BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8480

Length=820
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD06582.1|  PERK1-like protein kinase                              233   2e-71   Nicotiana tabacum [American tobacco]
ref|XP_009601165.1|  PREDICTED: proline-rich receptor-like protei...    232   2e-67   Nicotiana tomentosiformis
ref|XP_009601166.1|  PREDICTED: proline-rich receptor-like protei...    232   3e-67   Nicotiana tomentosiformis
dbj|BAF43699.1|  PERK1-like protein kinase                              232   4e-67   Nicotiana tabacum [American tobacco]
ref|XP_011078316.1|  PREDICTED: proline-rich receptor-like protei...    228   9e-66   Sesamum indicum [beniseed]
ref|XP_009781639.1|  PREDICTED: proline-rich receptor-like protei...    227   3e-65   Nicotiana sylvestris
ref|XP_009781640.1|  PREDICTED: proline-rich receptor-like protei...    227   3e-65   Nicotiana sylvestris
ref|XP_002514297.1|  ATP binding protein, putative                      222   1e-63   Ricinus communis
ref|XP_011043470.1|  PREDICTED: proline-rich receptor-like protei...    221   3e-63   Populus euphratica
ref|XP_011043469.1|  PREDICTED: proline-rich receptor-like protei...    221   4e-63   Populus euphratica
ref|XP_006372053.1|  hypothetical protein POPTR_0018s08800g             221   5e-63   Populus trichocarpa [western balsam poplar]
ref|XP_007013165.1|  Proline extensin-like receptor kinase 1            218   6e-62   
ref|XP_010103058.1|  Proline-rich receptor-like protein kinase PERK1    212   2e-61   
ref|XP_010249724.1|  PREDICTED: proline-rich receptor-like protei...    214   8e-61   Nelumbo nucifera [Indian lotus]
emb|CDP03328.1|  unnamed protein product                                203   2e-60   Coffea canephora [robusta coffee]
gb|EYU32927.1|  hypothetical protein MIMGU_mgv1a002397mg                213   5e-60   Erythranthe guttata [common monkey flower]
gb|KDO48900.1|  hypothetical protein CISIN_1g014904mg                   206   2e-59   Citrus sinensis [apfelsine]
ref|XP_010527207.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    209   4e-59   Tarenaya hassleriana [spider flower]
gb|AAS65794.1|  putative protein kinase                                 198   7e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20676.1|  Proline-rich receptor-like protein kinase PERK1         205   1e-58   Glycine soja [wild soybean]
ref|XP_012076697.1|  PREDICTED: proline-rich receptor-like protei...    207   3e-58   Jatropha curcas
gb|KHN45639.1|  Proline-rich receptor-like protein kinase PERK1         202   6e-58   Glycine soja [wild soybean]
gb|KCW82423.1|  hypothetical protein EUGRSUZ_C03822                     202   6e-58   Eucalyptus grandis [rose gum]
ref|NP_001237102.1|  putative receptor protein kinase PERK1             202   6e-58   
ref|XP_010051585.1|  PREDICTED: proline-rich receptor-like protei...    202   1e-57   
ref|XP_006353460.1|  PREDICTED: proline-rich receptor-like protei...    206   1e-57   Solanum tuberosum [potatoes]
ref|XP_003528909.1|  PREDICTED: proline-rich receptor-like protei...    206   2e-57   Glycine max [soybeans]
ref|XP_009757853.1|  PREDICTED: proline-rich receptor-like protei...    206   2e-57   Nicotiana sylvestris
ref|XP_006451164.1|  hypothetical protein CICLE_v10007670mg             205   4e-57   Citrus clementina [clementine]
ref|XP_007152836.1|  hypothetical protein PHAVU_004G164000g             204   4e-57   Phaseolus vulgaris [French bean]
ref|XP_004251608.1|  PREDICTED: proline-rich receptor-like protei...    205   4e-57   Solanum lycopersicum
ref|XP_002883531.1|  hypothetical protein ARALYDRAFT_479967             204   6e-57   
ref|XP_006586722.1|  PREDICTED: putative receptor protein kinase ...    202   3e-56   
ref|XP_009594845.1|  PREDICTED: proline-rich receptor-like protei...    202   6e-56   Nicotiana tomentosiformis
ref|XP_010466870.1|  PREDICTED: proline-rich receptor-like protei...    201   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010488565.1|  PREDICTED: proline-rich receptor-like protei...    201   7e-56   Camelina sativa [gold-of-pleasure]
gb|KHG20318.1|  Proline-rich receptor-like protein kinase PERK1         200   2e-55   Gossypium arboreum [tree cotton]
ref|XP_006297170.1|  hypothetical protein CARUB_v10013175mg             200   2e-55   Capsella rubella
gb|KFK39776.1|  hypothetical protein AALP_AA3G286200                    200   2e-55   Arabis alpina [alpine rockcress]
ref|XP_010513600.1|  PREDICTED: proline-rich receptor-like protei...    200   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_003620684.1|  Somatic embryogenesis receptor kinase              