XP_009370310.1|  PREDICTED: serine/threonine protein phosphat...    181   6e-49   
ref|XP_007049146.1|  Phosphatase 2A regulatory B subunit family p...    182   6e-49   
ref|XP_004239176.1|  PREDICTED: serine/threonine protein phosphat...    181   8e-49   Solanum lycopersicum
ref|XP_008444411.1|  PREDICTED: serine/threonine protein phosphat...    181   8e-49   Cucumis melo [Oriental melon]
ref|XP_008795966.1|  PREDICTED: serine/threonine protein phosphat...    181   1e-48   Phoenix dactylifera
ref|XP_009414678.1|  PREDICTED: serine/threonine protein phosphat...    181   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009606776.1|  PREDICTED: serine/threonine protein phosphat...    180   2e-48   Nicotiana tomentosiformis
ref|XP_003601840.1|  Serine/threonine protein phosphatase 2A 59 k...    180   2e-48   Medicago truncatula
ref|XP_009371715.1|  PREDICTED: serine/threonine protein phosphat...    179   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_011042316.1|  PREDICTED: serine/threonine protein phosphat...    180   4e-48   Populus euphratica
ref|XP_010531427.1|  PREDICTED: serine/threonine protein phosphat...    179   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_006852143.1|  PREDICTED: serine/threonine protein phosphat...    179   5e-48   Amborella trichopoda
ref|XP_010044751.1|  PREDICTED: serine/threonine protein phosphat...    179   7e-48   
ref|XP_010927329.1|  PREDICTED: serine/threonine protein phosphat...    179   8e-48   Elaeis guineensis
ref|XP_010252513.1|  PREDICTED: serine/threonine protein phosphat...    179   8e-48   
ref|XP_011086721.1|  PREDICTED: serine/threonine protein phosphat...    178   8e-48   Sesamum indicum [beniseed]
ref|XP_002514974.1|  protein phosphatase 2a, regulatory subunit, ...    179   9e-48   
emb|CBI28848.3|  unnamed protein product                                177   1e-47   Vitis vinifera
emb|CDP13292.1|  unnamed protein product                                177   2e-47   Coffea canephora [robusta coffee]
ref|XP_006447619.1|  hypothetical protein CICLE_v10014856mg             177   2e-47   Citrus clementina [clementine]
ref|XP_009402720.1|  PREDICTED: serine/threonine protein phosphat...    177   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006830091.1|  PREDICTED: serine/threonine protein phosphat...    177   3e-47   Amborella trichopoda
dbj|BAK05777.1|  predicted protein                                      177   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010657226.1|  PREDICTED: serine/threonine protein phosphat...    177   3e-47   Vitis vinifera
ref|XP_011098818.1|  PREDICTED: serine/threonine protein phosphat...    177   4e-47   Sesamum indicum [beniseed]
dbj|BAJ97460.1|  predicted protein                                      176   4e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009411830.1|  PREDICTED: serine/threonine protein phosphat...    176   5e-47   
ref|XP_006438130.1|  hypothetical protein CICLE_v10031228mg             176   5e-47   Citrus clementina [clementine]
ref|XP_009411828.1|  PREDICTED: serine/threonine protein phosphat...    176   5e-47   
ref|XP_006484025.1|  PREDICTED: serine/threonine protein phosphat...    176   6e-47   
ref|XP_007222861.1|  hypothetical protein PRUPE_ppa004258mg             176   6e-47   Prunus persica
ref|XP_006650885.1|  PREDICTED: serine/threonine protein phosphat...    176   9e-47   Oryza brachyantha
emb|CBI27539.3|  unnamed protein product                                174   9e-47   Vitis vinifera
ref|XP_003524485.1|  PREDICTED: serine/threonine protein phosphat...    175   1e-46   Glycine max [soybeans]
ref|XP_009411832.1|  PREDICTED: serine/threonine protein phosphat...    175   1e-46   
gb|KEH25426.1|  protein phosphatase 2A regulatory B subunit famil...    175   2e-46   Medicago truncatula
ref|XP_008379151.1|  PREDICTED: serine/threonine protein phosphat...    175   2e-46   
ref|XP_009412705.1|  PREDICTED: serine/threonine protein phosphat...    174   2e-46   
ref|XP_002266932.1|  PREDICTED: serine/threonine protein phosphat...    175   2e-46   Vitis vinifera
ref|XP_007151564.1|  hypothetical protein PHAVU_004G057400g             175   2e-46   Phaseolus vulgaris [French bean]
emb|CAN66032.1|  hypothetical protein VITISV_019650                     174   3e-46   Vitis vinifera
ref|XP_009412704.1|  PREDICTED: serine/threonine protein phosphat...    174   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047218.1|  PREDICTED: serine/threonine protein phosphat...    174   3e-46   Populus euphratica
ref|XP_008222034.1|  PREDICTED: serine/threonine protein phosphat...    174   3e-46   Prunus mume [ume]
gb|EMT26962.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    174   3e-46   
ref|XP_011470807.1|  PREDICTED: serine/threonine protein phosphat...    174   3e-46   Fragaria vesca subsp. vesca
gb|KJB78043.1|  hypothetical protein B456_012G174400                    174   4e-46   Gossypium raimondii
gb|EMS66139.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    174   6e-46   Triticum urartu
gb|KJB10684.1|  hypothetical protein B456_001G216400                    174   7e-46   Gossypium raimondii
gb|KHG18630.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    174   7e-46   Gossypium arboreum [tree cotton]
ref|XP_007044972.1|  Serine/threonine protein phosphatase 2A 59 k...    173   9e-46   
ref|XP_011029624.1|  PREDICTED: serine/threonine protein phosphat...    172   1e-45   Populus euphratica
ref|XP_010907766.1|  PREDICTED: serine/threonine protein phosphat...    172   1e-45   Elaeis guineensis
ref|XP_010234950.1|  PREDICTED: serine/threonine protein phosphat...    172   2e-45   Brachypodium distachyon [annual false brome]
gb|KHN44403.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    172   2e-45   Glycine soja [wild soybean]
ref|XP_003538573.1|  PREDICTED: serine/threonine protein phosphat...    172   3e-45   Glycine max [soybeans]
ref|XP_002311731.1|  hypothetical protein POPTR_0008s18010g             171   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011021368.1|  PREDICTED: serine/threonine protein phosphat...    170   7e-45   Populus euphratica
ref|NP_001060884.1|  Os08g0122000                                       170   7e-45   
ref|XP_002314558.1|  hypothetical protein POPTR_0010s06450g             170   9e-45   Populus trichocarpa [western balsam poplar]
gb|AAM61625.1|  B regulatory subunit of protein phosphatase 2A, p...    169   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307325.1|  hypothetical protein CARUB_v10008945mg             169   1e-44   Capsella rubella
ref|NP_172803.1|  protein phosphatase 2A B'theta                        169   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458797.1|  PREDICTED: serine/threonine protein phosphat...    169   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_003553878.1|  PREDICTED: serine/threonine protein phosphat...    170   1e-44   Glycine max [soybeans]
gb|KHN30494.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    170   1e-44   Glycine soja [wild soybean]
ref|XP_004310036.1|  PREDICTED: serine/threonine protein phosphat...    170   1e-44   Fragaria vesca subsp. vesca
ref|XP_002890006.1|  hypothetical protein ARALYDRAFT_471504             169   1e-44   
ref|XP_009418105.1|  PREDICTED: serine/threonine protein phosphat...    170   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008222035.1|  PREDICTED: serine/threonine protein phosphat...    169   1e-44   Prunus mume [ume]
ref|XP_008389803.1|  PREDICTED: serine/threonine protein phosphat...    169   2e-44   
gb|KJB31018.1|  hypothetical protein B456_005G172800                    169   2e-44   Gossypium raimondii
ref|XP_008350950.1|  PREDICTED: serine/threonine protein phosphat...    169   2e-44   
ref|XP_009385575.1|  PREDICTED: serine/threonine protein phosphat...    169   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010556177.1|  PREDICTED: serine/threonine protein phosphat...    169   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010476343.1|  PREDICTED: serine/threonine protein phosphat...    169   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010495328.1|  PREDICTED: serine/threonine protein phosphat...    168   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002301608.1|  serine/threonine protein phosphatase 2A regu...    168   3e-44   
gb|EYU44815.1|  hypothetical protein MIMGU_mgv1a005633mg                168   4e-44   Erythranthe guttata [common monkey flower]
ref|XP_007222857.1|  hypothetical protein PRUPE_ppa004253mg             168   4e-44   Prunus persica
ref|XP_006386782.1|  hypothetical protein POPTR_0002s21550g             169   4e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004502334.1|  PREDICTED: serine/threonine protein phosphat...    168   7e-44   
ref|XP_004243528.1|  PREDICTED: serine/threonine protein phosphat...    168   8e-44   Solanum lycopersicum
ref|NP_001051871.1|  Os03g0844500                                       167   1e-43   
ref|XP_011005899.1|  PREDICTED: serine/threonine protein phosphat...    167   2e-43   Populus euphratica
gb|EEC82836.1|  hypothetical protein OsI_27645                          167   2e-43   Oryza sativa Indica Group [Indian rice]
gb|AAM10385.1|  AT4g15410/dl3750w                                       167   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567464.1|  protein phosphatase 2A B'gamma                        167   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009152091.1|  PREDICTED: serine/threonine protein phosphat...    166   2e-43   
ref|XP_008649345.1|  PREDICTED: protein phosphatase 2A regulatory...    166   2e-43   
ref|XP_011029625.1|  PREDICTED: serine/threonine protein phosphat...    166   2e-43   Populus euphratica
ref|NP_001105904.1|  protein phosphatase 2A regulatory subunit B'       166   2e-43   
ref|XP_010554220.1|  PREDICTED: serine/threonine protein phosphat...    166   3e-43   Tarenaya hassleriana [spider flower]
gb|EYU22561.1|  hypothetical protein MIMGU_mgv1a007292mg                164   3e-43   Erythranthe guttata [common monkey flower]
ref|XP_010089442.1|  Serine/threonine protein phosphatase 2A 59 k...    166   3e-43   Morus notabilis
ref|XP_006283548.1|  hypothetical protein CARUB_v10004601mg             166   3e-43   Capsella rubella
gb|KJB42861.1|  hypothetical protein B456_007G171000                    165   5e-43   Gossypium raimondii
ref|XP_010100283.1|  Serine/threonine protein phosphatase 2A 59 k...    165   6e-43   Morus notabilis
ref|XP_006395602.1|  hypothetical protein EUTSA_v10004020mg             165   7e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010551033.1|  PREDICTED: serine/threonine protein phosphat...    165   1e-42   
emb|CDY13605.1|  BnaA06g33180D                                          164   1e-42   Brassica napus [oilseed rape]
emb|CDX83578.1|  BnaC07g23180D                                          164   1e-42   
ref|XP_004502031.1|  PREDICTED: serine/threonine protein phosphat...    164   1e-42   Cicer arietinum [garbanzo]
gb|KHN38476.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    164   2e-42   Glycine soja [wild soybean]
ref|NP_189231.1|  protein phosphatase 2A regulatory subunit B' eta      164   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006357949.1|  PREDICTED: serine/threonine protein phosphat...    164   2e-42   Solanum tuberosum [potatoes]
emb|CAB10320.1|  phosphatase like protein                               167   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012085600.1|  PREDICTED: serine/threonine protein phosphat...    163   2e-42   Jatropha curcas
ref|XP_006414514.1|  hypothetical protein EUTSA_v10024939mg             163   3e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009129571.1|  PREDICTED: serine/threonine protein phosphat...    163   3e-42   Brassica rapa
ref|XP_006657611.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    163   3e-42   
ref|XP_006293086.1|  hypothetical protein CARUB_v10019373mg             163   3e-42   Capsella rubella
ref|XP_003545564.1|  PREDICTED: serine/threonine protein phosphat...    163   4e-42   Glycine max [soybeans]
gb|KHM99097.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    163   5e-42   Glycine soja [wild soybean]
gb|KHF99622.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    163   5e-42   Gossypium arboreum [tree cotton]
ref|XP_002875297.1|  hypothetical protein ARALYDRAFT_904782             162   5e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_002870241.1|  hypothetical protein ARALYDRAFT_329973             166   5e-42   
gb|EMT15241.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    162   6e-42   
ref|NP_001154647.1|  protein phosphatase 2A regulatory subunit B'...    162   6e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22925.1|  BnaA01g18630D                                          162   7e-42   Brassica napus [oilseed rape]
ref|XP_003519459.1|  PREDICTED: serine/threonine protein phosphat...    162   7e-42   Glycine max [soybeans]
ref|NP_001154648.1|  protein phosphatase 2A regulatory subunit B'...    162   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601378.1|  Serine/threonine protein phosphatase 2A 59 k...    162   7e-42   Medicago truncatula
ref|XP_010548887.1|  PREDICTED: serine/threonine protein phosphat...    162   8e-42   Tarenaya hassleriana [spider flower]
ref|NP_001059361.1|  Os07g0274800                                       162   9e-42   
ref|XP_006417120.1|  hypothetical protein EUTSA_v10007450mg             161   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_010425263.1|  PREDICTED: serine/threonine protein phosphat...    161   1e-41   Camelina sativa [gold-of-pleasure]
emb|CDY48287.1|  BnaC01g31410D                                          161   1e-41   Brassica napus [oilseed rape]
ref|XP_010537569.1|  PREDICTED: serine/threonine protein phosphat...    161   1e-41   Tarenaya hassleriana [spider flower]
emb|CDY40986.1|  BnaA02g27760D                                          164   1e-41   Brassica napus [oilseed rape]
ref|XP_004972977.1|  PREDICTED: serine/threonine protein phosphat...    161   2e-41   Setaria italica
ref|XP_006406248.1|  hypothetical protein EUTSA_v10020525mg             161   2e-41   Eutrema salsugineum [saltwater cress]
gb|EPS71994.1|  hypothetical protein M569_02763                         159   2e-41   Genlisea aurea
ref|XP_009786927.1|  PREDICTED: serine/threonine protein phosphat...    161   3e-41   Nicotiana sylvestris
ref|XP_010449943.1|  PREDICTED: serine/threonine protein phosphat...    160   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010440315.1|  PREDICTED: serine/threonine protein phosphat...    160   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010440316.1|  PREDICTED: serine/threonine protein phosphat...    160   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004976008.1|  PREDICTED: serine/threonine protein phosphat...    160   3e-41   Setaria italica
ref|XP_010100284.1|  Serine/threonine protein phosphatase 2A 59 k...    160   3e-41   
ref|XP_010434994.1|  PREDICTED: serine/threonine protein phosphat...    160   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002459695.1|  hypothetical protein SORBIDRAFT_02g008950          160   3e-41   Sorghum bicolor [broomcorn]
emb|CAC09487.2|  H0811E11.3                                             160   4e-41   Oryza sativa [red rice]
ref|NP_001053130.1|  Os04g0485100                                       160   4e-41   
ref|XP_009147392.1|  PREDICTED: serine/threonine protein phosphat...    159   5e-41   Brassica rapa
gb|EMT31243.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    160   5e-41   
gb|EMS53921.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    159   8e-41   Triticum urartu
emb|CDX98102.1|  BnaA06g08530D                                          159   8e-41   
ref|XP_009148646.1|  PREDICTED: serine/threonine protein phosphat...    159   1e-40   Brassica rapa
emb|CDY30030.1|  BnaC05g09900D                                          159   1e-40   Brassica napus [oilseed rape]
ref|XP_007141624.1|  hypothetical protein PHAVU_008G211700g             159   1e-40   Phaseolus vulgaris [French bean]
ref|XP_008340163.1|  PREDICTED: serine/threonine protein phosphat...    159   1e-40   
ref|XP_003580003.1|  PREDICTED: serine/threonine protein phosphat...    159   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_009620794.1|  PREDICTED: serine/threonine protein phosphat...    159   2e-40   Nicotiana tomentosiformis
ref|XP_011071183.1|  PREDICTED: serine/threonine protein phosphat...    158   2e-40   Sesamum indicum [beniseed]
ref|XP_006659077.1|  PREDICTED: serine/threonine protein phosphat...    158   2e-40   Oryza brachyantha
gb|AHE76186.1|  protein phosphatase 2a                                  157   5e-40   Chrysanthemum indicum
ref|XP_010514232.1|  PREDICTED: serine/threonine protein phosphat...    157   6e-40   
gb|KDO82045.1|  hypothetical protein CISIN_1g010504mg                   157   6e-40   Citrus sinensis [apfelsine]
ref|XP_006438131.1|  hypothetical protein CICLE_v10031285mg             157   6e-40   Citrus clementina [clementine]
ref|XP_010514230.1|  PREDICTED: serine/threonine protein phosphat...    157   6e-40   
ref|XP_009359306.1|  PREDICTED: serine/threonine protein phosphat...    157   6e-40   Pyrus x bretschneideri [bai li]
gb|AFW58632.1|  hypothetical protein ZEAMMB73_760675                    156   7e-40   
ref|XP_004981072.1|  PREDICTED: serine/threonine protein phosphat...    156   8e-40   Setaria italica
ref|NP_001183245.1|  hypothetical protein                               156   8e-40   Zea mays [maize]
ref|XP_002885457.1|  protein phosphatase 2A B                           157   8e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_003551893.1|  PREDICTED: serine/threonine protein phosphat...    156   1e-39   Glycine max [soybeans]
ref|XP_003573322.1|  PREDICTED: serine/threonine protein phosphat...    156   1e-39   Brachypodium distachyon [annual false brome]
ref|NP_001169040.1|  hypothetical protein                               156   1e-39   Zea mays [maize]
emb|CDY09766.1|  BnaC07g32950D                                          155   1e-39   Brassica napus [oilseed rape]
tpg|DAA39803.1|  TPA: hypothetical protein ZEAMMB73_878468              155   2e-39   
emb|CDY44320.1|  BnaC05g30730D                                          155   2e-39   Brassica napus [oilseed rape]
ref|XP_010228176.1|  PREDICTED: serine/threonine protein phosphat...    155   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_002444972.1|  hypothetical protein SORBIDRAFT_07g002150          155   2e-39   Sorghum bicolor [broomcorn]
ref|XP_009145466.1|  PREDICTED: serine/threonine protein phosphat...    155   3e-39   Brassica rapa
emb|CDX90593.1|  BnaA03g41880D                                          154   3e-39   
ref|XP_010502490.1|  PREDICTED: serine/threonine protein phosphat...    154   4e-39   Camelina sativa [gold-of-pleasure]
dbj|BAB02360.1|  protein phosphatase 2A B' regulatory subunit           154   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43061.1|  unknown                                                 152   4e-39   Lotus japonicus
gb|EYU25948.1|  hypothetical protein MIMGU_mgv1a007752mg                152   4e-39   Erythranthe guttata [common monkey flower]
emb|CDX99733.1|  BnaC02g35870D                                          157   4e-39   
emb|CDY38628.1|  BnaA05g19590D                                          154   5e-39   Brassica napus [oilseed rape]
ref|NP_188802.1|  protein phosphatase 2A B'zeta                         154   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466418.1|  PREDICTED: serine/threonine protein phosphat...    154   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006652431.1|  PREDICTED: serine/threonine protein phosphat...    153   9e-39   Oryza brachyantha
ref|XP_008669249.1|  PREDICTED: serine/threonine protein phosphat...    153   1e-38   Zea mays [maize]
ref|XP_002466111.1|  hypothetical protein SORBIDRAFT_01g001550          153   2e-38   
gb|AGT16585.1|  hypothetical protein SHCRBa_109_M04_F_40                152   2e-38   Saccharum hybrid cultivar R570
ref|XP_002970708.1|  hypothetical protein SELMODRAFT_171686             152   2e-38   
gb|EYU34040.1|  hypothetical protein MIMGU_mgv1a004567mg                152   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_009137092.1|  PREDICTED: serine/threonine protein phosphat...    155   4e-38   Brassica rapa
ref|XP_010488186.1|  PREDICTED: serine/threonine protein phosphat...    152   5e-38   
ref|XP_010510456.1|  PREDICTED: serine/threonine protein phosphat...    152   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002969377.1|  hypothetical protein SELMODRAFT_267276             150   6e-38   
ref|XP_006428449.1|  hypothetical protein CICLE_v10013819mg             138   1e-36   
ref|XP_004955943.1|  PREDICTED: serine/threonine protein phosphat...    147   1e-36   Setaria italica
ref|XP_001768015.1|  predicted protein                                  146   3e-36   
gb|EPS59388.1|  hypothetical protein M569_15419                         145   5e-36   Genlisea aurea
ref|XP_001758786.1|  predicted protein                                  144   1e-35   
ref|XP_010682885.1|  PREDICTED: serine/threonine protein phosphat...    142   6e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001767940.1|  predicted protein                                  142   7e-35   
ref|XP_010514233.1|  PREDICTED: serine/threonine protein phosphat...    137   8e-35   
ref|XP_006371724.1|  hypothetical protein POPTR_0018s01130g             133   2e-34   
ref|XP_006297394.1|  hypothetical protein CARUB_v10013418mg             141   2e-34   Capsella rubella
ref|XP_001774044.1|  predicted protein                                  141   2e-34   
ref|XP_012082448.1|  PREDICTED: serine/threonine protein phosphat...    141   2e-34   
gb|KDO40519.1|  hypothetical protein CISIN_1g011191mg                   141   2e-34   Citrus sinensis [apfelsine]
ref|XP_004982170.1|  PREDICTED: serine/threonine protein phosphat...    141   2e-34   
ref|XP_006491669.1|  PREDICTED: serine/threonine protein phosphat...    141   2e-34   
ref|NP_001146864.1|  LOC100280472                                       141   2e-34   
ref|XP_007221123.1|  hypothetical protein PRUPE_ppa018321mg             132   3e-34   
ref|NP_189232.1|  serine/threonine protein phosphatase 2A B'55 delta    140   3e-34   
ref|XP_006290405.1|  hypothetical protein CARUB_v10018772mg             140   3e-34   
emb|CBI31412.3|  unnamed protein product                                132   6e-34   
ref|XP_006651691.1|  PREDICTED: serine/threonine protein phosphat...    139   6e-34   
ref|XP_012078625.1|  PREDICTED: serine/threonine protein phosphat...    139   7e-34   
gb|KFK33546.1|  hypothetical protein AALP_AA5G027700                    139   8e-34   
ref|XP_008648421.1|  PREDICTED: serine/threonine protein phosphat...    139   8e-34   
ref|XP_008643625.1|  PREDICTED: transposon protein isoform X1           139   9e-34   
emb|CAN61918.1|  hypothetical protein VITISV_026308                     131   9e-34   
ref|XP_002519463.1|  protein phosphatase 2a, regulatory subunit, ...    139   1e-33   
ref|XP_006395601.1|  hypothetical protein EUTSA_v10004128mg             139   1e-33   
ref|XP_010254226.1|  PREDICTED: serine/threonine protein phosphat...    139   1e-33   
ref|XP_002965046.1|  hypothetical protein SELMODRAFT_167051             139   1e-33   
ref|XP_001766428.1|  predicted protein                                  138   2e-33   
ref|XP_006368169.1|  hypothetical protein POPTR_0001s00210g             133   2e-33   
ref|XP_002875298.1|  hypothetical protein ARALYDRAFT_484365             138   2e-33   
ref|XP_010502492.1|  PREDICTED: serine/threonine protein phosphat...    138   2e-33   
gb|KEH24045.1|  protein phosphatase 2A regulatory B subunit famil...    130   3e-33   
ref|XP_006604586.1|  PREDICTED: serine/threonine protein phosphat...    137   4e-33   
emb|CBI20930.3|  unnamed protein product                                130   4e-33   
gb|KHN02304.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    135   4e-33   
ref|XP_002962142.1|  hypothetical protein SELMODRAFT_63731              136   5e-33   
ref|NP_001148001.1|  transposon protein                                 137   6e-33   
ref|XP_010425266.1|  PREDICTED: serine/threonine protein phosphat...    137   6e-33   
ref|XP_003561297.1|  PREDICTED: serine/threonine protein phosphat...    137   7e-33   
ref|XP_009409882.1|  PREDICTED: serine/threonine protein phosphat...    136   7e-33   
gb|KHG04678.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    136   8e-33   
ref|XP_011026522.1|  PREDICTED: serine/threonine protein phosphat...    136   9e-33   
ref|XP_003553562.1|  PREDICTED: serine/threonine protein phosphat...    136   1e-32   
emb|CDP15283.1|  unnamed protein product                                130   1e-32   
ref|XP_007027455.1|  Phosphatase 2A regulatory B subunit family p...    136   1e-32   
gb|EPS70490.1|  protein phosphatase 2a                                  136   1e-32   
ref|XP_010543448.1|  PREDICTED: serine/threonine protein phosphat...    136   1e-32   
gb|KJB36483.1|  hypothetical protein B456_006G161400                    135   1e-32   
ref|XP_008811587.1|  PREDICTED: serine/threonine protein phosphat...    135   2e-32   
ref|XP_010696300.1|  PREDICTED: serine/threonine protein phosphat...    135   2e-32   
ref|XP_006297503.1|  hypothetical protein CARUB_v10013525mg             135   2e-32   
ref|XP_010935325.1|  PREDICTED: serine/threonine protein phosphat...    135   2e-32   
ref|XP_010100285.1|  Serine/threonine protein phosphatase 2A 59 k...    134   3e-32   
dbj|BAK04196.1|  predicted protein                                      135   3e-32   
ref|XP_006838709.1|  PREDICTED: serine/threonine protein phosphat...    134   4e-32   
emb|CDY05497.1|  BnaA02g31940D                                          134   4e-32   
ref|XP_004961286.1|  PREDICTED: serine/threonine protein phosphat...    134   4e-32   
emb|CDY13606.1|  BnaA06g33170D                                          134   4e-32   
gb|EEC75941.1|  hypothetical protein OsI_13037                          130   4e-32   
ref|XP_010925297.1|  PREDICTED: serine/threonine protein phosphat...    134   4e-32   
ref|XP_009152089.1|  PREDICTED: serine/threonine protein phosphat...    134   4e-32   
ref|XP_008785874.1|  PREDICTED: serine/threonine protein phosphat...    134   5e-32   
ref|XP_008785883.1|  PREDICTED: serine/threonine protein phosphat...    134   5e-32   
ref|XP_001782778.1|  predicted protein                                  134   6e-32   
ref|XP_008813321.1|  PREDICTED: serine/threonine protein phosphat...    134   6e-32   
emb|CDY54903.1|  BnaC02g48620D                                          134   6e-32   
gb|KHG26884.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    134   6e-32   
ref|XP_009389489.1|  PREDICTED: serine/threonine protein phosphat...    134   6e-32   
ref|XP_011018792.1|  PREDICTED: serine/threonine protein phosphat...    134   7e-32   
gb|KHG25533.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    134   8e-32   
ref|XP_009129570.1|  PREDICTED: serine/threonine protein phosphat...    133   9e-32   
ref|XP_006381385.1|  hypothetical protein POPTR_0006s12420g             133   9e-32   
gb|AFW74402.1|  hypothetical protein ZEAMMB73_323247                    134   9e-32   
ref|XP_006382064.1|  hypothetical protein POPTR_0006s26330g             126   9e-32   
ref|XP_011468144.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    133   9e-32   
ref|XP_009407773.1|  PREDICTED: serine/threonine protein phosphat...    133   1e-31   
gb|KJB62361.1|  hypothetical protein B456_009G413800                    133   1e-31   
ref|XP_009146889.1|  PREDICTED: serine/threonine protein phosphat...    133   1e-31   
ref|XP_002323499.1|  serine/threonine protein phosphatase 2A regu...    133   1e-31   
ref|XP_010486565.1|  PREDICTED: serine/threonine protein phosphat...    133   1e-31   
emb|CDY54611.1|  BnaA05g28660D                                          133   1e-31   
ref|XP_008233254.1|  PREDICTED: serine/threonine protein phosphat...    132   1e-31   
gb|KCW48799.1|  hypothetical protein EUGRSUZ_K02441                     133   1e-31   
ref|XP_010037138.1|  PREDICTED: serine/threonine protein phosphat...    133   1e-31   
gb|EEE64635.1|  hypothetical protein OsJ_19488                          125   1e-31   
ref|XP_004497127.1|  PREDICTED: serine/threonine protein phosphat...    132   1e-31   
ref|XP_004494078.1|  PREDICTED: serine/threonine protein phosphat...    132   2e-31   
gb|KEH44274.1|  protein phosphatase 2A regulatory B subunit famil...    132   2e-31   
emb|CBI30157.3|  unnamed protein product                                127   2e-31   
ref|XP_002268726.1|  PREDICTED: serine/threonine protein phosphat...    132   2e-31   
gb|EYU38570.1|  hypothetical protein MIMGU_mgv1a005237mg                132   2e-31   
emb|CDX83579.1|  BnaC07g23190D                                          132   2e-31   
ref|XP_001766093.1|  predicted protein                                  132   2e-31   
ref|NP_187599.1|  serine/threonine protein phosphatase 2A regulat...    132   2e-31   
emb|CAB76153.1|  putative B' regulatory subunit of PP2A                 125   2e-31   
ref|XP_008462494.1|  PREDICTED: serine/threonine protein phosphat...    132   2e-31   
ref|XP_009377048.1|  PREDICTED: serine/threonine protein phosphat...    132   2e-31   
emb|CDY07942.1|  BnaC03g35810D                                          132   2e-31   
ref|XP_003521415.1|  PREDICTED: serine/threonine protein phosphat...    132   2e-31   
ref|XP_004143280.1|  PREDICTED: serine/threonine protein phosphat...    132   3e-31   
ref|XP_008809266.1|  PREDICTED: serine/threonine protein phosphat...    132   3e-31   
ref|XP_006407628.1|  hypothetical protein EUTSA_v10020593mg             132   3e-31   
ref|NP_001050908.2|  Os03g0681800                                       129   3e-31   
emb|CDY41574.1|  BnaC05g43110D                                          132   3e-31   
ref|XP_011006622.1|  PREDICTED: serine/threonine protein phosphat...    131   4e-31   
ref|XP_006287577.1|  hypothetical protein CARUB_v10000786mg             131   4e-31   
ref|XP_002973626.1|  hypothetical protein SELMODRAFT_149261             131   5e-31   
ref|XP_010493808.1|  PREDICTED: serine/threonine protein phosphat...    130   7e-31   
ref|XP_009129957.1|  PREDICTED: serine/threonine protein phosphat...    130   7e-31   
gb|KHN39022.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    129   8e-31   
ref|XP_002284526.1|  PREDICTED: serine/threonine protein phosphat...    130   8e-31   
gb|EMS45446.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    125   9e-31   
gb|AAP68376.1|  putative protein phosphatase 2A regulatory subuni...    130   9e-31   
ref|XP_008343496.1|  PREDICTED: serine/threonine protein phosphat...    125   1e-30   
ref|XP_010421407.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
ref|XP_009368942.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
ref|XP_010478286.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
gb|KHN48243.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    129   1e-30   
emb|CDX73997.1|  BnaA03g30500D                                          130   1e-30   
ref|XP_010464647.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
ref|XP_010098803.1|  Serine/threonine protein phosphatase 2A 57 k...    130   1e-30   
ref|XP_009135039.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
ref|XP_011094501.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
ref|XP_003535186.1|  PREDICTED: serine/threonine protein phosphat...    130   1e-30   
gb|EYU32426.1|  hypothetical protein MIMGU_mgv1a005619mg                129   2e-30   
ref|XP_002882642.1|  hypothetical protein ARALYDRAFT_478311             130   2e-30   
ref|XP_002440213.1|  hypothetical protein SORBIDRAFT_09g027870          129   2e-30   
ref|XP_003542561.1|  PREDICTED: serine/threonine protein phosphat...    129   2e-30   
ref|XP_009792362.1|  PREDICTED: serine/threonine protein phosphat...    129   2e-30   
gb|KFK38377.1|  hypothetical protein AALP_AA3G106000                    129   2e-30   
ref|NP_197933.1|  protein phosphatase 2A regulatory B subunit           129   3e-30   
ref|XP_010103508.1|  Serine/threonine protein phosphatase 2A 57 k...    129   3e-30   
ref|XP_007201959.1|  hypothetical protein PRUPE_ppa004682mg             129   3e-30   
ref|XP_008241387.1|  PREDICTED: serine/threonine protein phosphat...    129   3e-30   
emb|CDP11329.1|  unnamed protein product                                129   3e-30   
ref|XP_008387532.1|  PREDICTED: serine/threonine protein phosphat...    129   4e-30   
ref|XP_002516615.1|  protein phosphatase 2a, regulatory subunit, ...    129   4e-30   
gb|KCW80466.1|  hypothetical protein EUGRSUZ_C018112                    121   4e-30   
ref|XP_010670759.1|  PREDICTED: serine/threonine protein phosphat...    128   4e-30   
gb|ACN30940.1|  unknown                                                 128   5e-30   
ref|XP_004246610.1|  PREDICTED: serine/threonine protein phosphat...    128   5e-30   
gb|EYU39647.1|  hypothetical protein MIMGU_mgv1a005452mg                128   6e-30   
ref|XP_010913433.1|  PREDICTED: serine/threonine protein phosphat...    128   6e-30   
ref|XP_008647861.1|  PREDICTED: transposon protein isoform X1           128   6e-30   
ref|XP_002268629.1|  PREDICTED: serine/threonine protein phosphat...    128   6e-30   
ref|XP_010541630.1|  PREDICTED: serine/threonine protein phosphat...    128   7e-30   
ref|XP_009625008.1|  PREDICTED: serine/threonine protein phosphat...    128   7e-30   
emb|CDX80521.1|  BnaC07g29230D                                          128   7e-30   
ref|XP_011019731.1|  PREDICTED: serine/threonine protein phosphat...    128   7e-30   
ref|XP_009151080.1|  PREDICTED: serine/threonine protein phosphat...    128   8e-30   
gb|KFK27832.1|  hypothetical protein AALP_AA8G435800                    127   9e-30   
ref|XP_010249885.1|  PREDICTED: serine/threonine protein phosphat...    127   9e-30   
ref|XP_002973366.1|  hypothetical protein SELMODRAFT_99313              127   9e-30   
ref|XP_002874266.1|  hypothetical protein ARALYDRAFT_489409             127   1e-29   
ref|XP_002976536.1|  hypothetical protein SELMODRAFT_232803             127   1e-29   
ref|XP_006654758.1|  PREDICTED: serine/threonine protein phosphat...    127   1e-29   
gb|KEH42162.1|  protein phosphatase 2A regulatory B subunit famil...    127   1e-29   
ref|XP_003522642.1|  PREDICTED: serine/threonine protein phosphat...    127   2e-29   
gb|KJB07811.1|  hypothetical protein B456_001G045700                    127   2e-29   
ref|NP_191053.1|  protein phosphatase 2A B'epsilon                      126   2e-29   
ref|XP_003603467.1|  Serine/threonine protein phosphatase 2A 57 k...    126   2e-29   
gb|KHG19967.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    126   2e-29   
ref|XP_006394804.1|  hypothetical protein EUTSA_v10004060mg             126   2e-29   
emb|CDY56962.1|  BnaA09g55040D                                          126   2e-29   
ref|XP_007144376.1|  hypothetical protein PHAVU_007G151100g             126   2e-29   
emb|CDX88186.1|  BnaA06g27770D                                          126   2e-29   
emb|CAC85920.1|  protein phosphatase 2A B'kappa subunit                 126   2e-29   
ref|XP_010243212.1|  PREDICTED: serine/threonine protein phosphat...    126   2e-29   
ref|XP_007137075.1|  hypothetical protein PHAVU_009G097600g             126   3e-29   
ref|XP_010940226.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    126   3e-29   
ref|XP_003567932.1|  PREDICTED: serine/threonine protein phosphat...    126   3e-29   
ref|XP_010048263.1|  PREDICTED: serine/threonine protein phosphat...    126   3e-29   
ref|XP_004515912.1|  PREDICTED: serine/threonine protein phosphat...    126   3e-29   
emb|CDX73425.1|  BnaC08g25780D                                          126   4e-29   
ref|XP_003526435.1|  PREDICTED: serine/threonine protein phosphat...    125   4e-29   
ref|XP_006403514.1|  hypothetical protein EUTSA_v10010320mg             125   5e-29   
ref|XP_006290980.1|  hypothetical protein CARUB_v10017093mg             125   5e-29   
ref|XP_011077307.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    125   5e-29   
ref|XP_006354383.1|  PREDICTED: serine/threonine protein phosphat...    125   5e-29   
emb|CDY07514.1|  BnaC06g15500D                                          125   5e-29   
ref|XP_006589705.1|  PREDICTED: serine/threonine protein phosphat...    125   6e-29   
gb|KHN05593.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    125   8e-29   
ref|XP_004292963.1|  PREDICTED: serine/threonine protein phosphat...    125   1e-28   
ref|XP_002878006.1|  hypothetical protein ARALYDRAFT_906907             124   1e-28   
ref|XP_008242686.1|  PREDICTED: serine/threonine protein phosphat...    124   1e-28   
ref|XP_008812431.1|  PREDICTED: serine/threonine protein phosphat...    124   1e-28   
ref|XP_007162788.1|  hypothetical protein PHAVU_001G180600g             124   1e-28   
gb|EAY98962.1|  hypothetical protein OsI_20919                          124   2e-28   
ref|NP_001146050.1|  uncharacterized protein LOC100279581               124   2e-28   
ref|XP_003588682.1|  Serine/threonine protein phosphatase 2A 57 k...    124   2e-28   
gb|AFW81037.1|  hypothetical protein ZEAMMB73_275381                    124   2e-28   
ref|XP_006643825.1|  PREDICTED: serine/threonine protein phosphat...    124   2e-28   
gb|EMT11476.1|  hypothetical protein F775_43033                         124   2e-28   
ref|NP_001148974.1|  transposon protein                                 124   2e-28   
ref|XP_010554167.1|  PREDICTED: serine/threonine protein phosphat...    124   2e-28   
ref|XP_004138753.1|  PREDICTED: serine/threonine protein phosphat...    124   2e-28   
ref|XP_006299096.1|  hypothetical protein CARUB_v10015234mg             123   2e-28   
ref|XP_006436521.1|  hypothetical protein CICLE_v10033481mg             123   2e-28   
ref|XP_010656380.1|  PREDICTED: serine/threonine protein phosphat...    124   3e-28   
emb|CDX67616.1|  BnaA07g16560D                                          123   3e-28   
gb|KJB83138.1|  hypothetical protein B456_013G231300                    123   3e-28   
ref|XP_007204385.1|  hypothetical protein PRUPE_ppa004572mg             123   3e-28   
ref|XP_007013747.1|  Phosphatase 2A regulatory B subunit family p...    123   4e-28   
gb|EMS60469.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    122   4e-28   
ref|XP_009371422.1|  PREDICTED: serine/threonine protein phosphat...    123   4e-28   
ref|XP_009116189.1|  PREDICTED: serine/threonine protein phosphat...    122   4e-28   
ref|XP_006841877.1|  PREDICTED: serine/threonine protein phosphat...    122   4e-28   
gb|KHN03104.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    122   5e-28   
ref|XP_003544625.1|  PREDICTED: serine/threonine protein phosphat...    122   5e-28   
ref|XP_009117687.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    120   5e-28   
ref|XP_010534418.1|  PREDICTED: serine/threonine protein phosphat...    122   6e-28   
dbj|BAK03510.1|  predicted protein                                      122   7e-28   
ref|XP_009103943.1|  PREDICTED: serine/threonine protein phosphat...    122   7e-28   
ref|XP_007223260.1|  hypothetical protein PRUPE_ppa004440mg             122   8e-28   
ref|XP_004287389.1|  PREDICTED: serine/threonine protein phosphat...    122   8e-28   
ref|XP_008369010.1|  PREDICTED: serine/threonine protein phosphat...    122   9e-28   
ref|XP_009629305.1|  PREDICTED: serine/threonine protein phosphat...    121   1e-27   
ref|XP_007013280.1|  Serine/threonine protein phosphatase 2A 57 k...    122   1e-27   
ref|XP_002455079.1|  hypothetical protein SORBIDRAFT_03g003950          121   1e-27   
gb|KHG10267.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    121   1e-27   
ref|XP_004249476.1|  PREDICTED: serine/threonine protein phosphat...    121   1e-27   
ref|XP_007013281.1|  Serine/threonine protein phosphatase 2A 57 k...    121   1e-27   
ref|XP_008386225.1|  PREDICTED: serine/threonine protein phosphat...    121   1e-27   
ref|XP_006476191.1|  PREDICTED: serine/threonine protein phosphat...    121   1e-27   
ref|XP_006450560.1|  hypothetical protein CICLE_v10008015mg             121   1e-27   
ref|XP_006476190.1|  PREDICTED: serine/threonine protein phosphat...    121   1e-27   
ref|NP_001146165.1|  hypothetical protein                               121   2e-27   
ref|XP_006287591.1|  hypothetical protein CARUB_v10000801mg             121   2e-27   
ref|XP_010423705.1|  PREDICTED: serine/threonine protein phosphat...    121   2e-27   
emb|CDX87083.1|  BnaC09g03980D                                          120   2e-27   
ref|XP_011084269.1|  PREDICTED: serine/threonine protein phosphat...    121   2e-27   



>gb|KDO52089.1| hypothetical protein CISIN_1g0107852mg, partial [Citrus sinensis]
Length=119

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  753  VAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSDID  574
            VAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSDID
Sbjct  1    VAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARKHWNQAVQSLTLNVRKIFSDID  60

Query  573  AELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATSG  397
             ELFEECL KFQEDE++E+EIKMKREATWKRLEEIA +KAASNEPVL+S + A R  +G
Sbjct  61   PELFEECLLKFQEDEAKEEEIKMKREATWKRLEEIAAMKAASNEPVLISPKTATRPRTG  119



>ref|XP_006469972.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Citrus sinensis]
Length=501

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  381  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARKHWNQAVQSLTLNVRKIFSD  440

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE++E+EIKMKREATWKRLEEIA +KAASNEPVL+S + A R  +
Sbjct  441  IDPELFEECLLKFQEDEAKEEEIKMKREATWKRLEEIAAMKAASNEPVLISPKTATRPRT  500

Query  399  G  397
            G
Sbjct  501  G  501



>ref|XP_006447169.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006447170.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006469971.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Citrus sinensis]
 gb|ESR60409.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 gb|ESR60410.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
Length=524

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARKHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE++E+EIKMKREATWKRLEEIA +KAASNEPVL+S + A R  +
Sbjct  464  IDPELFEECLLKFQEDEAKEEEIKMKREATWKRLEEIAAMKAASNEPVLISPKTATRPRT  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_009590023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590024.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590025.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590026.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=524

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+E+LIKQNRKVILPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHVESLIKQNRKVILPIIFPSLEKNARGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECLHKF+ED++ E+EIKMKRE TW+RLEE+AG+KAASNEPVLVS R  P + S
Sbjct  464  VDPELFEECLHKFEEDQANEEEIKMKRETTWRRLEELAGMKAASNEPVLVSPRTKPHSPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_011012347.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011012348.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=524

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 6/141 (4%)
 Frame = -2

Query  816  ITLVCHL-SLFCSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSR  640
            + L CH+    CS H+     QVAERALFLWNNDHIENLIKQNR+VILPIIFPALE+N+R
Sbjct  389  VPLFCHIRCCLCSLHF-----QVAERALFLWNNDHIENLIKQNRRVILPIIFPALERNAR  443

Query  639  THWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGI  460
             HWNQAVQSLTLNVRK+FSDID ELFEECL KFQ++ES+E EIK KREATWKRLEEIA +
Sbjct  444  QHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQKEESQENEIKSKREATWKRLEEIAAM  503

Query  459  KAASNEPVLVSHRVAPRATSG  397
            KA SNEPVL+S ++  R  SG
Sbjct  504  KATSNEPVLISPKITRRTPSG  524



>ref|XP_009772668.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772669.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772670.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
Length=524

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+E+LIKQNRKVILPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHVESLIKQNRKVILPIIFPSLEKNARGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECLHKF+ED++ E+EIK KRE TW+RLEE+AG+KAASNEPVLVS R  P ++S
Sbjct  464  VDPELFEECLHKFEEDQANEEEIKTKRETTWRRLEELAGMKAASNEPVLVSPRTTPHSSS  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_011010241.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011010242.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011010243.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=524

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 6/141 (4%)
 Frame = -2

Query  816  ITLVCHL-SLFCSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSR  640
            + L CH+    CS H+     QVAERALFLWNNDHIENLIKQNR+VILPIIFPALE+N+R
Sbjct  389  VPLFCHIRCCLCSLHF-----QVAERALFLWNNDHIENLIKQNRRVILPIIFPALERNAR  443

Query  639  THWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGI  460
             HWNQAVQSLTLNVRK+FSDID ELFEECL KFQ++ES+E EIK KREATWKRLEEIA +
Sbjct  444  QHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQKEESQENEIKSKREATWKRLEEIAAM  503

Query  459  KAASNEPVLVSHRVAPRATSG  397
            KA SNEPVL+S ++  R  SG
Sbjct  504  KATSNEPVLISPKITRRTPSG  524



>ref|XP_011097329.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=524

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNARKHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE++E+E KMKREATWKRLEEIA +KAASNEPVLV  R + +  S
Sbjct  464  VDPELFEECLLKFQEDEAQEEETKMKREATWKRLEEIAAMKAASNEPVLVPLRTSTKTPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_006338659.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Solanum tuberosum]
 ref|XP_006338660.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Solanum tuberosum]
 ref|XP_006338661.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Solanum tuberosum]
Length=520

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN+H+ENLIKQNRKVILPIIFPALEKN+R HWNQAVQ+LTLNVRK+FSD
Sbjct  400  FQVAERALFLWNNNHVENLIKQNRKVILPIIFPALEKNARGHWNQAVQNLTLNVRKIFSD  459

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID+ELFEECL KF+ED+++E+E+K KRE TWKRLEE+AG+KAASNEPVLVSH+  P + S
Sbjct  460  IDSELFEECLQKFEEDKAQEEEVKRKREITWKRLEELAGMKAASNEPVLVSHKTTPHSPS  519

Query  399  G  397
            G
Sbjct  520  G  520



>emb|CDP16651.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN+R+HWNQAVQSLTLNVRK+FSD
Sbjct  401  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNARSHWNQAVQSLTLNVRKIFSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECL KFQEDE++++E+KMKREATWKRLEEIA +KAASNEPVLV  R+     S
Sbjct  461  TDPELFEECLLKFQEDEAQDKEVKMKREATWKRLEEIAAMKAASNEPVLVPRRLPSHTPS  520

Query  399  G  397
            G
Sbjct  521  G  521



>ref|XP_002323997.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF04130.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=530

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 118/145 (81%), Gaps = 10/145 (7%)
 Frame = -2

Query  816  ITLVCHL-SLFCSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSR  640
            + L CH+    CS H+     QVAERALFLWNNDHIENLIKQNR+VILPIIFPALE+N+R
Sbjct  389  VPLFCHIRCCLCSLHF-----QVAERALFLWNNDHIENLIKQNRRVILPIIFPALERNAR  443

Query  639  THWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGI  460
             HWNQAVQSLTLNVRK+FSDID ELFEECL KFQ++ESRE EIK KREATWKRLEEIA +
Sbjct  444  QHWNQAVQSLTLNVRKIFSDIDPELFEECLLKFQKEESRENEIKSKREATWKRLEEIAAM  503

Query  459  KAASNEPVLVSHRVAPRATSG*RLG  385
            KA SNEPVL+S    P++  G  LG
Sbjct  504  KATSNEPVLIS----PKSRGGHHLG  524



>ref|XP_006357177.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Solanum tuberosum]
Length=524

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHVENLIKQNRKVILPIIFPALEKNARGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KF+ED++ E+E K KRE TWKRLEEIA +K ASNEPVLVSHR+ P +++
Sbjct  464  VDPELFEECLRKFEEDQAHEEENKTKREMTWKRLEEIAAMKTASNEPVLVSHRITPNSST  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_010660823.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Vitis vinifera]
Length=525

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  405  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARNHWNQAVQSLTLNVRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE++E+E+KMKREATWKRLEEIA +KA SNEPVLV  R      S
Sbjct  465  VDPELFEECLLKFQEDEAQEKEVKMKREATWKRLEEIAAMKATSNEPVLVPRRATTHTPS  524

Query  399  G  397
            G
Sbjct  525  G  525



>ref|XP_010250854.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250855.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250856.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010250857.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
Length=525

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  405  FQVAERALFLWNNDHVENLIKQNRKVILPIIFPALEKNARNHWNQAVQSLTLNVRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF+ECL KFQEDES+E++I  KREATWKRLEEIA  KAASNE VLV+H   PR +S
Sbjct  465  LDPELFDECLLKFQEDESKEKDITAKREATWKRLEEIAASKAASNEAVLVAHVTPPRTSS  524

Query  399  G  397
            G
Sbjct  525  G  525



>ref|XP_009762457.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Nicotiana 
sylvestris]
Length=524

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNTRGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECLHKF+ED + E+E K KRE TWKRLEEIA +KAASNEPVLVS R  P + +
Sbjct  464  IDPELFEECLHKFEEDLAHEEENKTKREMTWKRLEEIAAMKAASNEPVLVSLRTTPHSPT  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_012071218.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 ref|XP_012071226.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 ref|XP_012071232.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 ref|XP_012071236.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 gb|KDP46344.1| hypothetical protein JCGZ_10184 [Jatropha curcas]
Length=522

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN KVILPIIFP+LE+NSR HWNQAVQSLTLNVRK+FSD
Sbjct  402  FQVAERALFLWNNDHIESLIKQNCKVILPIIFPSLERNSRQHWNQAVQSLTLNVRKIFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFE+CL KFQEDE++E+EIK KREATWKRLEEIA +KAASNEPVLVS +V  RA S
Sbjct  462  VDPELFEDCLLKFQEDETQEKEIKSKREATWKRLEEIAAMKAASNEPVLVSPKVTTRAPS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|XP_007031732.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 ref|XP_007031733.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02658.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02659.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
Length=525

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIF +LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  405  FQVAERALFLWNNDHIENLIKQNRKVILPIIFASLEKNARNHWNQAVQSLTLNVRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECL KFQEDE+RE E+K KREATWKRLEEIA +KAASNEPVLVS ++  R  S
Sbjct  465  SDPELFEECLQKFQEDEARENEVKSKREATWKRLEEIAAMKAASNEPVLVSPKITTRKPS  524

Query  399  G  397
            G
Sbjct  525  G  525



>ref|XP_010111637.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXC31382.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=525

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R+HWNQAV SLTLNVRK+FSD
Sbjct  405  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNTRSHWNQAVHSLTLNVRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE++E+EI  KRE TWKRLEEIA  KAASNEPVLVS ++  RA S
Sbjct  465  VDPELFEECLLKFQEDEAQEKEINAKREMTWKRLEEIAAKKAASNEPVLVSSKIIARAPS  524

Query  399  G  397
            G
Sbjct  525  G  525



>ref|XP_009762455.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Nicotiana 
sylvestris]
Length=524

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNTRGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECLHKF+ED + E+E K KRE TWK+LEEIA IKA SNEPVLVS R  P + +
Sbjct  464  IDPELFEECLHKFEEDLAHEEENKTKREMTWKQLEEIAAIKATSNEPVLVSLRTTPHSPT  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_009625334.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=524

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNTRGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KF+ED + E+E K KRE TWKRLEEIA  KAASNEPVLVS R  P +++
Sbjct  464  IDPELFEECLQKFEEDLAHEEENKTKREMTWKRLEEIAATKAASNEPVLVSLRTTPHSST  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_010029046.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 gb|KCW55891.1| hypothetical protein EUGRSUZ_I01694 [Eucalyptus grandis]
Length=524

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 111/121 (92%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R+HWNQAVQSLTLNVRK++SD
Sbjct  405  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARSHWNQAVQSLTLNVRKIYSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE +E+++K++REATWKRLEEIA +KAASNEPVLV  R+A  A S
Sbjct  465  VDPELFEECLAKFQEDEVQEKDVKLQREATWKRLEEIAAMKAASNEPVLVPRRLA-HAPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>gb|EYU34778.1| hypothetical protein MIMGU_mgv1a004809mg [Erythranthe guttata]
Length=509

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  389  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARSHWNQAVQSLTLNVRKIFSD  448

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE++E+E K KRE  WKRLE+IA +KAASNEPVLV  R   +ATS
Sbjct  449  VDPELFEECLLKFQEDEAKEEENKTKRELIWKRLEDIAAMKAASNEPVLVPLRTNSKATS  508

Query  399  G  397
            G
Sbjct  509  G  509



>ref|XP_010248839.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
 ref|XP_010248840.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nelumbo nucifera]
Length=523

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -2

Query  804  CHLSLFCSFHYLIL--FLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LFC     +     QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HW
Sbjct  386  CMVPLFCQISRCLSSSHFQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARNHW  445

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAVQSLTLNVRK+FSD+D ELFEECL KFQ+DE++E+++K KRE+TWKRLEEIA  KAA
Sbjct  446  NQAVQSLTLNVRKIFSDLDPELFEECLLKFQDDETKEKDLKAKRESTWKRLEEIAASKAA  505

Query  450  SNEPVLVSHRVAPRATSG  397
            SNE VLV     P A+ G
Sbjct  506  SNEAVLVGRVTPPHASLG  523



>gb|KJB33915.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
 gb|KJB33916.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
Length=524

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LI+QNRKVILPIIFP+LEKN+R HWNQAVQSLTLNVRK+FS 
Sbjct  404  FQVAERALFLWNNDHIESLIRQNRKVILPIIFPSLEKNARNHWNQAVQSLTLNVRKIFSA  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECLHKF+EDE++E E+K KREATWKRLEEIA +KAASNEPVL+S +   R  S
Sbjct  464  TDPELFEECLHKFKEDEAQENEVKSKREATWKRLEEIAAMKAASNEPVLISPKATTRKPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>gb|KJB40702.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40703.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40704.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40705.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
Length=523

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 4/120 (3%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE LIKQNR VILPIIFP+LEKN+R+HWN AVQSLTLNVRK+FSD
Sbjct  403  FQVAERALFLWNNDHIETLIKQNRNVILPIIFPSLEKNARSHWNPAVQSLTLNVRKIFSD  462

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECLHKF+ED+++E E+K KREATWKRLEEIA +KAASNEPVLVS    P+AT+
Sbjct  463  TDPELFEECLHKFEEDQAQENEVKSKREATWKRLEEIAAMKAASNEPVLVS----PKATT  518



>gb|KHG13833.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=523

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 4/120 (3%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE LIKQNR VILPIIFP+LEKN+R+HWN AVQSLTLNVRK+FSD
Sbjct  403  FQVAERALFLWNNDHIETLIKQNRTVILPIIFPSLEKNARSHWNPAVQSLTLNVRKIFSD  462

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECLHKF+ED+++E E+K KRE TWKRLEEIA +KAASNEPVLVS    P+AT+
Sbjct  463  TDPELFEECLHKFEEDQAQENEVKSKRETTWKRLEEIAAMKAASNEPVLVS----PKATT  518



>ref|XP_008799955.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like isoform X2 [Phoenix dactylifera]
Length=199

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIEN IKQNRKVILPIIFP LE+N++THWNQAVQSLTLNVRK+FSD
Sbjct  79   FQVAERALFLWNNDHIENSIKQNRKVILPIIFPVLERNAKTHWNQAVQSLTLNVRKIFSD  138

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELF ECL KF+EDE++EQEIK KRE+TW+RLEEIA  KAASNE VLV   V  + +S
Sbjct  139  HDPELFAECLKKFEEDEAKEQEIKSKRESTWRRLEEIATSKAASNEAVLVPRTVPHQVSS  198



>ref|XP_004231808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315939.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315940.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315942.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315943.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
Length=523

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ENLIKQN +VILPIIFP+LEKN+R HWNQAVQ+LTLNVRK+FSD
Sbjct  403  FQVAERALFLWNNDHVENLIKQNHRVILPIIFPSLEKNARGHWNQAVQNLTLNVRKIFSD  462

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID+ELFEECL KF+EDE++E+E+K KRE TWKRLEE+AG+KAASNEPVLVSH++ P   S
Sbjct  463  IDSELFEECLQKFEEDEAQEEEVKRKREITWKRLEELAGVKAASNEPVLVSHKITPHPPS  522

Query  399  G  397
            G
Sbjct  523  G  523



>ref|XP_010317069.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Solanum lycopersicum]
Length=524

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ENLIKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHVENLIKQNRKVILPIIFPALEKNARGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KF+EDE+ E+E K KRE TWKRLEEIA +KAASNE VLVSHR+ P +++
Sbjct  464  VDPELFEECLRKFEEDEAHEEEDKTKREMTWKRLEEIAAMKAASNEAVLVSHRITPNSST  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_011098814.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
 ref|XP_011098815.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
 ref|XP_011098816.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
 ref|XP_011098817.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=522

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPI+FPALEKN+R HWNQAV+SLTLNVRK+FS 
Sbjct  402  FQVAERALFLWNNDHIENLIKQNRKVILPIVFPALEKNARNHWNQAVRSLTLNVRKIFSG  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE++E+E K KREA WK LE+IA +KAASNE VLV HR +    S
Sbjct  462  VDPELFEECLLKFQEDEAQEEETKTKREAAWKHLEQIATMKAASNEAVLVPHRTSTNKPS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|XP_004138464.2| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis sativus]
 gb|KGN45729.1| hypothetical protein Csa_6G008600 [Cucumis sativus]
Length=524

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LFLWNN+HIENLIKQNRKVILPIIFPALE+NSR HWNQAVQ+LT NVRK+FSD
Sbjct  404  FQVAERTLFLWNNNHIENLIKQNRKVILPIIFPALERNSRNHWNQAVQNLTQNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECL KFQE+E++E+++K KREA WKRLEEIA +KAASNE VLV+ +VA RA S
Sbjct  464  ADPELFEECLLKFQEEETQEKDMKSKREAKWKRLEEIAALKAASNEAVLVTPKVALRAPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_008378369.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like, partial [Malus domestica]
Length=198

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 11/147 (7%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF    + +     QVAERALFLWNNDHI NLI QNR+VILPIIFPALEKN+R+HW
Sbjct  51   CMVPLFRQIGHCLNSSHFQVAERALFLWNNDHIRNLITQNRQVILPIIFPALEKNTRSHW  110

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAVQSLTLNV+K+FSD+D ELF+ECL  FQEDES+E+E + KRE+TWKRLE++A  KA 
Sbjct  111  NQAVQSLTLNVKKIFSDVDQELFDECLVGFQEDESKEKETQEKRESTWKRLEDVAASKAL  170

Query  450  SNEPVLVSHRVA---------PRATSG  397
             NE VLVS   +         PRA+SG
Sbjct  171  GNEAVLVSRFASSVAIATNPKPRASSG  197



>ref|XP_010682883.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Beta vulgaris subsp. 
vulgaris]
Length=522

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIENLIKQN KVILPI+FPALEKN+R HWNQAV SLTLNVRK+FSD
Sbjct  401  FQVAERSLFLWNNDHIENLIKQNCKVILPIVFPALEKNARNHWNQAVHSLTLNVRKIFSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDES+E E++ KREATWKRLEEIA  KA + EPVLV   +  R TS
Sbjct  461  LDPELFEECLLKFQEDESKEDEVRAKREATWKRLEEIAAEKAKTAEPVLVPLILPARTTS  520

Query  399  G  397
            G
Sbjct  521  G  521



>ref|XP_003555155.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Glycine max]
 gb|KHN01906.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Glycine soja]
Length=523

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN K+ILPI+ PALEKN+R HWNQAVQSLT+NVRK+F+D
Sbjct  405  FQVAERALFLWNNDHIENLIKQNCKIILPIVLPALEKNARNHWNQAVQSLTINVRKIFAD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D EL EECL KF+EDE++E+ +K+KREATWKRLEEIA +KAASNEPVLVS R A  ++S
Sbjct  465  TDPELLEECLRKFKEDEAQEKALKLKREATWKRLEEIAAMKAASNEPVLVSPRTA--SSS  522

Query  399  G  397
            G
Sbjct  523  G  523



>ref|XP_010910784.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Elaeis guineensis]
Length=129

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 8/127 (6%)
 Frame = -2

Query  753  VAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSDID  574
            VAERALFLWNNDH+ NLI  NRKVILPIIFPALE+N+R HWNQAVQSLTLNVRKLF D D
Sbjct  2    VAERALFLWNNDHVRNLITPNRKVILPIIFPALERNTREHWNQAVQSLTLNVRKLFLDAD  61

Query  573  AELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV--------  418
             ELFEECL +FQEDE++E+E++ KRE TWKRLE++A  KA SNEPVLVS  V        
Sbjct  62   QELFEECLIRFQEDEAKEKELQQKRELTWKRLEDVAASKAVSNEPVLVSRIVSSLSMASS  121

Query  417  APRATSG  397
            +PRA  G
Sbjct  122  SPRAAIG  128



>ref|XP_007215087.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
 gb|EMJ16286.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
Length=516

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNR V+LPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  396  FQVAERALFLWNNDHIANLIKQNRSVLLPIIFPSLEKNARNHWNQAVQSLTLNVRKIFSD  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE +E+E+ ++RE TWKRLEEIA  KA SNE VLVS R A    S
Sbjct  456  IDPELFEECLLKFQEDEVQEKELNLRREITWKRLEEIAAKKATSNEAVLVSPRKATGKPS  515

Query  399  G  397
            G
Sbjct  516  G  516



>ref|XP_008230444.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=516

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNR V+LPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  396  FQVAERALFLWNNDHIANLIKQNRSVLLPIIFPSLEKNARNHWNQAVQSLTLNVRKIFSD  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE +E+E+ ++RE TWKRLEEIA  KA SNE VLVS R A    S
Sbjct  456  IDPELFEECLLKFQEDEVQEKELNLRREITWKRLEEIAAKKATSNEAVLVSPRKATGKPS  515

Query  399  G  397
            G
Sbjct  516  G  516



>gb|KJB11612.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=368

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIE LIKQNR VILPIIFP+LE+N+R+HWN AVQSLTLNV+K+FSD
Sbjct  251  FQVAERALFLWNNHHIETLIKQNRNVILPIIFPSLERNARSHWNPAVQSLTLNVQKIFSD  310

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPR  409
             D ELFEECLH FQE+E+R+ E K KREATWKRLEEIA +KAASN+PVLVS +V  R
Sbjct  311  NDPELFEECLHMFQEEEARDNEAKSKREATWKRLEEIAAMKAASNQPVLVSPKVTTR  367



>ref|XP_008797311.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Phoenix dactylifera]
Length=522

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN K ILPIIFPALE+N+++HWNQAVQSLTLNVRK+FSD
Sbjct  402  FQVAERALFLWNNDHIENLIKQNCKAILPIIFPALERNTKSHWNQAVQSLTLNVRKIFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF ECL KF+EDES+E+EIK KREA WKRLEEIA  KAASNE VLVSH +  + +S
Sbjct  462  HDPGLFTECLKKFEEDESKEKEIKSKREAAWKRLEEIATSKAASNEAVLVSHIMPHQVSS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|XP_012080628.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Jatropha curcas]
 gb|KDP30791.1| hypothetical protein JCGZ_13734 [Jatropha curcas]
Length=544

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 105/130 (81%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  414  FQVAERALFLWNNDHIRNLITQNRKVILPIIFPALERNTRGHWNQAVQSLTLNVRKIFSD  473

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D ELF+ECL KFQEDE +EQE++ +RE TWKRLEE+A  KA SNE VLVS  V      
Sbjct  474  ADQELFDECLVKFQEDEVKEQEMQERRELTWKRLEEVAASKAISNEAVLVSRFVSSVAIT  533

Query  417  ---APRATSG  397
               +PRATSG
Sbjct  534  TGTSPRATSG  543



>ref|XP_010025360.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 ref|XP_010025361.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 gb|KCW62002.1| hypothetical protein EUGRSUZ_H04680 [Eucalyptus grandis]
Length=525

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALF WNNDHIENLIKQNR VILP+IFPALEKN+R HWNQAVQSLTLNVRKLF D
Sbjct  405  FQVAERALFFWNNDHIENLIKQNRSVILPMIFPALEKNARNHWNQAVQSLTLNVRKLFYD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF+ECL KFQEDE++E++++++RE TWKRLEE+A  KA SNE VLV  +   R  S
Sbjct  465  LDPELFKECLTKFQEDEAKEEDVQVRRETTWKRLEELAAKKATSNEAVLVVAKTLSRMAS  524

Query  399  G  397
            G
Sbjct  525  G  525



>ref|XP_004142950.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis sativus]
 ref|XP_011649508.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis sativus]
 ref|XP_011649509.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis sativus]
 gb|KGN62353.1| hypothetical protein Csa_2G350360 [Cucumis sativus]
Length=525

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIK+NRKVILPIIFPALEKN+R+HWNQAV SLTLNVRK+F D
Sbjct  405  FQVAERALFLWNNDHIENLIKENRKVILPIIFPALEKNARSHWNQAVHSLTLNVRKIFYD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D +L +ECL KFQEDE +E E+K +REATW RLEE+A  KAASNE VLVSH++  R  S
Sbjct  465  LDPDLLKECLVKFQEDELKENELKARREATWNRLEELAAKKAASNEAVLVSHKLPTRTAS  524



>ref|XP_006375537.1| hypothetical protein POPTR_0014s15520g [Populus trichocarpa]
 gb|ERP53334.1| hypothetical protein POPTR_0014s15520g [Populus trichocarpa]
Length=191

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 102/130 (78%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
            LQVAERALFLWNNDHI NLI QNR+VILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  61   LQVAERALFLWNNDHIRNLITQNRRVILPIIFPALERNTRGHWNQAVQSLTLNVRKIFSD  120

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D ELF+ECL KF+EDE ++ E + KRE TWKRLE++A  KA SNE VLV   V      
Sbjct  121  ADQELFDECLVKFEEDEVKQMETREKRELTWKRLEDLATSKAVSNEAVLVPSSVSSIAIA  180

Query  417  ---APRATSG  397
               +PR T+G
Sbjct  181  TGTSPRTTAG  190



>gb|KHG26982.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=516

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIE LIKQNR VILPIIFP+LE+N+R+HWN AVQSLTLNV+K+FSD
Sbjct  399  FQVAERALFLWNNHHIETLIKQNRNVILPIIFPSLERNARSHWNPAVQSLTLNVQKIFSD  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPR  409
             D ELFEECLH FQE+E+RE E K KREATWKRLEEIA +KAASN+PVL+S +V  R
Sbjct  459  NDPELFEECLHMFQEEEARENEAKSKREATWKRLEEIAAMKAASNQPVLISLKVTTR  515



>ref|XP_011457446.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKV+LPIIF ALEKN+R HWNQAV SLTLNVRK+F D
Sbjct  402  FQVAERALFLWNNDHIENLIKQNRKVLLPIIFSALEKNARNHWNQAVHSLTLNVRKIFYD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF ECL +F+EDES+E E+K +REATWKRLEE+A  KA+SNEPVLV  R   R  S
Sbjct  462  LDPELFNECLAEFKEDESKEDEVKARREATWKRLEEVAAKKASSNEPVLVRGRAPLRTAS  521



>ref|XP_006379947.1| hypothetical protein POPTR_0008s18050g [Populus trichocarpa]
 gb|ERP57744.1| hypothetical protein POPTR_0008s18050g [Populus trichocarpa]
Length=174

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
            L VAERAL+LWNNDHIENLI+QN K ILPIIFPALEKN R HWNQ VQSLT+NVRK+F+D
Sbjct  54   LAVAERALYLWNNDHIENLIRQNSKAILPIIFPALEKNGRNHWNQVVQSLTVNVRKIFAD  113

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELFEECL +FQE E++ +E K K+EATWKRLEEIA  KAAS+E VLV H + P  TS
Sbjct  114  TDPELFEECLRQFQEKEAKAEEFKTKQEATWKRLEEIAATKAASSEAVLVPHAI-PTLTS  172

Query  399  G  397
             
Sbjct  173  S  173



>ref|XP_010907764.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Elaeis guineensis]
 ref|XP_010907765.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Elaeis guineensis]
Length=522

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN KV+LPIIFPALE+N+++HWNQAVQSLTLNVRK+FSD
Sbjct  402  FQVAERALFLWNNDHIESLIKQNCKVVLPIIFPALERNTKSHWNQAVQSLTLNVRKIFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELF ECL KF+EDES+++EIK +REA WKRLEEIA  KAASNE VL+SH +  + +S
Sbjct  462  HDPELFTECLKKFEEDESKKEEIKSRREAAWKRLEEIATSKAASNEAVLISHVMPHQVSS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|XP_002514975.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47529.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=524

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL++WNNDHIENLI+ NRKVILPIIFPALEKN R HWNQ VQSLTLNVRK+F+D
Sbjct  404  FQVAERALYMWNNDHIENLIRHNRKVILPIIFPALEKNGRNHWNQVVQSLTLNVRKIFAD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE++ ++IK+K EATWKRLEEIA  K AS+E VLV   +    +S
Sbjct  464  IDPELFEECLRKFQEDEAKAEDIKLKHEATWKRLEEIAATKVASSEAVLVPRTIPTLTSS  523

Query  399  G  397
            G
Sbjct  524  G  524



>gb|KJB11609.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
 gb|KJB11610.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=516

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIE LIKQNR VILPIIFP+LE+N+R+HWN AVQSLTLNV+K+FSD
Sbjct  399  FQVAERALFLWNNHHIETLIKQNRNVILPIIFPSLERNARSHWNPAVQSLTLNVQKIFSD  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPR  409
             D ELFEECLH FQE+E+R+ E K KREATWKRLEEIA +KAASN+PVLVS +V  R
Sbjct  459  NDPELFEECLHMFQEEEARDNEAKSKREATWKRLEEIAAMKAASNQPVLVSPKVTTR  515



>ref|XP_008799952.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799954.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Phoenix dactylifera]
Length=519

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIEN IKQNRKVILPIIFP LE+N++THWNQAVQSLTLNVRK+FSD
Sbjct  399  FQVAERALFLWNNDHIENSIKQNRKVILPIIFPVLERNAKTHWNQAVQSLTLNVRKIFSD  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELF ECL KF+EDE++EQEIK KRE+TW+RLEEIA  KAASNE VLV   V  + +S
Sbjct  459  HDPELFAECLKKFEEDEAKEQEIKSKRESTWRRLEEIATSKAASNEAVLVPRTVPHQVSS  518



>ref|XP_010932304.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Elaeis guineensis]
Length=517

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 113/143 (79%), Gaps = 13/143 (9%)
 Frame = -2

Query  804  CHLSLFC-------SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LFC       S H+     QVAER+LFLWNNDHIE+LIKQNR VILPII+PALE+N
Sbjct  380  CMVPLFCQIACCLSSSHF-----QVAERSLFLWNNDHIESLIKQNRNVILPIIYPALERN  434

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            +++HWNQAVQSLTLNVRK+FSD D ELF ECL KF+EDE++E+EIK KREATWKRLEEIA
Sbjct  435  AKSHWNQAVQSLTLNVRKIFSDHDPELFAECLKKFEEDEAKEKEIKSKREATWKRLEEIA  494

Query  465  GIKAASNEPVLVSHRVAPRATSG  397
              +AA+NE VLV  R+ PR  S 
Sbjct  495  TSRAANNEAVLVP-RIMPRQVSS  516



>ref|XP_004304704.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNR V+LPIIFP+LE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  401  FQVAERALFLWNNDHISNLIKQNRHVLLPIIFPSLERNARNHWNQAVQSLTLNVRKIFSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKA-ASNEPVLVSHRVAPRAT  403
            ID ELFEECL KFQEDE++E+E+ +KRE TWKRLEEIA  KA ASNE VLVS R A    
Sbjct  461  IDPELFEECLLKFQEDEAQEKEMSLKRELTWKRLEEIAAKKASASNEAVLVSPRKAMGKP  520

Query  402  SG  397
            SG
Sbjct  521  SG  522



>ref|XP_008340161.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=521

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QNRKVILPII PALEKN+R HWNQAV SLTLNVRK+F +
Sbjct  401  FQVAERALFLWNNDHIENLIRQNRKVILPIILPALEKNARNHWNQAVHSLTLNVRKIFXE  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF+ECL +FQEDES++ E+  +REATWKRLEE+A  K+ASNE VLV  +  PR TS
Sbjct  461  LDPELFKECLLQFQEDESKDGEVTARREATWKRLEEVAAKKSASNEAVLVFGKAPPRTTS  520



>ref|XP_010244149.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
Length=554

 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 104/130 (80%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNRKVILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  424  FQVAERALFLWNNDHIRNLITQNRKVILPIIFPALERNTRSHWNQAVQSLTLNVRKIFSD  483

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
             D ELFEECL +FQEDE++E+E + KRE TWKRLE++A  KA SNE VLVS   +     
Sbjct  484  ADQELFEECLVRFQEDEAKEKETREKRECTWKRLEDVAASKAVSNEAVLVSRFASSLAPS  543

Query  414  ----PRATSG  397
                PRAT G
Sbjct  544  AGTNPRATVG  553



>ref|XP_008389801.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
 ref|XP_008389802.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=520

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QNRKVILPII PALEKN+R HWNQAV SLTLNVRK+F++
Sbjct  400  FQVAERALFLWNNDHIENLIRQNRKVILPIILPALEKNARNHWNQAVHSLTLNVRKIFNE  459

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF+ECL + QEDES+E E+  +RE+TWKRLEE+A  KAASNEPVLV  +  P  TS
Sbjct  460  LDPELFKECLLQVQEDESKEGEVAARRESTWKRLEEVAAKKAASNEPVLVFGKAPPSTTS  519



>ref|XP_008441374.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
 gb|ADN34067.1| protein phosphatase 2a [Cucumis melo subsp. melo]
Length=524

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LFLWNN+HIENLIKQNRKVILPIIFPALE+NSR HWNQAVQ+LT NVRK+FSD
Sbjct  404  FQVAERTLFLWNNNHIENLIKQNRKVILPIIFPALERNSRNHWNQAVQNLTQNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELF+ECL KFQE+E++E+++K KREA WKRLEEIA  KAAS E VLV+ +VA RA S
Sbjct  464  ADPELFDECLLKFQEEETQEKDMKSKREAKWKRLEEIAARKAASIEAVLVAPKVALRAPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>gb|KCW62001.1| hypothetical protein EUGRSUZ_H04680 [Eucalyptus grandis]
Length=545

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -2

Query  753  VAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSDID  574
            VAERALF WNNDHIENLIKQNR VILP+IFPALEKN+R HWNQAVQSLTLNVRKLF D+D
Sbjct  427  VAERALFFWNNDHIENLIKQNRSVILPMIFPALEKNARNHWNQAVQSLTLNVRKLFYDLD  486

Query  573  AELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATSG  397
             ELF+ECL KFQEDE++E++++++RE TWKRLEE+A  KA SNE VLV  +   R  SG
Sbjct  487  PELFKECLTKFQEDEAKEEDVQVRRETTWKRLEELAAKKATSNEAVLVVAKTLSRMASG  545



>ref|XP_007163719.1| hypothetical protein PHAVU_001G258400g [Phaseolus vulgaris]
 gb|ESW35713.1| hypothetical protein PHAVU_001G258400g [Phaseolus vulgaris]
Length=519

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNRKVILPIIFPALE+N+R+HWNQAV SLTLNVRK+F+D
Sbjct  399  FQVAERALFLWNNDHIVNLIKQNRKVILPIIFPALERNARSHWNQAVHSLTLNVRKIFND  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +DA+L +ECL KF+EDES+E E+K  REATWKRLEE+A  KAAS E VL+ ++   R ++
Sbjct  459  VDADLSKECLQKFEEDESKESEVKAGREATWKRLEELAMKKAASGEAVLIGNKAPTRPSA  518

Query  399  G  397
            G
Sbjct  519  G  519



>ref|XP_011021363.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021364.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021365.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021366.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021367.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVILPIIFPALEKN R HWNQ VQSLT+NVRK+F+D
Sbjct  427  FQVAERALYLWNNDHIENLIRQNRKVILPIIFPALEKNGRNHWNQVVQSLTVNVRKIFAD  486

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL +FQE+E++ +EIK K+EATWKRLEEIA  KA S+E VLV   +   A+S
Sbjct  487  IDPELFEECLLQFQENEAKAEEIKTKQEATWKRLEEIAATKATSSEAVLVPWAIPALASS  546

Query  399  G  397
            G
Sbjct  547  G  547



>ref|XP_009359296.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009359297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009359298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=520

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QNRKVILPII PALEKN+R HWNQAV SLTLNVRK+F++
Sbjct  402  FQVAERALFLWNNDHIENLIRQNRKVILPIILPALEKNARNHWNQAVHSLTLNVRKIFNE  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRAT  403
            +D ELF+ECL +FQEDES++ E+  +REATWKRLEE+A  K+ASNE VLV  +  PR T
Sbjct  462  LDPELFKECLLQFQEDESKDGEVTARREATWKRLEEVAAKKSASNEAVLVFGKAPPRTT  520



>ref|XP_007044975.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
 gb|EOY00807.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
Length=518

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF    + +  L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALEKN+R HW
Sbjct  381  CMVPLFRRIAHCLNSLHFQVAERALFLWNNDHIENLIIQNRKVILPIIFPALEKNARNHW  440

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D EL+ ECL KFQEDES+E EI+++REA W+RLEE+A  KA+
Sbjct  441  NQAVHSLTLNVRKIFCDLDPELYNECLLKFQEDESKEDEIEVRREARWQRLEELAEKKAS  500

Query  450  SNEPVLVSHRVAPRATSG  397
             +E VLVSH+     +SG
Sbjct  501  GSEAVLVSHKANANGSSG  518



>ref|XP_002314559.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF00730.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=526

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVILPIIFPALEKN R HWNQ VQSLT+NVRK+F+D
Sbjct  406  FQVAERALYLWNNDHIENLIRQNRKVILPIIFPALEKNGRNHWNQVVQSLTVNVRKIFAD  465

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL +FQE+E++ +EIK K+EATWKRLEEIA  KA S+E VLV   +    +S
Sbjct  466  IDPELFEECLRQFQENEAKAEEIKTKQEATWKRLEEIAATKATSSEAVLVPWAIPTLTSS  525

Query  399  G  397
            G
Sbjct  526  G  526



>ref|XP_006341761.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Solanum tuberosum]
Length=502

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 12/132 (9%)
 Frame = -2

Query  804  CHLSLF-------CSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LF        SFH+     QVAERALFLWNNDHIENLIKQ+RKVILPIIFPALE+N
Sbjct  368  CMVPLFRRIAQCLTSFHF-----QVAERALFLWNNDHIENLIKQHRKVILPIIFPALERN  422

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            +R HWNQAV SL+LN+RK+F D+D ELF+ECLHKFQEDE +E EIK KREATWKRLEE+A
Sbjct  423  ARNHWNQAVHSLSLNIRKIFYDLDPELFKECLHKFQEDELKEDEIKSKREATWKRLEELA  482

Query  465  GIKAASNEPVLV  430
                 SNE VLV
Sbjct  483  AKNTTSNEAVLV  494



>ref|XP_009365093.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Pyrus x bretschneideri]
Length=541

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILPIIFPALEKN+R+HWNQAVQSLTLNV+K+FSD
Sbjct  411  FQVAERALFLWNNDHIRNLITQNRQVILPIIFPALEKNTRSHWNQAVQSLTLNVKKIFSD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
            +D ELF+ECL  FQEDES+E+E + KRE+TWKRLE++A  KA  NE VLVS   +     
Sbjct  471  VDQELFDECLVGFQEDESKEKETQEKRESTWKRLEDVAASKALGNEAVLVSRFTSSVAIA  530

Query  414  ----PRATSG  397
                PRA+SG
Sbjct  531  TNPKPRASSG  540



>ref|XP_008363215.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Malus domestica]
 ref|XP_008363216.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Malus domestica]
Length=541

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 105/130 (81%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILPIIFPALEKN+R+HWNQAVQSLTLNV+K+FSD
Sbjct  411  FQVAERALFLWNNDHIRNLITQNRQVILPIIFPALEKNTRSHWNQAVQSLTLNVKKIFSD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
            +D ELF+ECL  FQEDES+E+E + KRE+TWKRLE++A  KA  NE VLVS   +     
Sbjct  471  VDQELFDECLVGFQEDESKEKETQEKRESTWKRLEDVAASKALGNEAVLVSRFASSVAIA  530

Query  414  ----PRATSG  397
                PRA+SG
Sbjct  531  TNPKPRASSG  540



>ref|XP_008379655.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Malus domestica]
 ref|XP_008379656.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Malus domestica]
Length=539

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NL+ QNR+VILPIIFPALEKN+R+HWNQAVQSLTLNV+K+FSD
Sbjct  411  FQVAERALFLWNNDHIRNLVTQNRQVILPIIFPALEKNTRSHWNQAVQSLTLNVKKIFSD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
            +D ELF+ECL  FQEDES+E++ + KRE+TWKRLE++A  KA  NE VLVS   +     
Sbjct  471  VDQELFDECLVGFQEDESKEKZTQEKRESTWKRLEDVAASKALGNEAVLVSGFTSSIDTN  530

Query  414  --PRATSG  397
              PRA+SG
Sbjct  531  PQPRASSG  538



>ref|XP_012085598.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 ref|XP_012085599.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 gb|KDP26745.1| hypothetical protein JCGZ_17903 [Jatropha curcas]
Length=524

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVILPIIFP+LEKN   HWNQ VQ+LT NVRK+F+D
Sbjct  404  FQVAERALYLWNNDHIENLIRQNRKVILPIIFPSLEKNGCNHWNQVVQNLTANVRKIFAD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL +FQEDE++ ++IK K EATWKRLEEIA  +AAS+E VLV H +    +S
Sbjct  464  IDPELFEECLRQFQEDEAKAEDIKAKHEATWKRLEEIAATQAASSEAVLVPHSIPTLTSS  523

Query  399  G  397
            G
Sbjct  524  G  524



>ref|XP_009780032.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
Length=514

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF    + +  L  QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N R HW
Sbjct  380  CMVPLFRRIAHCLTSLHFQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNGRNHW  439

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SL+LN+RK+F D+D ELF+ECLHKFQEDE +E EIK +REATWKRLE++A   + 
Sbjct  440  NQAVHSLSLNIRKIFYDLDPELFKECLHKFQEDELKEDEIKSRREATWKRLEDVAAKNST  499

Query  450  SNEPVLV  430
            SNE VLV
Sbjct  500  SNEAVLV  506



>ref|XP_007217254.1| hypothetical protein PRUPE_ppa003902mg [Prunus persica]
 gb|EMJ18453.1| hypothetical protein PRUPE_ppa003902mg [Prunus persica]
Length=541

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI  LI QNR+VILPIIFPALEKN+R+HWNQAVQSLTLNV+K+F+D
Sbjct  411  FQVAERALFLWNNDHIRTLITQNRQVILPIIFPALEKNTRSHWNQAVQSLTLNVKKIFAD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
            ID ELF+ECL  FQEDES+E+E + KRE+TWKRLE++A  KA  NE VLVS   +     
Sbjct  471  IDQELFDECLLSFQEDESKEKETQDKRESTWKRLEDVAASKALGNEAVLVSRFASSVAIA  530

Query  414  ----PRATSG  397
                PRATSG
Sbjct  531  TNPKPRATSG  540



>ref|XP_002525315.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF37048.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=544

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  414  FQVAERALFLWNNDHIRNLITQNRKVILPIIFPALERNTRGHWNQAVQSLTLNVRKIFSD  473

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA-T  403
             D ELF+ECL KFQEDE +E+E++ KRE+ WKRLE++A  KA SNE VLVS  V+  A T
Sbjct  474  ADQELFDECLVKFQEDEIKEREVQEKRESKWKRLEDVAASKAISNEAVLVSRFVSSVAIT  533

Query  402  SG  397
            SG
Sbjct  534  SG  535



>gb|EYU44814.1| hypothetical protein MIMGU_mgv1a004709mg [Erythranthe guttata]
Length=513

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIEN+IKQNRKVILPIIFPALEKN+R HWNQAVQSLTLNVRK+F+D
Sbjct  404  FQVAERALFLWNNDHIENMIKQNRKVILPIIFPALEKNARNHWNQAVQSLTLNVRKIFAD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D ELFEECL  FQEDE++E E K KREATWKRLE+IA +KA SN
Sbjct  464  VDPELFEECLLSFQEDEAQEGETKTKREATWKRLEDIATMKATSN  508



>ref|XP_004489571.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004489572.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Cicer arietinum]
 ref|XP_004489573.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Cicer arietinum]
 ref|XP_004489574.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X4 [Cicer arietinum]
Length=531

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN K+ILPI+ PALE+N+R HW+QAV+SLT+NV K+FSD
Sbjct  407  FQVAERALFLWNNDHIENLIKQNHKIILPIVLPALEQNARNHWSQAVRSLTVNVCKIFSD  466

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-PRAT  403
            ID   +EEC+ KF+EDE++E ++K KREA WKRLEE+ G+KAASNEPVLVS R A   AT
Sbjct  467  IDPAFYEECMIKFREDEAQENDMKSKREARWKRLEEMGGMKAASNEPVLVSPRTASSHAT  526

Query  402  SG  397
            SG
Sbjct  527  SG  528



>ref|XP_008230000.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Prunus mume]
Length=541

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI  LI QNR+VILPIIFPALEKN+R+HWNQAVQSLTLNV+K+F+D
Sbjct  411  FQVAERALFLWNNDHIRTLITQNRQVILPIIFPALEKNTRSHWNQAVQSLTLNVKKIFAD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
            ID ELF+ECL  FQEDES+E+E + KRE+TWKRLE++A  KA  NE VLVS   +     
Sbjct  471  IDQELFDECLLSFQEDESKEKETQDKRESTWKRLEDVATSKALGNEAVLVSRFASSVAIA  530

Query  414  ----PRATSG  397
                PRATSG
Sbjct  531  TNPKPRATSG  540



>ref|XP_009370310.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=514

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNR V+LPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  394  FQVAERALFLWNNDHIANLIKQNRHVLLPIIFPSLEKNARNHWNQAVQSLTLNVRKIFSD  453

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL  FQEDE++     +KR+ TWKRLEEIA   A SNE VLVS R A   TS
Sbjct  454  IDPELFEECLLNFQEDEAQASVKSLKRQNTWKRLEEIAAKNATSNEAVLVSPRGASGKTS  513

Query  399  G  397
            G
Sbjct  514  G  514



>ref|XP_007049146.1| Phosphatase 2A regulatory B subunit family protein, GAMMA [Theobroma 
cacao]
 gb|EOX93303.1| Phosphatase 2A regulatory B subunit family protein, GAMMA [Theobroma 
cacao]
Length=545

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  415  FQVAERALFLWNNDHIRNLITQNRKVILPIIFPALERNTRGHWNQAVQSLTLNVRKIFSD  474

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D  LF+ECL +FQEDE++E+E+  KRE TWKRLE++A   A SNE VLVS  V      
Sbjct  475  ADQSLFDECLARFQEDEAKEKEMLKKRELTWKRLEDVAASTAVSNEAVLVSRFVSSIAIA  534

Query  417  ---APRATSG  397
               +P+AT+G
Sbjct  535  TSTSPKATAG  544



>ref|XP_004239176.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Solanum lycopersicum]
Length=502

 Score =   181 bits (459),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLIKQ+RKVILPIIFPALE+N+R HWNQAV SL+LN+RK+F
Sbjct  383  LHFQVAERALFLWNNDHIENLIKQHRKVILPIIFPALERNARNHWNQAVHSLSLNIRKIF  442

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
             D+D ELF+ECLH FQEDE +E EIK KREATWKRLEE+A     SNE VLV
Sbjct  443  YDLDPELFKECLHNFQEDELKEDEIKSKREATWKRLEELAAKNTTSNEAVLV  494



>ref|XP_008444411.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
 ref|XP_008444412.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
Length=524

 Score =   181 bits (460),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 1/120 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIK+NRKVILPIIFPALEKN+  HWNQAV SLTLNVRK+F D
Sbjct  405  FQVAERALFLWNNDHIENLIKENRKVILPIIFPALEKNA-NHWNQAVHSLTLNVRKIFYD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D +L +ECL KFQEDE +E E+K +REATW RLEE+A  KAASNE VLVSH++  R  S
Sbjct  464  LDPDLLKECLVKFQEDELKENELKARREATWNRLEELAAKKAASNEAVLVSHKLPTRTAS  523



>ref|XP_008795966.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Phoenix dactylifera]
Length=527

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAER LFLWNNDH+ +LI QNRKVILPIIFPALE+N+R HW
Sbjct  381  CMVPLFRQIGRCLNSLHFQVAERTLFLWNNDHVRSLITQNRKVILPIIFPALERNTRGHW  440

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAVQSLTLNVRKLFSD D ELFEECL KFQEDE++E+E++  RE TWKRLE++A  KA 
Sbjct  441  NQAVQSLTLNVRKLFSDADQELFEECLLKFQEDEAKEREVQKTRELTWKRLEDVATSKAV  500

Query  450  SNEPVLVSHRV  418
            SNE VLVS  V
Sbjct  501  SNEAVLVSRIV  511



>ref|XP_009414678.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414679.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
Length=519

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KV+LPIIFPALE+N+++HWNQAVQSLTLNV K FSD
Sbjct  402  FQVAERALFLWNNDHIENLIKQNVKVLLPIIFPALERNAKSHWNQAVQSLTLNVSKFFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSH  424
             D ELF +CL K++EDE + +EI+ KRE TWKRLEEIA  KAASNEPVL+ H
Sbjct  462  NDPELFAKCLKKYEEDEVKGKEIQSKREVTWKRLEEIAATKAASNEPVLIPH  513



>ref|XP_009606776.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=513

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF    + +  L  QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HW
Sbjct  379  CMVPLFRRIAHCLTSLHFQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARNHW  438

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SL+LN+RK+F D+D +LF+ECLHKFQEDE +E EIK +REATWKRLE++A   + 
Sbjct  439  NQAVHSLSLNIRKIFYDLDPDLFKECLHKFQEDELKEDEIKSRREATWKRLEDVAAKNST  498

Query  450  SNEPVLV  430
            S E VLV
Sbjct  499  STEAVLV  505



>ref|XP_003601840.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Medicago truncatula]
 gb|AES72091.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=521

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQN KVILPIIFPALE+N++THWNQAV SLTLNV+K+F D
Sbjct  402  FQVAERALFLWNNDHIVNLIKQNCKVILPIIFPALERNTKTHWNQAVHSLTLNVQKIFHD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D +L++ECL KF++DES+E E+   REATWKRLEE+A  KAASNE VL+S +  PR ++
Sbjct  462  LDLDLYKECLQKFEQDESKEGEVTAGREATWKRLEEVAAKKAASNEAVLIS-KALPRKSA  520

Query  399  G  397
            G
Sbjct  521  G  521



>ref|XP_009371715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009371716.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=514

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNR V+LPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  394  FQVAERALFLWNNDHIANLIKQNRHVLLPIIFPSLEKNARNHWNQAVQSLTLNVRKIFSD  453

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL  F EDE++     +KR+ TWKRLEEIA   A SNE VLVS R A   TS
Sbjct  454  IDPELFEECLLNFHEDEAQASVKSLKRQNTWKRLEEIAAKNATSNEAVLVSPRGASGKTS  513

Query  399  G  397
            G
Sbjct  514  G  514



>ref|XP_011042316.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042318.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042319.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042320.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042321.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDH ENLI+QN K ILPIIFPALEKN R HWNQ VQSLT+NVRK+F+D
Sbjct  427  FQVAERALYLWNNDHTENLIRQNSKAILPIIFPALEKNGRNHWNQVVQSLTVNVRKIFAD  486

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL +FQE+E++ +EIK K+EATWKRLEEIA  KA S+E VLV   +   A+S
Sbjct  487  IDPELFEECLLQFQENEAKAEEIKTKQEATWKRLEEIAATKATSSEAVLVPWAIPALASS  546

Query  399  G  397
            G
Sbjct  547  G  547



>ref|XP_010531427.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Tarenaya hassleriana]
Length=520

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QN K ILPIIFPALEKNS +HWNQAV+SLTLNVRK+FSD
Sbjct  400  FQVAERALYLWNNDHIENLIRQNHKGILPIIFPALEKNSSSHWNQAVRSLTLNVRKIFSD  459

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECLHKF EDE + +EIK K+EATWKRLEE+A  K +S++ VL+  R+ P  +S
Sbjct  460  LDLELFEECLHKFHEDEEKSKEIKRKQEATWKRLEEMAATKISSSQAVLIP-RLVPAESS  518



>ref|XP_006852143.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Amborella trichopoda]
 gb|ERN13610.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
Length=528

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNRKVILPI+FPALE+N++ HWNQAVQSLTLNVRK+FSD
Sbjct  400  FQVAERALFLWNNDHILNLIKQNRKVILPIVFPALERNTKNHWNQAVQSLTLNVRKIFSD  459

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFE CL KF+EDE++++ I+ KREATWKRLE++A  +A SNE VL+   V     +
Sbjct  460  LDHELFEACLAKFREDEAKDEVIQEKREATWKRLEDVAASRAVSNEAVLIPQTVPLSKVA  519

Query  399  G  397
            G
Sbjct  520  G  520



>ref|XP_010044751.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 ref|XP_010044752.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 gb|KCW86862.1| hypothetical protein EUGRSUZ_B03453 [Eucalyptus grandis]
Length=524

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QN++VILPI+FPALE+N R HWNQ VQSLTLNVRK+FSD
Sbjct  403  FQVAERALYLWNNDHIENLIRQNQRVILPIVFPALERNCRNHWNQVVQSLTLNVRKIFSD  462

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQ+DE + +++K K EATWK+LE+IA  KAA+NE VLV + +  + +S
Sbjct  463  VDPELFEECLQKFQDDEEKAEDMKKKHEATWKQLEDIAATKAATNEAVLVPYVLPSQFSS  522

Query  399  G  397
             
Sbjct  523  S  523



>ref|XP_010927329.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Elaeis guineensis]
Length=542

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 8/129 (6%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI +LI QNRKVILPIIFPALE+++R HWNQ VQSLTLNVRKLF D
Sbjct  413  FQVAERALFLWNNDHIRSLITQNRKVILPIIFPALERSTRGHWNQVVQSLTLNVRKLFLD  472

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D ELFEECL +FQEDE++E+E++ KRE TWKRLE++A  KA SNE VLVS  V      
Sbjct  473  ADQELFEECLLRFQEDEAKEREVQKKRELTWKRLEDVAASKAVSNEAVLVSRIVSSLSMA  532

Query  417  --APRATSG  397
              +PRA  G
Sbjct  533  SSSPRAAVG  541



>ref|XP_010252513.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
 ref|XP_010252514.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
 ref|XP_010252515.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
 ref|XP_010252516.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
Length=553

 Score =   179 bits (454),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNRKVI PIIFPALE+N+R+HWNQAVQSLTLNVRK+F+D
Sbjct  423  FQVAERALFLWNNDHIRNLITQNRKVIFPIIFPALERNTRSHWNQAVQSLTLNVRKIFTD  482

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSH--------  424
             D ELFEEC  +F+EDE +E+E + KRE+TWKRLE++A  KA SNE VLVS         
Sbjct  483  ADPELFEECSIRFKEDELKEKETQEKRESTWKRLEDVAASKAISNEAVLVSRFASSLAIA  542

Query  423  -RVAPRATSG  397
                PRAT G
Sbjct  543  TSTTPRATVG  552



>ref|XP_011086721.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=509

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF    + +  L  QVAERALFLWNNDHIENLIKQNRKVILPIIFP+LEKN+R HW
Sbjct  382  CMVPLFHQISHSLNSLHFQVAERALFLWNNDHIENLIKQNRKVILPIIFPSLEKNARHHW  441

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D +LF+ C  KFQ DE++E E+K +REA WKRLEE+A  KAA
Sbjct  442  NQAVHSLTLNVRKIFYDLDPDLFKSCQIKFQNDEAKENEVKERREAIWKRLEEVAAEKAA  501

Query  450  SNEPVLV  430
            SN+P+LV
Sbjct  502  SNQPILV  508



>ref|XP_002514974.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47528.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=527

 Score =   179 bits (453),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI QNRKVILPIIFPALEKN+R HWNQAV+SLTLNVRK+F D
Sbjct  407  FQVAERALFLWNNDHIENLIIQNRKVILPIIFPALEKNARNHWNQAVRSLTLNVRKIFDD  466

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF ECLHKF+E E +E E K + EATW+RLE +A  K+++N   L+ H+  P  TS
Sbjct  467  LDPELFNECLHKFREAERKEDETKARCEATWRRLEGLAAQKSSNNIQALIPHKSVPHTTS  526

Query  399  G  397
            G
Sbjct  527  G  527



>emb|CBI28848.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN  VILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  345  FQVAERALFLWNNDHIRNLITQNCMVILPIIFPALERNARSHWNQAVQSLTLNVRKIFSD  404

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
             D  L +ECL KFQEDE++E+EI+ KRE+TWKRLE++A  KA SNE VLVS  V+     
Sbjct  405  QDQVLLDECLVKFQEDEAKEREIQEKRESTWKRLEDLAASKAVSNEAVLVSKFVSSVAIS  464

Query  414  ----PRATSG  397
                PR T+G
Sbjct  465  TSTNPRTTAG  474



>emb|CDP13292.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI+NLIKQNRK+ILPIIFPALE+N+R HWNQAV  LTLN+RK+F
Sbjct  396  LHFQVAERALFLWNNDHIDNLIKQNRKIILPIIFPALERNARHHWNQAVHGLTLNIRKIF  455

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
             D+D ELF+ECL KF+E  S+++EI+ KREATW RLEEIA  K ASNE VLVS    P  
Sbjct  456  YDLDPELFKECLLKFEEVVSKQEEIRAKREATWNRLEEIAAEKVASNEAVLVSQSSFPHL  515

Query  405  T  403
            T
Sbjct  516  T  516



>ref|XP_006447619.1| hypothetical protein CICLE_v10014856mg [Citrus clementina]
 ref|XP_006469633.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Citrus sinensis]
 gb|ESR60859.1| hypothetical protein CICLE_v10014856mg [Citrus clementina]
 gb|KDO54277.1| hypothetical protein CISIN_1g041798mg [Citrus sinensis]
Length=534

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 102/129 (79%), Gaps = 9/129 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI  NRKVILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  404  FQVAERALFLWNNDHIRNLINLNRKVILPIIFPALERNTRGHWNQAVQSLTLNVRKIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D  LF+ECL +FQEDE +E+E + KRE+TWKRLE++A  +A SNE VLVS  +      
Sbjct  464  ADQALFDECLARFQEDEMKEKETQEKRESTWKRLEDLAASRAVSNEAVLVSKFIYSVAVA  523

Query  417  ---APRATS  400
               +PRAT+
Sbjct  524  PSTSPRATA  532



>ref|XP_009402720.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402721.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402722.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KV+LPIIFPALE+N+RTHWNQAV+SLTLNV K+FSD
Sbjct  402  FQVAERALFLWNNDHIENLIKQNSKVLLPIIFPALERNTRTHWNQAVKSLTLNVCKIFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D +L  ECL KF+EDE++ +EI  KREATWKRLEE+A  +AAS E V V   V  RA S
Sbjct  462  HDPDLVAECLKKFEEDEAKNKEIMSKREATWKRLEEVAASRAASRESVTVPRVVPFRAAS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|XP_006830091.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Amborella trichopoda]
 gb|ERM97507.1| hypothetical protein AMTR_s00123p00060730 [Amborella trichopoda]
Length=550

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI +LI QNR+VILPIIFP+LE+N+R HWNQAVQSLTLNVRK+F+D
Sbjct  420  FQVAERALFLWNNDHILSLITQNRRVILPIIFPSLERNTRNHWNQAVQSLTLNVRKIFTD  479

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
            +D ELFEECL KFQEDE +E+E+  KRE+ WKRLE++A  KA SNE VLVS
Sbjct  480  VDYELFEECLLKFQEDEVKEKEMHEKRESAWKRLEDVAASKAVSNEAVLVS  530



>dbj|BAK05777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIE+LIKQN KVILPIIFPALE+NS  HWNQAVQSLTLNVRKLFSD
Sbjct  391  FQVAERSLFLWNNDHIESLIKQNSKVILPIIFPALERNSNGHWNQAVQSLTLNVRKLFSD  450

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA L+ ECL K++E +++E+E K+K+EATWKRLEEIA  +A S E VLV HR  PR +S
Sbjct  451  HDAGLYTECLRKYEEAKAKEKENKLKQEATWKRLEEIASSRATSGEAVLV-HRTLPRQSS  509

Query  399  G  397
             
Sbjct  510  A  510



>ref|XP_010657226.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Vitis vinifera]
 emb|CAN75915.1| hypothetical protein VITISV_022158 [Vitis vinifera]
Length=548

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 103/130 (79%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN  VILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  418  FQVAERALFLWNNDHIRNLITQNCMVILPIIFPALERNARSHWNQAVQSLTLNVRKIFSD  477

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
             D  L +ECL KFQEDE++E+EI+ KRE+TWKRLE++A  KA SNE VLVS  V+     
Sbjct  478  QDQVLLDECLVKFQEDEAKEREIQEKRESTWKRLEDLAASKAVSNEAVLVSKFVSSVAIS  537

Query  414  ----PRATSG  397
                PR T+G
Sbjct  538  TSTNPRTTAG  547



>ref|XP_011098818.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
 ref|XP_011098819.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
 ref|XP_011098820.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=524

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN+R HWNQAV SLTLNVR++FSD
Sbjct  404  FQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNARNHWNQAVHSLTLNVRRIFSD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +DAELFEECL KFQEDE++E+E K KRE  W+RLE++A +KA+SNE VLV  +++    S
Sbjct  464  VDAELFEECLLKFQEDEAQEEETKKKREERWRRLEDLATMKASSNEAVLVPLKISTYKPS  523

Query  399  G  397
            G
Sbjct  524  G  524



>dbj|BAJ97460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIE+LIKQN KVILPIIFPALE+NS  HWNQAVQSLTLNVRKLFSD
Sbjct  391  FQVAERSLFLWNNDHIESLIKQNSKVILPIIFPALERNSNGHWNQAVQSLTLNVRKLFSD  450

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA L+ ECL K++E +++E+E K+K+EATWKRLEEIA  +A S E VLV HR  PR +S
Sbjct  451  HDAGLYTECLRKYEEAKAKEKENKLKQEATWKRLEEIASSRATSGEAVLV-HRTLPRQSS  509

Query  399  G  397
             
Sbjct  510  A  510



>ref|XP_009411830.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  401  FQVAERALFLWNNDHIENLIKQNNKVILPIIFPALERNTRSHWNQAVQSLTLNVRKIFSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D EL  ECL KF+EDE+++++  MKREATWKRLEEIA  KA S + V++  R  P   S
Sbjct  461  HDPELVAECLKKFEEDEAKDKQYIMKREATWKRLEEIAASKAVSRDSVIIP-RTLPHQVS  519

Query  399  G  397
             
Sbjct  520  S  520



>ref|XP_006438130.1| hypothetical protein CICLE_v10031228mg [Citrus clementina]
 gb|ESR51370.1| hypothetical protein CICLE_v10031228mg [Citrus clementina]
Length=524

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALEKN+R HW
Sbjct  387  CMVPLFQQIARCLNSLHFQVAERALFLWNNDHIENLIIQNRKVILPIIFPALEKNARNHW  446

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D ELF+ECL KF+E ES+E EI+ +REATWKRLEE+A     
Sbjct  447  NQAVHSLTLNVRKIFFDLDPELFKECLAKFREYESKEGEIEARREATWKRLEELAEGNVP  506

Query  450  SNEPVLVSHRVAPRATSG  397
             N+ V V  +V P  +SG
Sbjct  507  INKLVPVPQKVQPSPSSG  524



>ref|XP_009411828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  401  FQVAERALFLWNNDHIENLIKQNNKVILPIIFPALERNTRSHWNQAVQSLTLNVRKIFSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D EL  ECL KF+EDE+++++  MKREATWKRLEEIA  KA S + V++  R  P   S
Sbjct  461  HDPELVAECLKKFEEDEAKDKQYIMKREATWKRLEEIAASKAVSRDSVIIP-RTLPHQVS  519

Query  399  G  397
             
Sbjct  520  S  520



>ref|XP_006484025.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Citrus sinensis]
 gb|KDO82044.1| hypothetical protein CISIN_1g009829mg [Citrus sinensis]
Length=524

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALEKN+R HW
Sbjct  387  CMVPLFQQIARCLNSLHFQVAERALFLWNNDHIENLIIQNRKVILPIIFPALEKNARNHW  446

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D ELF+ECL KF+E ES+E EI+ +REATWKRLEE+A     
Sbjct  447  NQAVHSLTLNVRKIFFDLDPELFKECLAKFREYESKEGEIEARREATWKRLEELAEGNVP  506

Query  450  SNEPVLVSHRVAPRATSG  397
             N+ V V  +V P  +SG
Sbjct  507  INKLVPVPQKVQPSPSSG  524



>ref|XP_007222861.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
 gb|EMJ24060.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
Length=520

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QNRKVILPIIFPALEKN+R HWNQAV SLTLNV K+F D
Sbjct  402  FQVAERALFLWNNDHIENLIRQNRKVILPIIFPALEKNARNHWNQAVHSLTLNVHKIFQD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRAT  403
            +D EL++ECL +F+EDES+E+E+K +R+ATWKRLEEIA  KAASNEPVLV  +  PR++
Sbjct  462  LDPELYKECLLQFEEDESKEEEVKARRDATWKRLEEIAAKKAASNEPVLVFGKAPPRSS  520



>ref|XP_006650885.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Oryza brachyantha]
Length=517

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN +VILPIIFPALE+N+  HWNQAVQSLTLNVRKLFSD
Sbjct  397  FQVAERALFLWNNDHIENLIKQNSRVILPIIFPALERNANGHWNQAVQSLTLNVRKLFSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA L++EC  K++ED+++E+E+K+K++  WKRLEE+A  KA S   VLVS R  PR +S
Sbjct  457  HDAGLYDECQRKYEEDKTKEKEMKLKQQVAWKRLEEMASAKATSGAAVLVS-RTLPRQSS  515

Query  399  G  397
            G
Sbjct  516  G  516



>emb|CBI27539.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIENLIKQNR +ILPIIFPALEKN+R HWNQAV  LTLNVRK+F D
Sbjct  341  FQVAERALFLWNNGHIENLIKQNRGIILPIIFPALEKNARNHWNQAVHGLTLNVRKIFFD  400

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
            +D EL++ECL KFQEDES+E EIK KREA WK LEE+A  + ASNE VLV
Sbjct  401  LDPELYKECLLKFQEDESKEDEIKAKREAAWKLLEEMAAKRVASNEAVLV  450



>ref|XP_003524485.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Glycine max]
 gb|KHN27624.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Glycine soja]
Length=534

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE LIKQN K+ILPI+ PALE N+R HWNQAVQSLT+NVRK+F D
Sbjct  406  FQVAERALFLWNNDHIETLIKQNHKIILPIVLPALEHNARNHWNQAVQSLTINVRKIFVD  465

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D E +EEC+ K +E+E++E+++K KREA WKRLEE+ G+KA +NE VLVS R A    S
Sbjct  466  TDPEFYEECMIKVRENEAQEKDMKSKREARWKRLEEMGGMKATTNEAVLVSPRTASHTPS  525

Query  399  G  397
            G
Sbjct  526  G  526



>ref|XP_009411832.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=513

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N+R+HWNQAVQSLTLNVRK+FSD
Sbjct  401  FQVAERALFLWNNDHIENLIKQNNKVILPIIFPALERNTRSHWNQAVQSLTLNVRKIFSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHR  421
             D EL  ECL KF+EDE+++++  MKREATWKRLEEIA  KA   +P +++ R
Sbjct  461  HDPELVAECLKKFEEDEAKDKQYIMKREATWKRLEEIAASKAVLEDPEVITAR  513



>gb|KEH25426.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=523

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN K+ILPI+ PALE+N+R+HWNQAV+SLT+NV K+FSD
Sbjct  396  FQVAERALFLWNNDHIENLIKQNYKIILPIVLPALEQNARSHWNQAVRSLTINVSKIFSD  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D   +EEC+ KF+EDE++  ++K K EA WKRLEE+ G+K A NEPVLVS R    ATS
Sbjct  456  TDPAFYEECMTKFREDEAQANDMKSKHEARWKRLEEMGGMKVAINEPVLVSPRT--HATS  513

Query  399  G  397
            G
Sbjct  514  G  514



>ref|XP_008379151.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=515

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNR V+LPIIFP+LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  395  FQVAERALFLWNNDHIVNLIKQNRHVLLPIIFPSLEKNARNHWNQAVQSLTLNVRKIFSD  454

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KF EDE++E     KR  TWKRLEE+A   A SNE VLVS + A    S
Sbjct  455  IDPELFEECLLKFXEDEAQETVNSEKRHDTWKRLEELAAKNATSNEAVLVSPKGAXXKPS  514

Query  399  G  397
            G
Sbjct  515  G  515



>ref|XP_009412705.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KVILPIIFPALEKN+++HWNQAVQSLTLNVRK+F+D
Sbjct  377  FQVAERALFLWNNDHIENLIKQNSKVILPIIFPALEKNTKSHWNQAVQSLTLNVRKIFTD  436

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE----PVLVSHRV  418
             D +L  ECL KF+EDE++++EI+ K EATWKRLEEIA  KAAS E    P  + H+V
Sbjct  437  HDPDLVSECLKKFEEDEAKDKEIRSKGEATWKRLEEIAASKAASRESAIDPRTIPHQV  494



>ref|XP_002266932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Vitis vinifera]
Length=515

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIENLIKQNR +ILPIIFPALEKN+R HWNQAV  LTLNVRK+F D
Sbjct  405  FQVAERALFLWNNGHIENLIKQNRGIILPIIFPALEKNARNHWNQAVHGLTLNVRKIFFD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
            +D EL++ECL KFQEDES+E EIK KREA WK LEE+A  + ASNE VLV
Sbjct  465  LDPELYKECLLKFQEDESKEDEIKAKREAAWKLLEEMAAKRVASNEAVLV  514



>ref|XP_007151564.1| hypothetical protein PHAVU_004G057400g [Phaseolus vulgaris]
 gb|ESW23558.1| hypothetical protein PHAVU_004G057400g [Phaseolus vulgaris]
Length=536

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI  LIKQN K+ILPI+ PALE+N+R HWNQAVQSLT+NVRK+F+D
Sbjct  408  FQVAERALFLWNNDHIGTLIKQNHKIILPIVLPALEQNARNHWNQAVQSLTINVRKIFAD  467

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D E +EEC+ K +E E++E+++K KREA WKRLEE+ G+KA +NE VLVS R A    S
Sbjct  468  TDPEFYEECMMKVRESEAQEKDMKSKREARWKRLEEMGGMKATTNEAVLVSPRTASHTPS  527

Query  399  G  397
            G
Sbjct  528  G  528



>emb|CAN66032.1| hypothetical protein VITISV_019650 [Vitis vinifera]
Length=535

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIENLIKQNR +ILPIIFPALEKN+R HWNQAV  LTLNVRK+F D
Sbjct  425  FQVAERALFLWNNGHIENLIKQNRGIILPIIFPALEKNARNHWNQAVHGLTLNVRKIFFD  484

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
            +D EL++ECL KFQEDES+E EIK KREA WK LEE+A  + ASNE VLV
Sbjct  485  LDPELYKECLLKFQEDESKEDEIKAKREAAWKLLEEMAAKRVASNEAVLV  534



>ref|XP_009412704.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN KVILPIIFPALEKN+++HWNQAVQSLTLNVRK+F+D
Sbjct  402  FQVAERALFLWNNDHIENLIKQNSKVILPIIFPALEKNTKSHWNQAVQSLTLNVRKIFTD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE----PVLVSHRV  418
             D +L  ECL KF+EDE++++EI+ K EATWKRLEEIA  KAAS E    P  + H+V
Sbjct  462  HDPDLVSECLKKFEEDEAKDKEIRSKGEATWKRLEEIAASKAASRESAIDPRTIPHQV  519



>ref|XP_011047218.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Populus euphratica]
Length=541

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILPIIFPALE+N+R HWNQAVQSLTLNVRK+FSD
Sbjct  411  FQVAERALFLWNNDHIRNLITQNRRVILPIIFPALERNTRGHWNQAVQSLTLNVRKIFSD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHR-------  421
             D ELF+ECL KF+EDE ++ E + KRE TWKRLE++A  KA SNE VLVS         
Sbjct  471  ADQELFDECLVKFEEDEVKQMETREKRELTWKRLEDLATSKAVSNEAVLVSSSVSSIAIA  530

Query  420  --VAPRATSG  397
               +PR T+G
Sbjct  531  TGTSPRTTAG  540



>ref|XP_008222034.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QNRKVILPIIFPALEKN+R HWNQAV SLTLNV K+F D
Sbjct  402  FQVAERALFLWNNDHIENLIRQNRKVILPIIFPALEKNARNHWNQAVHSLTLNVHKIFQD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRAT  403
            +D EL++ECL +F+EDES+E+E+K +R ATW+RLEEIA  KAASNEPVLV  +  PR++
Sbjct  462  LDPELYKECLLQFEEDESKEEEVKARRNATWRRLEEIAAKKAASNEPVLVFGKAPPRSS  520



>gb|EMT26962.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Aegilops tauschii]
Length=513

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIE LIKQN KVILPIIFPALE+NS  HWN AVQSLTLNVRKLFSD
Sbjct  393  FQVAERSLFLWNNDHIEGLIKQNSKVILPIIFPALERNSSGHWNPAVQSLTLNVRKLFSD  452

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA L+ ECL K++E +++E+E K+K+EATWKRLEEIA  +A S E VLV HR  PR +S
Sbjct  453  HDAGLYTECLRKYEEAKAKEKENKLKQEATWKRLEEIASSRATSGEAVLV-HRTLPRQSS  511

Query  399  G  397
             
Sbjct  512  A  512



>ref|XP_011470807.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 8/129 (6%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI  LI QNR+VILPIIFPA+E+N+R+HWNQAV+SLTLNVRK+FSD
Sbjct  397  FQVAERALFLWNNDHIRTLITQNRQVILPIIFPAMEENARSHWNQAVRSLTLNVRKIFSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA-----  415
            ID ELF+ECL  FQEDE++E+E + KRE+TWKRLE +A  K+ +NE  LVS   +     
Sbjct  457  IDQELFDECLATFQEDETKEKETQEKRESTWKRLEAVASSKSLNNEADLVSRFASNAIST  516

Query  414  ---PRATSG  397
               PR TSG
Sbjct  517  SQKPRTTSG  525



>gb|KJB78043.1| hypothetical protein B456_012G174400 [Gossypium raimondii]
 gb|KJB78044.1| hypothetical protein B456_012G174400 [Gossypium raimondii]
 gb|KJB78045.1| hypothetical protein B456_012G174400 [Gossypium raimondii]
Length=520

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALEKN+R HW
Sbjct  383  CMMPLFRQIARCLNSLHFQVAERALFLWNNDHIENLIIQNRKVILPIIFPALEKNARNHW  442

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F+D+D ELF+ECL KFQEDES+E E + KRE TWKRLEE+A  KA 
Sbjct  443  NQAVHSLTLNVRKIFNDLDPELFKECLLKFQEDESKEDETEAKRENTWKRLEELAEKKAF  502

Query  450  SNEPVLVSHRVAPRATSG  397
             +E  + +       +SG
Sbjct  503  HSEATVETSESMANGSSG  520



>gb|EMS66139.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Triticum urartu]
Length=593

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIE+LIKQN KVILPIIFPALE+NS  HWN AVQSLTLNVRKLFSD
Sbjct  473  FQVAERSLFLWNNDHIESLIKQNSKVILPIIFPALERNSSGHWNPAVQSLTLNVRKLFSD  532

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA L+ ECL K++E +++E+E K+K+EATWKRLEEIA  +A S E VLV HR  PR +S
Sbjct  533  HDAGLYTECLRKYEEAKAKEKENKLKQEATWKRLEEIASSRATSGEAVLV-HRTLPRQSS  591

Query  399  G  397
             
Sbjct  592  A  592



>gb|KJB10684.1| hypothetical protein B456_001G216400 [Gossypium raimondii]
Length=544

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 11/147 (7%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNNDHI NLI QNR VILPIIFPALE+N+R HW
Sbjct  397  CMVPLFRQIGRCLNSLHFQVAERALFLWNNDHIRNLITQNRTVILPIIFPALERNTRGHW  456

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            N AVQSLTLNVRK+FSD D  +F+ECL ++QEDE++++E++ KRE TWKRLE++A  K  
Sbjct  457  NPAVQSLTLNVRKIFSDADQAIFDECLARYQEDEAKQKELQEKRELTWKRLEDVAASKVV  516

Query  450  SNEPVLVSHRV---------APRATSG  397
            SNE V+VS  +         AP+AT+ 
Sbjct  517  SNEAVMVSKSISSIAIDKSTAPKATAS  543



>gb|KHG18630.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
gamma-like protein [Gossypium arboreum]
Length=544

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 11/147 (7%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNNDHI NLI QNR VILPIIFPALE+N+R HW
Sbjct  397  CMVPLFRQIGRCLNSLHFQVAERALFLWNNDHIRNLITQNRTVILPIIFPALERNTRGHW  456

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            N AVQSLTLNVRK+FSD D  +F+ECL ++QEDE++++E++ KRE TWKRLE++A  K  
Sbjct  457  NPAVQSLTLNVRKIFSDADQAIFDECLARYQEDEAKQKELQEKRELTWKRLEDVAASKVV  516

Query  450  SNEPVLVSHRV---------APRATSG  397
            SNE V+VS  +         AP+AT+ 
Sbjct  517  SNEAVMVSKSISSIAIDRGTAPKATAS  543



>ref|XP_007044972.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 ref|XP_007044973.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY00804.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY00805.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
Length=523

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LW+NDHIENLI+QNR+VILPIIFPALEKN   HWNQ VQSLT NVRK+FSD
Sbjct  405  FQVAERALYLWSNDHIENLIRQNRRVILPIIFPALEKNGHNHWNQVVQSLTHNVRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRAT  403
            ID ELFEECL+KF+EDE +  EIK K EATWKRLE+IA    A+ E  LV H VA R +
Sbjct  465  IDPELFEECLNKFREDEEKLGEIKTKHEATWKRLEDIAVSNTANGEAGLVPHIVASRIS  523



>ref|XP_011029624.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=526

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDH ENLI+QN K ILPIIFPALEKN R HWNQ VQSLT+NVRK+F+D
Sbjct  406  FQVAERALYLWNNDHTENLIRQNSKAILPIIFPALEKNGRNHWNQVVQSLTVNVRKIFAD  465

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
             D ELFE+CL +FQE+E++ +E K K+EATWKRLEEIA  KAAS+E VLV
Sbjct  466  ADPELFEQCLCRFQENEAKAEEFKTKQEATWKRLEEIAATKAASSEAVLV  515



>ref|XP_010907766.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Elaeis guineensis]
Length=515

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN KV+LPIIFPALE+N+++HWNQAVQSLTLNVRK+FSD
Sbjct  402  FQVAERALFLWNNDHIESLIKQNCKVVLPIIFPALERNTKSHWNQAVQSLTLNVRKIFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE  442
             D ELF ECL KF+EDES+++EIK +REA WKRLEEIA  KAAS +
Sbjct  462  HDPELFTECLKKFEEDESKKEEIKSRREAAWKRLEEIATSKAASPQ  507



>ref|XP_010234950.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Brachypodium distachyon]
Length=517

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIENLIKQN KVILPIIFPALE+N+  HWNQ VQSLTLNV KLFSD
Sbjct  397  FQVAERSLFLWNNDHIENLIKQNSKVILPIIFPALERNTSGHWNQVVQSLTLNVCKLFSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA L+ ECL K++E +++E+E K+K+EATWKRLEEIA  KA S E VLVS R  PR +S
Sbjct  457  HDAVLYNECLRKYEEAKAKEKETKLKQEATWKRLEEIASAKATSGEAVLVS-RNLPRQSS  515

Query  399  G  397
             
Sbjct  516  A  516



>gb|KHN44403.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Glycine soja]
Length=521

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI +LIKQNRKVILPIIFPALE+N+R+HWNQAV  LTLNVRK+F+D
Sbjct  402  FQVAERALFLWNNDHIMSLIKQNRKVILPIIFPALERNARSHWNQAVHGLTLNVRKVFND  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D +L +ECL KF+EDES++ E+   REATWKRLEE+A  KAAS E VL+  +   R ++
Sbjct  462  VDPDLSKECLQKFEEDESKKSEVIAGREATWKRLEELAAKKAASGEAVLIG-KAPTRNSA  520

Query  399  G  397
            G
Sbjct  521  G  521



>ref|XP_003538573.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Glycine max]
Length=521

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI +LIKQNRKVILPIIFPALE+N+R+HWNQAV  LTLNVRK+F+D
Sbjct  402  FQVAERALFLWNNDHIMSLIKQNRKVILPIIFPALERNARSHWNQAVHGLTLNVRKVFND  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D +L +ECL KF+EDES++ E+   REATWKRLEE+A  KAAS E VL+  +   R ++
Sbjct  462  VDPDLSKECLQKFEEDESKKSEVIAGREATWKRLEELAAKKAASGEAVLIG-KAPTRNSA  520

Query  399  G  397
            G
Sbjct  521  G  521



>ref|XP_002311731.1| hypothetical protein POPTR_0008s18010g [Populus trichocarpa]
 gb|EEE89098.1| hypothetical protein POPTR_0008s18010g [Populus trichocarpa]
Length=522

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNND IENLI QNRKVILPIIFPALEKN R HWNQAV+SLTLNVRK+F D
Sbjct  402  FQVAERALFLWNNDPIENLIIQNRKVILPIIFPALEKNVRNHWNQAVRSLTLNVRKIFED  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF ECL KFQEDE +E EIK + EA WKRLEEIA  KAAS+  V+   +    + S
Sbjct  462  LDHELFNECLLKFQEDEEKEVEIKARSEAAWKRLEEIATQKAASDAMVVAPRKALTCSAS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|XP_011021368.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021369.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021370.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042310.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042311.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042312.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=507

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNND IENLI QNRKVILPIIFPALEKN+R HWNQAV+SLTLNVRK+F D
Sbjct  396  FQVAERALFLWNNDPIENLIIQNRKVILPIIFPALEKNARNHWNQAVRSLTLNVRKIFED  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
            +D ELF ECL KFQEDE +E EIK + EA WKRLEEIA  K AS++ V+V
Sbjct  456  LDHELFNECLLKFQEDEKKEVEIKARSEAAWKRLEEIAAQKTASDDTVVV  505



>ref|NP_001060884.1| Os08g0122000 [Oryza sativa Japonica Group]
 emb|CAC85922.1| putative protein phosphatase 2A B'teta subunit [Oryza sativa 
Japonica Group]
 dbj|BAD10591.1| putative B' regulatory subunit of PP2A (AtB'gamma) [Oryza sativa 
Japonica Group]
 dbj|BAD10800.1| putative B' regulatory subunit of PP2A (AtB'gamma) [Oryza sativa 
Japonica Group]
 dbj|BAD10832.1| putative B' regulatory subunit of PP2A (AtB'gamma) [Oryza sativa 
Japonica Group]
 dbj|BAF22798.1| Os08g0122000 [Oryza sativa Japonica Group]
 gb|EEE67962.1| hypothetical protein OsJ_25866 [Oryza sativa Japonica Group]
Length=516

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 7/136 (5%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C +SLFC     +     QVAERALFLWNNDHIE LIKQN KVILPII PA+E+N++ HW
Sbjct  384  CMVSLFCQIARCLNSSHFQVAERALFLWNNDHIEVLIKQNSKVILPIILPAIERNTKEHW  443

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAVQSL+LNVRK+F D D  LFEECL KF+EDE++E  ++ KREATWKRLEEIA  K  
Sbjct  444  NQAVQSLSLNVRKIFMDHDPVLFEECLKKFEEDEAKETALRSKREATWKRLEEIASSKTI  503

Query  450  SNEPVLVSHRVAPRAT  403
            S+EP      V P AT
Sbjct  504  SSEPA-----VPPEAT  514



>ref|XP_002314558.1| hypothetical protein POPTR_0010s06450g [Populus trichocarpa]
 gb|EEF00729.1| hypothetical protein POPTR_0010s06450g [Populus trichocarpa]
Length=507

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNND IENLI QNRKVILPIIFPALEKN+R HWNQAV+SLTLNVRK+F D
Sbjct  396  FQVAERALFLWNNDPIENLIIQNRKVILPIIFPALEKNARNHWNQAVRSLTLNVRKIFED  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
            +D ELF ECL KFQEDE +E EIK + EA WKRLEEIA  K AS++ V+V
Sbjct  456  LDHELFNECLLKFQEDEKKEVEIKARSEAAWKRLEEIAAQKTASDDTVVV  505



>gb|AAM61625.1| B regulatory subunit of protein phosphatase 2A, putative [Arabidopsis 
thaliana]
Length=492

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HW
Sbjct  370  CMVPLFRQVARCLNSLHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHW  429

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNV+K+F+DIDAELF++CL KF+EDES+E EI  KREATWKRLEEI   K  
Sbjct  430  NQAVHSLTLNVQKIFNDIDAELFKDCLAKFREDESKEAEIGAKREATWKRLEEIGNQKKK  489

Query  450  SN  445
            S+
Sbjct  490  SS  491



>ref|XP_006307325.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
 gb|EOA40223.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
Length=495

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  388  LHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  447

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +DIDAELF++CL KF+EDES+E EI  KREATWKRLEEI   K  S+
Sbjct  448  NDIDAELFKDCLGKFREDESKEAEIGAKREATWKRLEEIGNQKQKSS  494



>ref|NP_172803.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 ref|NP_973816.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 sp|Q8LF36.2|2A5T_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' theta isoform; Short=AtB' theta; Short=PP2A, 
B' subunit, theta isoform [Arabidopsis thaliana]
 gb|AAG09562.1|AC011810_21 Putative protein phosphatase 2A regulatory subunit B [Arabidopsis 
thaliana]
 gb|ABH04491.1| At1g13460 [Arabidopsis thaliana]
 gb|AEE29021.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 gb|AEE29022.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
Length=492

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  385  LHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  444

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +DIDAELF++CL KF+EDES+E EI  KREATWKRLEEI   K  S+
Sbjct  445  NDIDAELFKDCLAKFREDESKEAEIGAKREATWKRLEEIGNQKQKSS  491



>ref|XP_010458797.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Camelina sativa]
Length=490

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  383  LHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  442

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D+DA+LF+ECL KF+EDES+E EI  KREATWKRLEEI   K  S+
Sbjct  443  NDVDADLFKECLGKFREDESKESEIGAKREATWKRLEEIGNQKQKSS  489



>ref|XP_003553878.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Glycine max]
 ref|XP_006604098.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Glycine max]
Length=536

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE LIKQN K+ILP++ PALE N+R HWNQAVQSLT+NVRK+F+D
Sbjct  408  FQVAERALFLWNNDHIETLIKQNYKIILPVVLPALEYNARNHWNQAVQSLTINVRKIFAD  467

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D E +EE + K +E+E++E+++K KREA WKRLE++ G+KA +NE VLVS R A    S
Sbjct  468  TDPEFYEEYMIKVRENEAQEKDMKSKREARWKRLEDMGGMKATTNEAVLVSPRTASHTPS  527

Query  399  G  397
            G
Sbjct  528  G  528



>gb|KHN30494.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Glycine soja]
Length=536

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE LIKQN K+ILP++ PALE N+R HWNQAVQSLT+NVRK+F+D
Sbjct  408  FQVAERALFLWNNDHIETLIKQNYKIILPVVLPALEYNARNHWNQAVQSLTINVRKIFAD  467

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D E +EE + K +E+E++E+++K KREA WKRLE++ G+KA +NE VLVS R A    S
Sbjct  468  TDPEFYEEYMIKVRENEAQEKDMKSKREARWKRLEDMGGMKATTNEAVLVSPRTASHTPS  527

Query  399  G  397
            G
Sbjct  528  G  528



>ref|XP_004310036.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Fragaria vesca subsp. vesca]
Length=514

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN+HIENLIKQNR VILPIIFPALEKN R+HWNQAV SL+LN+RK+FSD
Sbjct  405  FQVAERALFLWNNEHIENLIKQNRNVILPIIFPALEKNGRSHWNQAVHSLSLNIRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE  442
             D EL EECL KFQEDE++ +EIK K+E TWKRLEEIA  KA S +
Sbjct  465  ADPELVEECLLKFQEDEAKMEEIKRKQETTWKRLEEIAASKAVSGK  510



>ref|XP_002890006.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66265.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  388  LHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  447

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +DIDAELF+ECL KF+EDES+E EI  KRE+TWKRLEEI   K  S+
Sbjct  448  NDIDAELFKECLAKFREDESKEAEIDAKRESTWKRLEEIGNQKQKSS  494



>ref|XP_009418105.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 99/127 (78%), Gaps = 5/127 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNRKV+LPIIFP+LE+N+R+HWNQAVQSLTLNVRKL  D
Sbjct  386  FQVAERALFLWNNDHIRNLIIQNRKVVLPIIFPSLERNNRSHWNQAVQSLTLNVRKLLLD  445

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ELF ECL KF++D+++E+  + KRE TWKRLEE+A  +A SNE VLVS     R  S
Sbjct  446  ADQELFNECLLKFEQDDTKEKAAQEKRELTWKRLEEVAATRAISNEAVLVS-----RIVS  500

Query  399  G*RLGNP  379
              R+  P
Sbjct  501  SLRIAAP  507



>ref|XP_008222035.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLIKQNRKVI+PIIFPALEKN R HWNQ  +SLTLNVRK++SD
Sbjct  401  FQVAERALYLWNNDHIENLIKQNRKVIVPIIFPALEKNGRYHWNQVARSLTLNVRKIYSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE+  +EIK K E TWKRLEE A   A S+  V+  H + P  TS
Sbjct  461  VDPELFEECLLKFQEDEANMEEIKTKHETTWKRLEESAASNAVSSGAVV--HCLNPIETS  518

Query  399  G  397
             
Sbjct  519  S  519



>ref|XP_008389803.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=516

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIE+LI+QNRKVILPIIFPALEKN   HWNQ  + LTLN+RK++SD
Sbjct  397  FQVAERALYLWNNDHIEDLIRQNRKVILPIIFPALEKNGHNHWNQVARRLTLNIRKIYSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE++E+EIK K  ATWK LEEIA   A S+E V+   R+ P  TS
Sbjct  457  IDPELFEECLLKFQEDEAKEEEIKAKHVATWKHLEEIAASNAVSSEAVV--GRLDPTQTS  514



>gb|KJB31018.1| hypothetical protein B456_005G172800 [Gossypium raimondii]
 gb|KJB31019.1| hypothetical protein B456_005G172800 [Gossypium raimondii]
 gb|KJB31020.1| hypothetical protein B456_005G172800 [Gossypium raimondii]
Length=523

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIE+LI+QNR+VILPIIFPALE+N   HWNQ VQSLTLNVRK+FSD
Sbjct  405  FQVAERALYLWNNDHIESLIRQNRRVILPIIFPALEQNGHNHWNQVVQSLTLNVRKIFSD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA  415
             D ELFEECL+KF+E+  + +EIK K EA WKR+EEIA   AA+ E VLV H VA
Sbjct  465  TDPELFEECLNKFRENTEKWEEIKTKHEAAWKRIEEIAVSNAANGEAVLVPHVVA  519



>ref|XP_008350950.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=514

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIE+LI+QNRKVILPIIFPALEKN   HWNQ  + LTLN+RK++SD
Sbjct  395  FQVAERALYLWNNDHIEDLIRQNRKVILPIIFPALEKNGHNHWNQVARRLTLNIRKIYSD  454

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            ID ELFEECL KFQEDE++E+EIK K  ATWK LEEIA   A S+E V+   R+ P  TS
Sbjct  455  IDPELFEECLLKFQEDEAKEEEIKAKHVATWKHLEEIAASNAVSSEAVV--GRLDPTQTS  512



>ref|XP_009385575.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
Length=519

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIENLIKQN KV+LPIIFP LE+N++ HWNQAVQSLTLNV ++FSD
Sbjct  402  FQVAERSLFLWNNDHIENLIKQNDKVLLPIIFPLLERNAKCHWNQAVQSLTLNVCEIFSD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
             + ELF +CL KF+EDE + +EI++KRE+TWKR+EE+A  KAASNEPVL+
Sbjct  462  NNHELFADCLKKFEEDEVKGKEIQLKRESTWKRVEELATTKAASNEPVLI  511



>ref|XP_010556177.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Tarenaya hassleriana]
Length=516

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVILPIIFP+LEKNS +HWNQ VQSLTLNVRK+FSD
Sbjct  398  FQVAERALYLWNNDHIENLIRQNRKVILPIIFPSLEKNSSSHWNQVVQSLTLNVRKIFSD  457

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
            +D ELFEECL KF+EDE + +E + KREATWKRLE++A  KA+S+E VLV   V  ++
Sbjct  458  LDPELFEECLQKFREDEEKSEETERKREATWKRLEDMAATKASSSEAVLVPRPVPAKS  515



>ref|XP_010476343.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Camelina sativa]
Length=503

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  384  LHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  443

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D+DA+LF+ECL KF+EDES+E EI  KREATWKRLEEI   K  S+
Sbjct  444  NDVDADLFKECLGKFREDESKEAEIGAKREATWKRLEEIGDQKQKSS  490



>ref|XP_010495328.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Camelina sativa]
 ref|XP_010495335.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Camelina sativa]
Length=485

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  378  LHFQVAERALFLWNNDHIENLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  437

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D+DA+LF+ECL KF+EDES+E EI  KREATWKRLE+I   K  S+
Sbjct  438  NDVDADLFKECLGKFREDESKEAEIGAKREATWKRLEDIGNQKQKSS  484



>ref|XP_002301608.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEE80881.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=514

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LFLWNNDHI NLI QNR+VILPIIFPALE+N+R HWNQAVQSLTLNV+K+FSD
Sbjct  384  FQVAERTLFLWNNDHIRNLITQNRRVILPIIFPALERNTRGHWNQAVQSLTLNVKKIFSD  443

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D E+F+ECL KF+EDE ++ E + KR+ TWK LE++A  K  SNE VLVS  +      
Sbjct  444  ADQEIFDECLVKFEEDEVKQMETREKRDLTWKCLEDVATSKVVSNEAVLVSKFISSVAIA  503

Query  417  ---APRATSG  397
               +PRAT+ 
Sbjct  504  SGTSPRATAA  513



>gb|EYU44815.1| hypothetical protein MIMGU_mgv1a005633mg [Erythranthe guttata]
Length=476

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNN HIENLIKQNRK+ILPIIFPALEKNSR HWNQAVQSLTLNVRK+F+D
Sbjct  374  FQVAERALFLWNNGHIENLIKQNRKIILPIIFPALEKNSRNHWNQAVQSLTLNVRKIFAD  433

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKA  454
            +D  LF+ECL KFQ+DE RE+E   KR+ TW RLEEIA +K+
Sbjct  434  VDPVLFDECLLKFQQDEKREEETNTKRKETWLRLEEIAAMKS  475



>ref|XP_007222857.1| hypothetical protein PRUPE_ppa004253mg [Prunus persica]
 gb|EMJ24056.1| hypothetical protein PRUPE_ppa004253mg [Prunus persica]
Length=520

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVI+PIIFPALEKN R HWNQ  +SLTLNVRK++SD
Sbjct  401  FQVAERALYLWNNDHIENLIRQNRKVIVPIIFPALEKNGRYHWNQVARSLTLNVRKIYSD  460

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQEDE+  +EIK K E TWKRLEE A   A S+  V+   R+ P  TS
Sbjct  461  VDPELFEECLLKFQEDEANMEEIKTKHETTWKRLEESAASNAVSSGAVV--RRLNPIETS  518

Query  399  G  397
             
Sbjct  519  S  519



>ref|XP_006386782.1| hypothetical protein POPTR_0002s21550g [Populus trichocarpa]
 gb|ABK95558.1| unknown [Populus trichocarpa]
 gb|ERP64579.1| hypothetical protein POPTR_0002s21550g [Populus trichocarpa]
Length=541

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 9/130 (7%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LFLWNNDHI NLI QNR+VILPIIFPALE+N+R HWNQAVQSLTLNV+K+FSD
Sbjct  411  FQVAERTLFLWNNDHIRNLITQNRRVILPIIFPALERNTRGHWNQAVQSLTLNVKKIFSD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRV------  418
             D E+F+ECL KF+EDE ++ E + KR+ TWK LE++A  K  SNE VLVS  +      
Sbjct  471  ADQEIFDECLVKFEEDEVKQMETREKRDLTWKCLEDVATSKVVSNEAVLVSKFISSVAIA  530

Query  417  ---APRATSG  397
               +PRAT+ 
Sbjct  531  SGTSPRATAA  540



>ref|XP_004502334.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cicer arietinum]
Length=526

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQN KVILPI+FPALE+N +THWNQAV SLTLNV+K+F D
Sbjct  407  FQVAERALFLWNNDHIVNLIKQNCKVILPIMFPALERNIKTHWNQAVHSLTLNVQKIFHD  466

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D +L++ECL KF++DES+E E+   REATW+RLEE+A  KA S+E VLV  +   R ++
Sbjct  467  FDPDLYKECLQKFEQDESKEGEVTAGREATWRRLEELAAKKATSSEAVLVG-KALTRKSA  525

Query  399  G  397
            G
Sbjct  526  G  526



>ref|XP_004243528.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Solanum lycopersicum]
Length=545

 Score =   168 bits (425),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILP+IFP LEKN+R HWNQAVQSLTLNVRK+FSD
Sbjct  422  FQVAERALFLWNNDHIRNLIVQNREVILPLIFPLLEKNTRGHWNQAVQSLTLNVRKIFSD  481

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KF+EDE +++E + KRE TWKRLE+IA     SNE VL+S
Sbjct  482  ADQALFDECLEKFKEDERKDKETQEKRELTWKRLEDIAASNFVSNEAVLIS  532



>ref|NP_001051871.1| Os03g0844500 [Oryza sativa Japonica Group]
 emb|CAC85921.1| putative protein phosphatase 2A B'zeta subunit [Oryza sativa 
Japonica Group]
 gb|AAS07368.1| putative B' regulatory subunit of protein phosphatase [Oryza 
sativa Japonica Group]
 gb|ABF99851.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99852.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13785.1| Os03g0844500 [Oryza sativa Japonica Group]
 gb|EEC76514.1| hypothetical protein OsI_14291 [Oryza sativa Indica Group]
 gb|EEE60283.1| hypothetical protein OsJ_13339 [Oryza sativa Japonica Group]
Length=517

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLIKQN +VILPIIFPALE+N+  HWNQAVQSLTLNVRKLFSD
Sbjct  397  FQVAERALFLWNNDHIENLIKQNSRVILPIIFPALERNANGHWNQAVQSLTLNVRKLFSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  +++EC  K+++++++E+E K+K+E  WKRLEE+A  KA S   VLVS R  PR +S
Sbjct  457  HDVGVYDECQRKYEDEKAKEKETKLKQEVAWKRLEEMASAKATSGAAVLVS-RTLPRQSS  515

Query  399  G  397
             
Sbjct  516  A  516



>ref|XP_011005899.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Populus euphratica]
Length=541

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILPIIFPALE+N+R HWNQAVQSLTLNV+K+FSD
Sbjct  411  FQVAERALFLWNNDHIRNLITQNRRVILPIIFPALERNTRGHWNQAVQSLTLNVKKIFSD  470

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D E+F+E L KF+EDE ++ E + KR+ TWKRLE++A  K  SNE VLVS  ++  A +
Sbjct  471  ADQEIFDESLVKFEEDEVKQMETREKRDLTWKRLEDVATSKVVSNEAVLVSKFISSVAIA  530

Query  399  G  397
             
Sbjct  531  S  531



>gb|EEC82836.1| hypothetical protein OsI_27645 [Oryza sativa Indica Group]
Length=516

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 103/141 (73%), Gaps = 17/141 (12%)
 Frame = -2

Query  804  CHLSLF-----C--SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C +SLF     C  S H+     QVAERALFLWNNDHIE LIKQN KVILPII PA+E+N
Sbjct  384  CMVSLFRQIARCLNSSHF-----QVAERALFLWNNDHIEVLIKQNSKVILPIILPAIERN  438

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            ++ HWNQAVQSL+LNVRK+F D D  LFEECL KF+EDE++E  ++ KREATWKRLEEIA
Sbjct  439  TKEHWNQAVQSLSLNVRKIFMDHDPVLFEECLKKFEEDEAKETALRSKREATWKRLEEIA  498

Query  465  GIKAASNEPVLVSHRVAPRAT  403
              K  S+EP      V P AT
Sbjct  499  SSKTISSEPA-----VPPEAT  514



>gb|AAM10385.1| AT4g15410/dl3750w [Arabidopsis thaliana]
Length=522

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HWNQAVQSLTLNVRK+ ++
Sbjct  396  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVMAE  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV-----SHRVA  415
             D  LF+ECL KFQEDE+ E E+  KREATWK LEE+A  K+ SNE VLV     S  +A
Sbjct  456  TDQILFDECLAKFQEDEANETEVVAKREATWKLLEELAASKSVSNEAVLVPRFSSSVTLA  515

Query  414  PRATSG  397
               TSG
Sbjct  516  TGKTSG  521



>ref|NP_567464.1| protein phosphatase 2A B'gamma [Arabidopsis thaliana]
 ref|NP_849390.1| protein phosphatase 2A B'gamma [Arabidopsis thaliana]
 sp|Q8RW96.2|2A5G_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 59 kDa 
regulatory subunit B' gamma isoform; Short=AtB' gamma; Short=PP2A, 
B' subunit, gamma isoform [Arabidopsis thaliana]
 gb|AAB58902.1| B' regulatory subunit of PP2A [Arabidopsis thaliana]
 gb|AAW80854.1| At4g15415 [Arabidopsis thaliana]
 dbj|BAF01161.1| phosphatase like protein [Arabidopsis thaliana]
 gb|AEE83598.1| protein phosphatase 2A B'gamma [Arabidopsis thaliana]
 gb|AEE83599.1| protein phosphatase 2A B'gamma [Arabidopsis thaliana]
Length=522

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HWNQAVQSLTLNVRK+ ++
Sbjct  396  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVMAE  455

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV-----SHRVA  415
             D  LF+ECL KFQEDE+ E E+  KREATWK LEE+A  K+ SNE VLV     S  +A
Sbjct  456  TDQILFDECLAKFQEDEANETEVVAKREATWKLLEELAASKSVSNEAVLVPRFSSSVTLA  515

Query  414  PRATSG  397
               TSG
Sbjct  516  TGKTSG  521



>ref|XP_009152091.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Brassica rapa]
 ref|XP_009152092.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Brassica rapa]
 ref|XP_009152093.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Brassica rapa]
Length=500

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI Q+RKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F
Sbjct  396  LHFQVAERALFLWNNNHIENLIMQSRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIF  455

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
            SD+D ELF+ECL KF+EDES+E E K KREATW+RLEE+ G++ AS
Sbjct  456  SDLDPELFKECLAKFKEDESKEGETKAKREATWRRLEEV-GMRKAS  500



>ref|XP_008649345.1| PREDICTED: protein phosphatase 2A regulatory subunit B' isoform 
X1 [Zea mays]
 ref|XP_008649348.1| PREDICTED: protein phosphatase 2A regulatory subunit B' isoform 
X1 [Zea mays]
 gb|ACL52666.1| unknown [Zea mays]
 tpg|DAA52443.1| TPA: protein phosphatase 2A regulatory subunit B isoform 1 [Zea 
mays]
 tpg|DAA52444.1| TPA: protein phosphatase 2A regulatory subunit B isoform 2 [Zea 
mays]
Length=519

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN +VILPIIFPALE+N+  HWNQAVQSLTLNVRKLFSD
Sbjct  399  FQVAERALFLWNNDHIESLIKQNSRVILPIIFPALERNASGHWNQAVQSLTLNVRKLFSD  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF E L K++E+++RE+E+K K+EATW+RLEE+A  KA S   VLVS  ++ ++++
Sbjct  459  NDPGLFTESLRKYEEEKAREKEVKSKQEATWRRLEEMASAKATSGAAVLVSRPLSRQSSA  518



>ref|XP_011029625.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011029626.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=522

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNND IENLI QNRKVILPII PALEKN R HWNQAV+SLTLNVRK+F D
Sbjct  402  FQVAERALFLWNNDPIENLIIQNRKVILPIILPALEKNVRNHWNQAVRSLTLNVRKIFED  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELF ECL KFQEDE +E EIK + EA WKRLEEIA  K+AS+  V+   +    + S
Sbjct  462  LDHELFNECLLKFQEDEKKEVEIKARSEAAWKRLEEIARQKSASDAMVVAPRKALTCSAS  521

Query  399  G  397
            G
Sbjct  522  G  522



>ref|NP_001105904.1| protein phosphatase 2A regulatory subunit B' [Zea mays]
 gb|AAY24686.1| protein phosphatase 2A regulatory subunit B' [Zea mays]
Length=519

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN +VILPIIFPALE+N+  HWNQAVQSLTLNVRKLFSD
Sbjct  399  FQVAERALFLWNNDHIESLIKQNSRVILPIIFPALERNASGHWNQAVQSLTLNVRKLFSD  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF E L K++E+++RE+E+K K+EATW+RLEE+A  KA S   VLVS  ++ ++++
Sbjct  459  NDPGLFTESLRKYEEEKAREKEVKSKQEATWRRLEEMASAKATSGAAVLVSRPLSRQSSA  518



>ref|XP_010554220.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Tarenaya hassleriana]
 ref|XP_010554221.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Tarenaya hassleriana]
 ref|XP_010554222.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Tarenaya hassleriana]
Length=506

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIE+LI QNRKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F
Sbjct  399  LHFQVAERALFLWNNDHIESLIMQNRKVILPIIFPALERNAQNHWNQAVHSLTLNVRKIF  458

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D D +LF+ECL KF+EDES+E E + +REATWKRLEE+  +KA+S
Sbjct  459  HDPDPDLFKECLAKFKEDESKEAETETRREATWKRLEELGKLKASS  504



>gb|EYU22561.1| hypothetical protein MIMGU_mgv1a007292mg [Erythranthe guttata]
Length=412

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAE AL LWNNDHIENLIKQNRKVILPIIFP+LE+N+R HWNQ+V+SLTLNVRK+F
Sbjct  294  LHFQVAEIALLLWNNDHIENLIKQNRKVILPIIFPSLERNARQHWNQSVRSLTLNVRKVF  353

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
             DID +LFE C  +FQEDES E+EI+ KRE+TWK LEE+A  K  SNE +LV
Sbjct  354  YDIDPDLFEVCQIRFQEDESMEKEIEEKRESTWKLLEELASKKVVSNEAILV  405



>ref|XP_010089442.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
 gb|EXB37815.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
Length=545

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 12/132 (9%)
 Frame = -2

Query  804  CHLSLF-----C--SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LF     C  SFH+     QVAER LFLWNNDH+ NLI QNR+VILP++ PALE+N
Sbjct  398  CMVPLFRQISRCLNSFHF-----QVAERTLFLWNNDHLRNLIIQNRQVILPMVLPALERN  452

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            +R HWNQAVQSLTLNVRK+FSD D  LF+E L +FQEDE +++E + +RE+TWKRLE++A
Sbjct  453  TRNHWNQAVQSLTLNVRKIFSDADQALFDEYLERFQEDEVKDRETQQRRESTWKRLEDVA  512

Query  465  GIKAASNEPVLV  430
              KA SNE VLV
Sbjct  513  ASKAVSNEAVLV  524



>ref|XP_006283548.1| hypothetical protein CARUB_v10004601mg [Capsella rubella]
 gb|EOA16446.1| hypothetical protein CARUB_v10004601mg [Capsella rubella]
Length=516

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HWNQAVQSLTLNVRK+ ++
Sbjct  390  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVLAE  449

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF+ECL KFQEDE+ E E+  KREATWK LE++A  K+ SNE VLV     PR +S
Sbjct  450  TDQVLFDECLAKFQEDEANETEVVAKREATWKLLEDLAASKSVSNEAVLV-----PRFSS  504

Query  399  G  397
             
Sbjct  505  S  505



>gb|KJB42861.1| hypothetical protein B456_007G171000 [Gossypium raimondii]
 gb|KJB42862.1| hypothetical protein B456_007G171000 [Gossypium raimondii]
Length=518

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR VILPIIFPALE+N+  HWNQAVQS TLNVRK+F+D
Sbjct  385  FQVAERALFLWNNDHIRNLIIQNRSVILPIIFPALERNTSGHWNQAVQSFTLNVRKMFTD  444

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEE-IAGIKAASNEPVLVSHRVAPRAT  403
            +D  LF+ECL +FQEDE +E+E++ +RE TWK LE+ ++   AASNE VLVS  V+  A 
Sbjct  445  VDHMLFDECLSRFQEDELKEKEMQERRELTWKHLEDVVSSTTAASNEAVLVSRFVSSIAI  504

Query  402  S  400
            +
Sbjct  505  A  505



>ref|XP_010100283.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXB82417.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=515

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 109/142 (77%), Gaps = 12/142 (8%)
 Frame = -2

Query  804  CHLSLF-----C--SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LF     C  SFH+     QVAERALFLWNNDHI+NLIKQN  VILPIIFPALEKN
Sbjct  378  CMVPLFRQLARCLNSFHF-----QVAERALFLWNNDHIQNLIKQNCHVILPIIFPALEKN  432

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            +R HWNQAV SLTLNVRK+F D+D ELF+ECL  F+E++S+E+EIK +REATW+RLEE+A
Sbjct  433  ARNHWNQAVHSLTLNVRKIFHDLDPELFKECLVTFEEEKSKEEEIKARREATWRRLEELA  492

Query  465  GIKAASNEPVLVSHRVAPRATS  400
              KA SNE VLV ++  P   S
Sbjct  493  SKKATSNEAVLVPYKAPPSTAS  514



>ref|XP_006395602.1| hypothetical protein EUTSA_v10004020mg [Eutrema salsugineum]
 gb|ESQ32888.1| hypothetical protein EUTSA_v10004020mg [Eutrema salsugineum]
Length=513

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNN+HIENLI Q+RKVILPIIFPALE+N++ HW
Sbjct  394  CMVPLFRQIARCLNSLHFQVAERALFLWNNNHIENLIMQSRKVILPIIFPALERNAQNHW  453

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D ELF+ECL KF+EDES++ E K KREATWKRLEE+ G++ A
Sbjct  454  NQAVHSLTLNVRKIFHDLDPELFKECLAKFKEDESKQAETKAKREATWKRLEEL-GVRKA  512

Query  450  S  448
            S
Sbjct  513  S  513



>ref|XP_010551033.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Tarenaya hassleriana]
 ref|XP_010551034.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Tarenaya hassleriana]
Length=525

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 12/133 (9%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRT--HWNQAVQSLTLNVRKLF  586
             QVAERALFLWNNDHI NLI  N K I+PIIFPALE+N+R   HWNQAVQSLTLNVRK+F
Sbjct  392  FQVAERALFLWNNDHIRNLITHNHKTIMPIIFPALERNTRGRGHWNQAVQSLTLNVRKVF  451

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA-SNEPVLVSHRV---  418
            SD D +LF+ECL KFQEDE+RE+E++MKR+ TW+RLEE+A  +A  S+E VL+       
Sbjct  452  SDTDLDLFDECLAKFQEDEAREKELQMKRDMTWQRLEELAASRAVRSSEAVLLVPSFTSS  511

Query  417  ------APRATSG  397
                  +PR  SG
Sbjct  512  MALTSGSPRGASG  524



>emb|CDY13605.1| BnaA06g33180D [Brassica napus]
Length=509

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 97/115 (84%), Gaps = 5/115 (4%)
 Frame = -2

Query  780  FHYLILFL----QVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQS  613
            F Y+I  +     VAERALFLWNN+HIENLI Q+RKVILPIIFPALE+N++ HWNQAV S
Sbjct  396  FGYVIYIINISSSVAERALFLWNNNHIENLIMQSRKVILPIIFPALERNAQKHWNQAVHS  455

Query  612  LTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
            LTLNVRK+FSD+D ELF+ECL KF+EDES+E E K KREATW+RLEE+ G++ AS
Sbjct  456  LTLNVRKIFSDLDPELFKECLAKFKEDESKEGETKAKREATWRRLEEV-GMRKAS  509



>emb|CDX83578.1| BnaC07g23180D [Brassica napus]
Length=482

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNN+HIENLI Q+RKVILPIIFPALE+N+  HW
Sbjct  363  CMVPLFRQIARCLNSLHFQVAERALFLWNNNHIENLIMQSRKVILPIIFPALERNAEKHW  422

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F+D+D ELF++CL KF+EDES+E E K KREATWKRLEE+ G++ A
Sbjct  423  NQAVHSLTLNVRKIFNDLDPELFKDCLAKFKEDESKEGETKAKREATWKRLEEV-GMRKA  481

Query  450  S  448
            S
Sbjct  482  S  482



>ref|XP_004502031.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Cicer arietinum]
Length=539

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN KVILPIIFPALEKN+R HWNQAVQSLTLNVRK+F
Sbjct  415  LHFQVAERALFLWNNDHIRNLIIQNCKVILPIIFPALEKNARGHWNQAVQSLTLNVRKIF  474

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGI-KAASNEPVLVS  427
            SD D  LF+EC+ KFQEDE +E++ +  RE+TWK+LE+IA   K+ SNE VL S
Sbjct  475  SDADQALFDECMLKFQEDEIKERQKQENRESTWKKLEDIAAASKSISNEAVLAS  528



>gb|KHN38476.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Glycine soja]
Length=537

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN KVILPIIFPA+EKN R HWNQAVQSLT+NVRK+F
Sbjct  405  LHFQVAERALFLWNNDHIRNLILQNSKVILPIIFPAMEKNIRGHWNQAVQSLTMNVRKIF  464

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
            SD D  LF+ECL +FQE+E  ++E + KRE+ WK+LE++A   A SNE +LVS  V+  A
Sbjct  465  SDADQALFDECLKRFQEEEINDREKQEKRESIWKQLEDVAAANAVSNEAILVSRFVSSVA  524

Query  405  TS  400
             +
Sbjct  525  IA  526



>ref|NP_189231.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
 ref|NP_001030770.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
 sp|Q9LU89.1|2A5N_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 59 kDa 
regulatory subunit B' eta isoform; Short=AtB' eta; Short=PP2A, 
B' subunit, eta isoform [Arabidopsis thaliana]
 gb|AAK56256.1|AF367267_1 AT3g26020/MPE11_17 [Arabidopsis thaliana]
 dbj|BAB01065.1| protein phosphatase 2A regulatory subunit B' [Arabidopsis thaliana]
 gb|AAL15383.1| AT3g26020/MPE11_17 [Arabidopsis thaliana]
 dbj|BAH20024.1| AT3G26020 [Arabidopsis thaliana]
 gb|AEE77102.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
 gb|AEE77103.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
Length=510

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F
Sbjct  406  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIF  465

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D+D ELF+ECL KF+EDES+  E + KREATWKRLEE+ G++ AS
Sbjct  466  HDLDPELFKECLAKFKEDESKAAETEAKREATWKRLEEL-GVRKAS  510



>ref|XP_006357949.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Solanum tuberosum]
Length=545

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILP+IFP LEKN+R HWN+AVQSLTLNVRK+FSD
Sbjct  422  FQVAERALFLWNNDHIRNLIVQNREVILPLIFPLLEKNTRGHWNEAVQSLTLNVRKIFSD  481

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KF+EDE +++E + +RE TWKRLE++A     SNE VLVS
Sbjct  482  ADQALFDECLEKFKEDEIKDKEAQERRELTWKRLEDLAASNFVSNEAVLVS  532



>emb|CAB10320.1| phosphatase like protein [Arabidopsis thaliana]
 emb|CAB78583.1| phosphatase like protein [Arabidopsis thaliana]
Length=969

 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HWNQAVQSLTLNVRK+ ++
Sbjct  843  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVMAE  902

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV-----SHRVA  415
             D  LF+ECL KFQEDE+ E E+  KREATWK LEE+A  K+ SNE VLV     S  +A
Sbjct  903  TDQILFDECLAKFQEDEANETEVVAKREATWKLLEELAASKSVSNEAVLVPRFSSSVTLA  962

Query  414  PRATSG  397
               TSG
Sbjct  963  TGKTSG  968



>ref|XP_012085600.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Jatropha curcas]
 gb|KDP26746.1| hypothetical protein JCGZ_17904 [Jatropha curcas]
Length=510

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNND IENLI Q+RKVILPIIFPALE+N+R+HWNQAV+SLTLNVRK+F D
Sbjct  405  FQVAERALFLWNNDPIENLIIQHRKVILPIIFPALEQNARSHWNQAVRSLTLNVRKIFDD  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE  442
            +D ELF ECL KFQE E +E EIK +REA WKRLEE+A  KA+ N+
Sbjct  465  LDPELFNECLLKFQEAERKEDEIKARREAKWKRLEELAAQKASRNK  510



>ref|XP_006414514.1| hypothetical protein EUTSA_v10024939mg [Eutrema salsugineum]
 gb|ESQ55967.1| hypothetical protein EUTSA_v10024939mg [Eutrema salsugineum]
Length=516

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 98/129 (76%), Gaps = 7/129 (5%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HWNQAVQSLTLNVRK+ +D
Sbjct  390  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERNTRGHWNQAVQSLTLNVRKVLAD  449

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF+ECL KFQE+E+++ E+  KRE TWK LE++A  K+ SNE VLV     PR +S
Sbjct  450  TDQVLFDECLAKFQEEEAKKTEVVAKREVTWKLLEDLAASKSVSNEAVLV-----PRFSS  504

Query  399  G*RL--GNP  379
               L  G P
Sbjct  505  SVTLAAGKP  513



>ref|XP_009129571.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Brassica rapa]
Length=502

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI Q+RKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F
Sbjct  398  LHFQVAERALFLWNNNHIENLIMQSRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIF  457

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
             D+D ELF+ECL KF+EDES+E E K KREATWKRLEE AG++  
Sbjct  458  QDLDPELFKECLAKFKEDESKEGETKAKREATWKRLEE-AGMRKG  501



>ref|XP_006657611.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine protein phosphatase 
2A 57 kDa regulatory subunit B' theta isoform-like [Oryza 
brachyantha]
Length=510

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QN KVILPIIF ALEKN   HWNQAV+SL+LNV+KLFSD
Sbjct  390  FQVAERALFLWNNDHIENLIRQNSKVILPIIFSALEKNVNEHWNQAVKSLSLNVQKLFSD  449

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DAE F+ECL K++ ++++E+E+K+K+E+ WKRLEE+A  KA S E VL++  + PR +S
Sbjct  450  RDAEHFKECLRKYEVNQAKEKELKLKQESVWKRLEEVASAKATSGEAVLIAPSL-PRTSS  508



>ref|XP_006293086.1| hypothetical protein CARUB_v10019373mg [Capsella rubella]
 gb|EOA25984.1| hypothetical protein CARUB_v10019373mg [Capsella rubella]
Length=521

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIFPALE N++ HWNQAV SLTLNVRK+F
Sbjct  417  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFPALEINAQKHWNQAVHSLTLNVRKIF  476

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D+D ELF+ECL KF+EDES+  E K KREATWKRLEE+ G++ AS
Sbjct  477  HDLDPELFKECLAKFKEDESKAAETKAKREATWKRLEEL-GVQKAS  521



>ref|XP_003545564.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Glycine max]
Length=536

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN KVILPIIFPA+EKN R HWNQAVQSLT+NVRK+F
Sbjct  404  LHFQVAERALFLWNNDHIRNLILQNSKVILPIIFPAMEKNIRDHWNQAVQSLTMNVRKIF  463

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
            SD D  LF+ECL +FQE+E +++E + KRE+ WK+LE++A   A S+E +LVS  V+  A
Sbjct  464  SDADQALFDECLKRFQEEEIKDREKQEKRESIWKQLEDVAAANAVSSEAILVSRFVSSVA  523

Query  405  TS  400
             +
Sbjct  524  IA  525



>gb|KHM99097.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Glycine soja]
Length=536

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN KVILPIIFPA+EKN R HWNQAVQSLT+NVRK+F
Sbjct  404  LHFQVAERALFLWNNDHIRNLILQNSKVILPIIFPAMEKNIRDHWNQAVQSLTMNVRKIF  463

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
            SD D  LF+ECL +FQE+E +++E + KRE+ WK+LE++A   A S+E +LVS  V+  A
Sbjct  464  SDADQALFDECLKRFQEEEIKDREKQEKRESIWKQLEDVAAANAVSSEAILVSRFVSSVA  523

Query  405  TS  400
             +
Sbjct  524  IA  525



>gb|KHF99622.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
zeta-like protein [Gossypium arboreum]
Length=548

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR VILPIIFPALE+N+  HWN AVQS TLNVRK+F+D
Sbjct  413  FQVAERALFLWNNDHIRNLIIQNRSVILPIIFPALERNTNGHWNLAVQSFTLNVRKIFTD  472

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA-GIKAASNEPVLVSHRVA  415
            +D  LF+ECL +FQEDE +E+E++ +RE TWK LE++A    AASNE VLVS  V+
Sbjct  473  VDHVLFDECLSRFQEDELKEKEMQERRELTWKHLEDVASSTTAASNEAVLVSRFVS  528



>ref|XP_002875297.1| hypothetical protein ARALYDRAFT_904782 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51556.1| hypothetical protein ARALYDRAFT_904782 [Arabidopsis lyrata subsp. 
lyrata]
Length=517

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F
Sbjct  413  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIF  472

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D+D ELF+ECL KF+EDES   E + KREATWKRLEE+ G++ AS
Sbjct  473  HDLDPELFKECLAKFKEDESNAAETEAKREATWKRLEEL-GVRKAS  517



>ref|XP_002870241.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46500.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   166 bits (420),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 12/132 (9%)
 Frame = -2

Query  804  CHLSLF-----C--SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LF     C  S H+     QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N
Sbjct  805  CMVPLFRQIARCLNSSHF-----QVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERN  859

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            +R HWNQAVQSLTLNVRK+ ++ D  LF+ECL KFQEDE+ E E+  KREATWK LE++A
Sbjct  860  TRGHWNQAVQSLTLNVRKVLAETDQILFDECLAKFQEDEANENEVVAKREATWKLLEDLA  919

Query  465  GIKAASNEPVLV  430
              K+ SNE VLV
Sbjct  920  ASKSVSNEAVLV  931



>gb|EMT15241.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Aegilops tauschii]
Length=528

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -2

Query  774  YLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVR  595
            +L++  QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N+R HWNQAV+SLTLNVR
Sbjct  411  FLVICFQVAERALFLWNNDHIENLIKQNYKVILPIIFPALERNARGHWNQAVRSLTLNVR  470

Query  594  KLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEP  439
            K+F+D D+  F EC+ KF +DE +++E   KREA WKRLEE+ G    S  P
Sbjct  471  KIFTDHDSAFFGECMQKFDDDELKQEESSSKREALWKRLEEMGGESNPSGIP  522



>ref|NP_001154647.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
 gb|AEE77104.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
Length=512

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
            L VAERALFLWNN+HIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F D
Sbjct  410  LGVAERALFLWNNNHIENLIMQNRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIFHD  469

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
            +D ELF+ECL KF+EDES+  E + KREATWKRLEE+ G++ AS
Sbjct  470  LDPELFKECLAKFKEDESKAAETEAKREATWKRLEEL-GVRKAS  512



>emb|CDY22925.1| BnaA01g18630D [Brassica napus]
Length=494

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HW+QAVQSLTLNVRK+ ++
Sbjct  368  FQVAERALFLWNNDHIRNLITQNYKVIMPIVFPAMERNTRGHWHQAVQSLTLNVRKVLAE  427

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KFQEDE+ + E+  KREATWK LE++A  K  SNE VL+S
Sbjct  428  TDQALFDECLAKFQEDEANKTEVLAKREATWKLLEDLAASKTVSNEAVLLS  478



>ref|XP_003519459.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Glycine max]
Length=537

 Score =   162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN KVILPIIFPA+EKN R HWNQ VQSLT+NVRK+F
Sbjct  405  LHFQVAERALFLWNNDHIRNLILQNSKVILPIIFPAMEKNIRGHWNQVVQSLTMNVRKIF  464

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
            SD D  LF+ECL +FQE+E  ++E + KRE+ WK+LE++A   A SNE +LVS  V+  A
Sbjct  465  SDADQALFDECLKRFQEEEINDREKQEKRESIWKQLEDVAAANAVSNEAILVSRFVSSVA  524

Query  405  TS  400
             +
Sbjct  525  IA  526



>ref|NP_001154648.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
 gb|AEE77105.1| protein phosphatase 2A regulatory subunit B' eta [Arabidopsis 
thaliana]
Length=529

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
            L VAERALFLWNN+HIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F D
Sbjct  427  LGVAERALFLWNNNHIENLIMQNRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIFHD  486

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
            +D ELF+ECL KF+EDES+  E + KREATWKRLEE+ G++ AS
Sbjct  487  LDPELFKECLAKFKEDESKAAETEAKREATWKRLEEL-GVRKAS  529



>ref|XP_003601378.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Medicago truncatula]
 gb|AES71629.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=535

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN KVILPIIFPALEKN+R HWNQAVQSLTLNVRK+F
Sbjct  410  LHFQVAERALFLWNNDHIRNLIIQNCKVILPIIFPALEKNARGHWNQAVQSLTLNVRKIF  469

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA-GIKAASNEPVLVSHRVAPR  409
            SD D  LF+EC+ KFQEDE +E+E + KRE+ WK+LE++A    + SNE VL S   +  
Sbjct  470  SDADHSLFDECMIKFQEDEIKEREKQEKRESMWKKLEDVAVASTSISNEAVLASRFASSL  529

Query  408  ATSG  397
            A + 
Sbjct  530  AVAA  533



>ref|XP_010548887.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Tarenaya hassleriana]
Length=540

 Score =   162 bits (410),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 94/124 (76%), Gaps = 4/124 (3%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ NLI QN KV++PII PALE+N+R HWNQAVQSLTLNVRK+F D
Sbjct  413  FQVAERALFLWNNDHVRNLITQNHKVVMPIILPALERNTRGHWNQAVQSLTLNVRKVFCD  472

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS----HRVAP  412
             D  LF+ECL KFQEDE++E+E++ +RE TWKRLEE+A    A   P   S    + V+P
Sbjct  473  TDQALFDECLAKFQEDETKEKEVETRRETTWKRLEELAVSTEAVPVPRFTSLVGFNGVSP  532

Query  411  RATS  400
            +  S
Sbjct  533  KGNS  536



>ref|NP_001059361.1| Os07g0274800 [Oryza sativa Japonica Group]
 dbj|BAC84389.1| putative protein phosphatase PP2A0 B' subunit gamma isoform [Oryza 
sativa Japonica Group]
 dbj|BAF21275.1| Os07g0274800 [Oryza sativa Japonica Group]
 dbj|BAG91016.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81852.1| hypothetical protein OsI_25621 [Oryza sativa Indica Group]
 gb|EEE66955.1| hypothetical protein OsJ_23826 [Oryza sativa Japonica Group]
Length=517

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIENLI+QN KVILPIIF ALEKN   HWNQAV+SL+LNV+KLFSD
Sbjct  397  FQVAERALFLWNNDHIENLIRQNSKVILPIIFSALEKNVIEHWNQAVKSLSLNVQKLFSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA  415
             D EL++ECL K++E++++E++ K+K+E+ WKRLEE+A  KA S E VL+S  +A
Sbjct  457  RDPELYKECLRKYEENKAKEKDHKLKQESVWKRLEEVASAKATSGEAVLISPSLA  511



>ref|XP_006417120.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
 gb|ESQ35473.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
Length=497

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIE+LI QNRKVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  390  LHFQVAERALFLWNNDHIESLIMQNRKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  449

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +DID E F+ECL KF+E+E++E E++ KREATWKRLEEI   K  S+
Sbjct  450  NDIDPEFFKECLAKFRENEAKEAEVEAKREATWKRLEEIGMQKQKSS  496



>ref|XP_010425263.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Camelina sativa]
 ref|XP_010425264.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Camelina sativa]
 ref|XP_010425265.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform [Camelina sativa]
Length=517

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIFPALE+N++ HWNQAV SLTLNVRK+F
Sbjct  413  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFPALERNAQKHWNQAVHSLTLNVRKIF  472

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D D ELF+ECL KF+EDES+  E + KREATWKRLEE+ G++ AS
Sbjct  473  HDQDPELFKECLAKFKEDESKAAETEAKREATWKRLEEL-GVQKAS  517



>emb|CDY48287.1| BnaC01g31410D [Brassica napus]
Length=496

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N+R HW+QAVQSLTLNVRK+ ++
Sbjct  370  FQVAERALFLWNNDHIRNLITQNYKVIMPIVFPAMERNTRGHWHQAVQSLTLNVRKVLAE  429

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KFQEDE    E+ +KREATWK LE++A  K  SNE VL+S
Sbjct  430  TDQALFDECLAKFQEDEVNTTEVVVKREATWKLLEDLAASKTVSNEAVLLS  480



>ref|XP_010537569.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Tarenaya hassleriana]
Length=495

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLI QNRKVILPI+ PALE+N+R HWNQAV+SLT NVRK+F
Sbjct  391  LHFQVAERALFLWNNDHIENLIMQNRKVILPILLPALERNARNHWNQAVRSLTQNVRKMF  450

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
             D+D +LF+ECL KF+EDES+E E + +REATWKR+EE    KA+
Sbjct  451  HDLDPDLFKECLAKFEEDESKEAETEARREATWKRVEEFGAHKAS  495



>emb|CDY40986.1| BnaA02g27760D [Brassica napus]
Length=954

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF      +  L  QVAERALFLWNN+HIENLI Q+RKVILPIIFPALE+N++ HW
Sbjct  354  CMVPLFRQIARCLNSLHFQVAERALFLWNNNHIENLIMQSRKVILPIIFPALERNAQKHW  413

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D ELF+ECL KF+EDES+E E K KREATWKRLEE AG++  
Sbjct  414  NQAVHSLTLNVRKIFQDLDPELFKECLAKFKEDESKEGETKAKREATWKRLEE-AGMRKD  472

Query  450  SN  445
             N
Sbjct  473  PN  474


 Score =   133 bits (335),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDH+ +L++QN ++ILPI+ PALEKN  +HWNQAV++LT NV K+ SD
Sbjct  847  FQVAERALYLWNNDHVSSLVRQNSRIILPIVLPALEKNGSSHWNQAVKNLTDNVLKVLSD  906

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
             + ELFEECL KFQED+   ++ K K   TW++LEEI   K  ++
Sbjct  907  TNPELFEECLRKFQEDQQNAEDNKKKNGETWRQLEEIVASKGHTS  951



>ref|XP_004972977.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Setaria italica]
Length=501

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 95/125 (76%), Gaps = 12/125 (10%)
 Frame = -2

Query  804  CHLSLF-------CSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LF       CS H+     QVAERALFLWNNDHIE LIKQN KVILPIIFPALE+N
Sbjct  381  CMVPLFRQIARCLCSSHF-----QVAERALFLWNNDHIEGLIKQNSKVILPIIFPALERN  435

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            ++ HWNQAVQSL+LNVRK+F D D  LFEEC  KF+E+E++E  ++ KREA WKRLEEIA
Sbjct  436  TKGHWNQAVQSLSLNVRKIFMDHDPTLFEECRKKFEEEEAQEASVRSKREAIWKRLEEIA  495

Query  465  GIKAA  451
              K+A
Sbjct  496  LSKSA  500



>ref|XP_006406248.1| hypothetical protein EUTSA_v10020525mg [Eutrema salsugineum]
 gb|ESQ47701.1| hypothetical protein EUTSA_v10020525mg [Eutrema salsugineum]
Length=516

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPALE+N+R HWNQAVQSLTLNVRK+F D
Sbjct  392  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPALERNTRGHWNQAVQSLTLNVRKVFCD  451

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA  415
            ID  LF+ECL  FQ +E  + E+K KRE TW+RLE++AG+   +NE VLV   V+
Sbjct  452  IDQALFDECLANFQAEEENKPEVKAKRERTWERLEDLAGLN--TNEKVLVPRFVS  504



>gb|EPS71994.1| hypothetical protein M569_02763, partial [Genlisea aurea]
Length=431

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+H+ENLIKQNRK ILPIIFPALE+N+R+HWNQAV SLTLNVRKLF
Sbjct  317  LHFQVAERALFLWNNNHVENLIKQNRKAILPIIFPALERNTRSHWNQAVHSLTLNVRKLF  376

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIK--AASNEPVLVS  427
             D D ELF  C  KF++DE+RE E K KR ATW RLEE+A  +    S+E +L+ 
Sbjct  377  EDADPELFAACRMKFEQDEAREGEAKEKRAATWIRLEELAAARNVTTSHEAILIP  431



>ref|XP_009786927.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nicotiana sylvestris]
Length=551

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILPIIFP LEKN+  HWNQAVQSLT NVRK+FSD
Sbjct  421  FQVAERALFLWNNDHIRNLIIQNREVILPIIFPPLEKNTNGHWNQAVQSLTSNVRKIFSD  480

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KFQE E + +E++ +RE TWKRLE++A     SNE VLVS
Sbjct  481  ADQALFDECLEKFQEAEIKNKEMQERRELTWKRLEDVAASNFVSNEAVLVS  531



>ref|XP_010449943.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Camelina sativa]
Length=515

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ NLI QN KVI+PI+FPA+E+N+R HW+QAVQSLTLNVRK+ ++
Sbjct  389  FQVAERALFLWNNDHVRNLITQNIKVIMPIVFPAMERNTRGHWHQAVQSLTLNVRKVLAE  448

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF+ECL KFQEDE+ E ++  KREATWK LE++A  K+ SNE VLV     PR +S
Sbjct  449  TDQVLFDECLAKFQEDEANETKVVAKREATWKLLEDLAASKSVSNEAVLV-----PRFSS  503

Query  399  G  397
             
Sbjct  504  S  504



>ref|XP_010440315.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like isoform X1 [Camelina sativa]
Length=514

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ NLI QN KVI+PI+FPA+E+N+R HW+QAVQSLTLNVRK+ ++
Sbjct  388  FQVAERALFLWNNDHVRNLITQNIKVIMPIVFPAMERNTRGHWHQAVQSLTLNVRKVLAE  447

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF+ECL KFQEDE+ E ++  KREATWK LE++A  K+ SNE VLV     PR +S
Sbjct  448  TDQVLFDECLAKFQEDEANETKVVAKREATWKLLEDLAASKSVSNEAVLV-----PRFSS  502

Query  399  G  397
             
Sbjct  503  S  503



>ref|XP_010440316.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like isoform X2 [Camelina sativa]
Length=515

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ NLI QN KVI+PI+FPA+E+N+R HW+QAVQSLTLNVRK+ ++
Sbjct  389  FQVAERALFLWNNDHVRNLITQNIKVIMPIVFPAMERNTRGHWHQAVQSLTLNVRKVLAE  448

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF+ECL KFQEDE+ E ++  KREATWK LE++A  K+ SNE VLV     PR +S
Sbjct  449  TDQVLFDECLAKFQEDEANETKVVAKREATWKLLEDLAASKSVSNEAVLV-----PRFSS  503

Query  399  G  397
             
Sbjct  504  S  504



>ref|XP_004976008.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Setaria italica]
Length=513

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 97/130 (75%), Gaps = 12/130 (9%)
 Frame = -2

Query  804  CHLSLFC-------SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKN  646
            C + LFC       S H+     QVAERALFLWNNDHIENLIKQN KV+LPII+PALE+N
Sbjct  377  CMVPLFCQIARSMNSSHF-----QVAERALFLWNNDHIENLIKQNYKVLLPIIYPALERN  431

Query  645  SRTHWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
            +R HWNQAV+SLTLNVRK+FSD D+  F EC+ +F ++E +++E  +KREA WKRLEE+A
Sbjct  432  TRDHWNQAVRSLTLNVRKIFSDHDSAFFGECVQRFNDEELKQEESDLKREALWKRLEEMA  491

Query  465  GIKAASNEPV  436
              K   N P+
Sbjct  492  TSKPGENNPL  501



>ref|XP_010100284.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXB82418.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=506

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  753  VAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSDID  574
            VAERAL+LWNNDHIENLI+QN KVILPIIFPALE N R HWNQ VQSLTLN+RK+FSD+D
Sbjct  390  VAERALYLWNNDHIENLIRQNCKVILPIIFPALE-NGRNHWNQVVQSLTLNIRKIFSDVD  448

Query  573  AELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
             ELFEECL KFQED+S+  E + K E  WKRLEEIA  KAA  E +LV
Sbjct  449  PELFEECLCKFQEDQSKLGETRRKHETVWKRLEEIAASKAA-GEAILV  495



>ref|XP_010434994.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Camelina sativa]
Length=514

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 95/121 (79%), Gaps = 5/121 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDH+ NLI QN KVI+PI+FPA+E+N+R HW+QAVQSLTLNVRK+ ++
Sbjct  388  FQVAERALFLWNNDHVRNLITQNIKVIMPIVFPAMERNTRGHWHQAVQSLTLNVRKVLAE  447

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D  LF+ECL KFQEDE+ E ++  KREATWK LE++A  K+ SNE VLV     PR +S
Sbjct  448  TDQVLFDECLAKFQEDEANETKVVAKREATWKLLEDLAASKSVSNEAVLV-----PRFSS  502

Query  399  G  397
             
Sbjct  503  S  503



>ref|XP_002459695.1| hypothetical protein SORBIDRAFT_02g008950 [Sorghum bicolor]
 gb|EER96216.1| hypothetical protein SORBIDRAFT_02g008950 [Sorghum bicolor]
Length=504

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LF WNN H EN +KQN KVILPIIFPALEKN   HWNQ VQSL+LNVRK+FSD
Sbjct  384  FQVAERVLFFWNNSHFENFVKQNSKVILPIIFPALEKNINGHWNQVVQSLSLNVRKIFSD  443

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D +LF ECL K++ED+ RE+E K+K+E  WKRL+EIA  K  S E VLVS  + PR  S
Sbjct  444  RDPQLFTECLRKYEEDKDREKEFKLKQELAWKRLDEIASAKITSGEAVLVSPTL-PRQPS  502



>emb|CAC09487.2| H0811E11.3 [Oryza sativa Indica Group]
 emb|CAH67484.1| H0805A05.14 [Oryza sativa Indica Group]
Length=509

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = -2

Query  804  CHLSLF----CSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRT  637
            C + LF    CS +      QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N+R 
Sbjct  373  CMVPLFRQIACSMNSS--HFQVAERALFLWNNDHIENLIKQNYKVILPIIFPALERNARG  430

Query  636  HWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIK  457
            HWNQAV+SLTLNVRK+FSD D+  F EC  KF +DE +++E   KREA WKRLEE A  +
Sbjct  431  HWNQAVRSLTLNVRKIFSDHDSAFFGECTQKFNDDELKQEESNSKREALWKRLEEAAVPR  490

Query  456  AASNEPV  436
            + +N PV
Sbjct  491  SDNNNPV  497



>ref|NP_001053130.1| Os04g0485100 [Oryza sativa Japonica Group]
 emb|CAE03154.2| OSJNBa0081L15.16 [Oryza sativa Japonica Group]
 emb|CAD41393.2| OJ000223_09.6 [Oryza sativa Japonica Group]
 dbj|BAF15044.1| Os04g0485100 [Oryza sativa Japonica Group]
 gb|EAY94598.1| hypothetical protein OsI_16375 [Oryza sativa Indica Group]
 gb|EAZ31144.1| hypothetical protein OsJ_15242 [Oryza sativa Japonica Group]
 dbj|BAG95856.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = -2

Query  804  CHLSLF----CSFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRT  637
            C + LF    CS +      QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N+R 
Sbjct  373  CMVPLFRQIACSMNSS--HFQVAERALFLWNNDHIENLIKQNYKVILPIIFPALERNARG  430

Query  636  HWNQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIK  457
            HWNQAV+SLTLNVRK+FSD D+  F EC  KF +DE +++E   KREA WKRLEE A  +
Sbjct  431  HWNQAVRSLTLNVRKIFSDHDSAFFGECTQKFNDDELKQEESNSKREALWKRLEEAAVPR  490

Query  456  AASNEPV  436
            + +N PV
Sbjct  491  SDNNNPV  497



>ref|XP_009147392.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Brassica rapa]
Length=495

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+EKN+R HW+QAVQSLTLNVRK+ ++
Sbjct  369  FQVAERALFLWNNDHIRNLITQNYKVIMPIVFPAMEKNTRGHWHQAVQSLTLNVRKVLAE  428

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KF+EDE+ + E   KREATWK LE++A  K  SNE VL+S
Sbjct  429  TDQALFDECLAKFREDEANKTEAVAKREATWKLLEDLAASKTVSNEAVLLS  479



>gb|EMT31243.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Aegilops tauschii]
Length=535

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
            +QVAERALFLWNNDHIE LIKQN KV+LPII P+LE+N++ HWNQAVQSL+LNVRK+F D
Sbjct  418  VQVAERALFLWNNDHIEGLIKQNSKVLLPIILPSLERNTKGHWNQAVQSLSLNVRKIFLD  477

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHR  421
             D  LFE CL KFQ+DE++E  ++ KR+ATWKRLEEIA     +  P  ++H+
Sbjct  478  HDPVLFEGCLKKFQDDEAQEDAVRSKRDATWKRLEEIASSNPQAGRPQAIAHQ  530



>gb|EMS53921.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' gamma isoform [Triticum urartu]
Length=535

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
            +QVAERALFLWNNDHIE LIKQN KV+LPII P+LE+N++ HWNQAVQSL+LNVRK+F D
Sbjct  418  VQVAERALFLWNNDHIEGLIKQNSKVLLPIILPSLERNTKGHWNQAVQSLSLNVRKIFLD  477

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHR  421
             D  LFE CL KFQ+DE++E  ++ KR+ATWKRLEEIA     +  P  ++H+
Sbjct  478  HDPVLFEGCLKKFQDDEAQEDAMRSKRDATWKRLEEIASSNPQAGRPQAIAHQ  530



>emb|CDX98102.1| BnaA06g08530D [Brassica napus]
Length=463

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  355  LHFQVAERALFLWNNDHIENLIKQNCKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  414

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D D E F+ECL KF+E ES+E E++ KR+ATWKRLEEI   K  S+
Sbjct  415  NDNDPEFFKECLAKFRESESKEAEVEAKRQATWKRLEEIGMQKQKSS  461



>ref|XP_009148646.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
 ref|XP_009148647.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
Length=493

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  385  LHFQVAERALFLWNNDHIENLIKQNCKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  444

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D D E F+ECL KF+E ES+E E++ KR+ATWKRLEEI   K  S+
Sbjct  445  NDNDPEFFKECLAKFRESESKEAEVEAKRQATWKRLEEIGMQKQKSS  491



>emb|CDY30030.1| BnaC05g09900D [Brassica napus]
Length=496

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHIENLIKQN KVILPIIFPALE+N++ HWNQAV SLTLNV+K+F
Sbjct  388  LHFQVAERALFLWNNDHIENLIKQNCKVILPIIFPALERNTQKHWNQAVHSLTLNVQKIF  447

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASN  445
            +D D E F+ECL KF+E ES+E E++ KR+ATWKRLEEI   K  S+
Sbjct  448  NDNDPEFFKECLAKFRESESKEAEVEAKRQATWKRLEEIGMQKQKSS  494



>ref|XP_007141624.1| hypothetical protein PHAVU_008G211700g [Phaseolus vulgaris]
 gb|ESW13618.1| hypothetical protein PHAVU_008G211700g [Phaseolus vulgaris]
Length=536

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNNDHI NLI QN K+ILP+IFPALEKN R HWNQAVQSLTLNVRK+F
Sbjct  404  LHFQVAERALFLWNNDHIRNLILQNSKMILPMIFPALEKNIRGHWNQAVQSLTLNVRKIF  463

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRA  406
            SD D  +F+ECL +FQE+E + +E   KRE+ WK+LE++A     SNE +LVS  V+  A
Sbjct  464  SDADQAVFDECLMRFQEEEIKNREKLEKRESIWKQLEDVAAANVVSNEAILVSRFVSSVA  523

Query  405  TS  400
             +
Sbjct  524  IT  525



>ref|XP_008340163.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=522

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 2/120 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI++N KVILPIIFPALEKN R HWNQ  +SLTLN+RK++SD
Sbjct  403  FQVAERALYLWNNDHIENLIRENCKVILPIIFPALEKNGRNHWNQVARSLTLNIRKIYSD  462

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQE+E++E+EIK K EATWKRLEE+A   A S+E   V HR+ P  TS
Sbjct  463  VDPELFEECLLKFQEEEAKEEEIKAKHEATWKRLEEVAASNAVSSEA--VGHRLGPIQTS  520



>ref|XP_003580003.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Brachypodium distachyon]
Length=507

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN KVILPIIFPALE+N+R HWNQAV+SLTLNVRK+FSD
Sbjct  391  FQVAERALFLWNNDHIESLIKQNYKVILPIIFPALERNARGHWNQAVRSLTLNVRKIFSD  450

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSH  424
             D   F EC+ KF +DE +++E   KREA WKRLEE+   K+  N P+ +++
Sbjct  451  HDPAFFGECMEKFNDDELKQEESSSKREALWKRLEEMVASKSNGNIPLGITN  502



>ref|XP_009620794.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nicotiana tomentosiformis]
Length=554

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QNR+VILPIIF  LEKN+  HWNQAVQSLT NVRK+FSD
Sbjct  424  FQVAERALFLWNNDHIRNLIIQNREVILPIIFSPLEKNTHGHWNQAVQSLTSNVRKIFSD  483

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL +FQEDE + +E + +RE TWKRLE++A     SNE VLVS
Sbjct  484  ADQALFDECLERFQEDEIKNKETQERRELTWKRLEDVAASNFVSNEAVLVS  534



>ref|XP_011071183.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=509

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 2/127 (2%)
 Frame = -2

Query  804  CHLSLFCSFHYLI--LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHW  631
            C + LF    + +  L  QVAERALFLWNNDHIENLIKQNRKVILPIIFPALE+N+R HW
Sbjct  382  CMVPLFQQISHCLNSLHFQVAERALFLWNNDHIENLIKQNRKVILPIIFPALERNARHHW  441

Query  630  NQAVQSLTLNVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAA  451
            NQAV SLTLNVRK+F D+D +LF+ C  KFQ+DE++E+E+K KREATWKRLEE+A   AA
Sbjct  442  NQAVHSLTLNVRKIFYDLDPDLFKACQVKFQDDEAKEKEMKEKREATWKRLEELAARNAA  501

Query  450  SNEPVLV  430
            SNE +LV
Sbjct  502  SNEAILV  508



>ref|XP_006659077.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Oryza brachyantha]
Length=521

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER+LFLWNNDHIE LIKQN KVILPII PA+E+N++ HWNQAVQSL+LNVRK+F D
Sbjct  404  FQVAERSLFLWNNDHIEVLIKQNSKVILPIILPAIERNTKGHWNQAVQSLSLNVRKIFMD  463

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE  442
             D  LFEECL KF+EDE++E  ++ KREATWKRLEEIA  K+  +E
Sbjct  464  HDPVLFEECLKKFEEDEAKETVLRSKREATWKRLEEIALSKSTRSE  509



>gb|AHE76186.1| protein phosphatase 2a [Chrysanthemum indicum]
Length=505

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAER LF WNNDHIE+LI+QNRKVILPIIFPALE+N R HWNQAV  LTLNVRK+F
Sbjct  393  LHFQVAERVLFFWNNDHIESLIRQNRKVILPIIFPALERNGRYHWNQAVHGLTLNVRKVF  452

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D+D ELF ECL  FQE+E++E++IK +RE+TWKRLEEIA  K +SNE VLV+
Sbjct  453  FDLDPELFNECLLNFQEEEAKEEKIKSRRESTWKRLEEIAADKVSSNEAVLVN  505



>ref|XP_010514232.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Camelina sativa]
Length=505

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIF ALE+N++ HWNQAV SLTLNVRK+F
Sbjct  401  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFLALERNAQKHWNQAVHSLTLNVRKIF  460

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D D ELF+ECL KF+EDES+  E + KREATWKRLEE+ G++ AS
Sbjct  461  HDQDPELFKECLAKFKEDESKAAETEAKREATWKRLEEL-GVQKAS  505



>gb|KDO82045.1| hypothetical protein CISIN_1g010504mg [Citrus sinensis]
 gb|KDO82046.1| hypothetical protein CISIN_1g010504mg [Citrus sinensis]
Length=508

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVILPIIFPALEKN   HWNQ VQ+LT+NVRK+FS+
Sbjct  405  FQVAERALYLWNNDHIENLIRQNRKVILPIIFPALEKNGCNHWNQVVQNLTVNVRKIFSE  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAG  463
            ID ELF+ECL KF+E E++ +EI+ + +A+WKRLEEIA 
Sbjct  465  IDPELFDECLQKFKESEAKVEEIRTQCDASWKRLEEIAA  503



>ref|XP_006438131.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 ref|XP_006438132.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 gb|ESR51371.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 gb|ESR51372.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
Length=508

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI+QNRKVILPIIFPALEKN   HWNQ VQ+LT+NVRK+FS+
Sbjct  405  FQVAERALYLWNNDHIENLIRQNRKVILPIIFPALEKNGCNHWNQVVQNLTVNVRKIFSE  464

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAG  463
            ID ELF+ECL KF+E E++ +EI+ + +A+WKRLEEIA 
Sbjct  465  IDPELFDECLQKFKESEAKVEEIRTQCDASWKRLEEIAA  503



>ref|XP_010514230.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Camelina sativa]
 ref|XP_010514231.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Camelina sativa]
Length=516

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIF ALE+N++ HWNQAV SLTLNVRK+F
Sbjct  412  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFLALERNAQKHWNQAVHSLTLNVRKIF  471

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D D ELF+ECL KF+EDES+  E + KREATWKRLEE+ G++ AS
Sbjct  472  HDQDPELFKECLAKFKEDESKAAETEAKREATWKRLEEL-GVQKAS  516



>ref|XP_009359306.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=522

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERAL+LWNNDHIENLI++N KVILPIIFPALEKN R HWNQ  +SLTLN+RK++SD
Sbjct  403  FQVAERALYLWNNDHIENLIRENCKVILPIIFPALEKNGRNHWNQVARSLTLNIRKIYSD  462

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +D ELFEECL KFQE+E++E+E   K EATWKRLEE+A   A S+E   V  R+ P  TS
Sbjct  463  VDPELFEECLLKFQEEEAKEEETLAKHEATWKRLEEVAASNAVSSEA--VGRRLGPIQTS  520



>gb|AFW58632.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=470

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = -2

Query  783  SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTL  604
            SFH+     QVAERALFLWNNDHIE LIKQN KV+LPII+PALE+NSR HWNQAV+SLTL
Sbjct  348  SFHF-----QVAERALFLWNNDHIETLIKQNYKVLLPIIYPALERNSRDHWNQAVRSLTL  402

Query  603  NVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPV  436
            NVRK+FSD D+  F EC+ +F ++E ++ E   KR+A WKRLEE+   K   N P+
Sbjct  403  NVRKIFSDHDSTFFGECVQRFSDEELKQAESDSKRDAMWKRLEEMGASKPGGNHPL  458



>ref|XP_004981072.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Setaria italica]
 ref|XP_004981073.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Setaria italica]
Length=519

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN +VILPIIFPALE+N+  HWNQAVQSLTLNVRKLFSD
Sbjct  399  FQVAERALFLWNNDHIESLIKQNSRVILPIIFPALERNTNGHWNQAVQSLTLNVRKLFSD  458

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             DA LF ECL K++E++++E+E+K+K+EATWKRLEEIA  KA S   VLVS R  PR +S
Sbjct  459  HDAGLFTECLRKYEEEKAKEKEVKLKQEATWKRLEEIASAKATSGTAVLVS-RPLPRQSS  517

Query  399  G  397
             
Sbjct  518  A  518



>ref|NP_001183245.1| hypothetical protein [Zea mays]
 gb|ACR36180.1| unknown [Zea mays]
 gb|AFW58631.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=510

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 5/116 (4%)
 Frame = -2

Query  783  SFHYLILFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTL  604
            SFH+     QVAERALFLWNNDHIE LIKQN KV+LPII+PALE+NSR HWNQAV+SLTL
Sbjct  388  SFHF-----QVAERALFLWNNDHIETLIKQNYKVLLPIIYPALERNSRDHWNQAVRSLTL  442

Query  603  NVRKLFSDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPV  436
            NVRK+FSD D+  F EC+ +F ++E ++ E   KR+A WKRLEE+   K   N P+
Sbjct  443  NVRKIFSDHDSTFFGECVQRFSDEELKQAESDSKRDAMWKRLEEMGASKPGGNHPL  498



>ref|XP_002885457.1| protein phosphatase 2A B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61716.1| protein phosphatase 2A B [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPALE+N+R HWNQAVQSLT+NVRK+F D
Sbjct  415  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPALERNTRGHWNQAVQSLTINVRKVFCD  474

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKA-ASNEPVLVSHRVA  415
            ID  LF+ECL KFQ +E  + E K KRE TW+RLE++A  K   +NE +LV   V+
Sbjct  475  IDQVLFDECLAKFQVEEENKTEAKAKRERTWQRLEDLATSKTVVTNETMLVPRFVS  530



>ref|XP_003551893.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Glycine max]
 ref|XP_006601907.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Glycine max]
 gb|KHN24101.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Glycine soja]
Length=517

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 5/121 (4%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLIKQNRKVI+PIIFPALE+N+R+HWNQAV  LTLNVRK+F+D
Sbjct  402  FQVAERALFLWNNDHIMNLIKQNRKVIMPIIFPALERNARSHWNQAVHGLTLNVRKIFND  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
            +DA+L +ECL KF+E+ES++ E+   REATWKRLEE+    AA+ E VL+  +  PR ++
Sbjct  462  VDADLSKECLQKFEEEESKKSEVMAGREATWKRLEEL----AANGEAVLIG-KAPPRNSA  516

Query  399  G  397
            G
Sbjct  517  G  517



>ref|XP_003573322.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Brachypodium distachyon]
Length=519

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 91/108 (84%), Gaps = 2/108 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN KV+LPII PALE+N++ HW+QAVQSL+LNVRK+F D
Sbjct  402  FQVAERALFLWNNDHIESLIKQNSKVLLPIILPALERNTKGHWHQAVQSLSLNVRKIFLD  461

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEI--AGIKAASNE  442
             D  LF ECL KF++DE++E  ++ KREATWKRLEEI  + ++AAS E
Sbjct  462  HDPALFSECLKKFEDDEAQEAAVRSKREATWKRLEEITMSNLQAASPE  509



>ref|NP_001169040.1| hypothetical protein [Zea mays]
 gb|ACN31499.1| unknown [Zea mays]
 tpg|DAA60241.1| TPA: hypothetical protein ZEAMMB73_811871 [Zea mays]
Length=539

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LF WNN H ENL+KQN KVILPI+FPALEKN   HWNQ V+SL+LNVRKLFSD
Sbjct  419  FQVAERVLFFWNNTHFENLVKQNSKVILPIVFPALEKNINGHWNQVVRSLSLNVRKLFSD  478

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D ++F ECL  ++ED+ RE+E ++K+E  WKRL+EIA  K  S E VLVS
Sbjct  479  RDPQMFNECLRGYEEDKDREKEFRLKQELAWKRLDEIASAKVTSGEAVLVS  529



>emb|CDY09766.1| BnaC07g32950D [Brassica napus]
Length=465

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N   HWNQAV++LTLNVRK+ ++
Sbjct  338  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPAMERNMCGHWNQAVKNLTLNVRKVLAE  397

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLV  430
             D  LF+ECL KFQEDE+ + E+  KREATWK LE++A  K+ S+E VLV
Sbjct  398  TDQALFDECLAKFQEDEASKPEVAAKREATWKLLEDLAASKSVSSEAVLV  447



>tpg|DAA39803.1| TPA: hypothetical protein ZEAMMB73_878468 [Zea mays]
Length=509

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAER LF WNN H EN +KQN KVILPII PALEKN   HWNQ VQSL+LNVRKL SD
Sbjct  389  FQVAERVLFFWNNIHFENFVKQNSKVILPIILPALEKNINGHWNQVVQSLSLNVRKLLSD  448

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             D ++F ECL K++ED+ RE+E K+K+E  WKRL+EIA  K  S E VLVS  + PR  S
Sbjct  449  RDPQMFTECLRKYEEDKGREKEFKLKQELAWKRLDEIASAKVTSGEAVLVSPTL-PRQPS  507



>emb|CDY44320.1| BnaC05g30730D [Brassica napus]
Length=508

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPALE+N+R HWNQAV++LTLNVRK+FSD
Sbjct  384  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPALERNTRGHWNQAVKTLTLNVRKVFSD  443

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVA  415
            +D  LF+ECL KFQ +E  + E+K  RE TWKRLE++A  K  +NE  LV   V+
Sbjct  444  VDQALFDECLAKFQVEEENKTELKANRERTWKRLEDLAASK--TNEAELVPRFVS  496



>ref|XP_010228176.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Brachypodium 
distachyon]
 ref|XP_010228177.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=517

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNND IENLI QN KV+LPIIFPALE N   HWNQAVQSLTLNVRKLFSD
Sbjct  397  FQVAERALFLWNNDRIENLINQNSKVLLPIIFPALENNINGHWNQAVQSLTLNVRKLFSD  456

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVSHRVAPRATS  400
             + ELF +CL +++E++++E E K+K+E+TWKRLEEIA  KA + E VLVS R  PR +S
Sbjct  457  CEPELFAQCLGRYEEEKAKEAEHKLKQESTWKRLEEIASSKATTGEAVLVS-RNLPRLSS  515



>ref|XP_002444972.1| hypothetical protein SORBIDRAFT_07g002150 [Sorghum bicolor]
 gb|EES14467.1| hypothetical protein SORBIDRAFT_07g002150 [Sorghum bicolor]
Length=509

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHIE+LIKQN KVILPIIFPALE+N++ HWNQAVQSL+LNVRK+F D
Sbjct  406  FQVAERALFLWNNDHIESLIKQNSKVILPIIFPALERNTKGHWNQAVQSLSLNVRKIFMD  465

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIA  466
             D  LFEEC  KF+E+E++E  ++ KREA WKRLEEIA
Sbjct  466  HDPTLFEECRKKFEEEEAQEAGVRSKREARWKRLEEIA  503



>ref|XP_009145466.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform [Brassica rapa]
Length=509

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPALE+N+R HWNQAV++LTLNVRK+FSD
Sbjct  385  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPALERNTRGHWNQAVKTLTLNVRKVFSD  444

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNE--PVLVS  427
            ID  LF+ECL KFQ +E  + E+K  RE TWKRLE++A  K    E  P  VS
Sbjct  445  IDQALFDECLAKFQVEEENKTEVKANRERTWKRLEDLAASKTDEAELVPRFVS  497



>emb|CDX90593.1| BnaA03g41880D [Brassica napus]
Length=464

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPA+E+N  +HWNQ V++LTLNVRK+ ++
Sbjct  337  FQVAERALFLWNNDHIRNLITQNLKVIMPIVFPAMERNMCSHWNQTVKNLTLNVRKVLAE  396

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAASNEPVLVS  427
             D  LF+ECL KFQEDE+ + E+  KREATWK LE++A  K  S+E VLV+
Sbjct  397  TDQALFDECLAKFQEDEASKAEVAAKREATWKLLEDLAASKTVSSEAVLVT  447



>ref|XP_010502490.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Camelina sativa]
 ref|XP_010502491.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Camelina sativa]
Length=517

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -2

Query  765  LFLQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLF  586
            L  QVAERALFLWNN+HIENLI QNRKVILPIIF ALE+N++ HWNQAV SLT+NVRK+F
Sbjct  413  LHFQVAERALFLWNNNHIENLIMQNRKVILPIIFLALERNAQKHWNQAVHSLTVNVRKIF  472

Query  585  SDIDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKAAS  448
             D D ELF+ECL KF+EDE++  E + KREATWKRLEE+ G++ AS
Sbjct  473  HDQDPELFKECLAKFKEDETKAAETEAKREATWKRLEEL-GVQKAS  517



>dbj|BAB02360.1| protein phosphatase 2A B' regulatory subunit [Arabidopsis thaliana]
Length=518

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = -2

Query  759  LQVAERALFLWNNDHIENLIKQNRKVILPIIFPALEKNSRTHWNQAVQSLTLNVRKLFSD  580
             QVAERALFLWNNDHI NLI QN KVI+PI+FPALE+N+R HWNQAVQSLT+NVRK+  +
Sbjct  389  FQVAERALFLWNNDHIRNLITQNHKVIMPIVFPALERNTRGHWNQAVQSLTINVRKVLCE  448

Query  579  IDAELFEECLHKFQEDESREQEIKMKREATWKRLEEIAGIKA-ASNEPVLVSHRVA  415
            ID  LF+ECL KFQ +E  + E+K KRE TW+RLE++A  K   +NE VLV   V+
Sbjct  449  IDQVLFDECLAKFQVEEVNKTEVKAKRERTWQRLEDLATSKTVVTNEAVLVPRFVS  504



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2213930630844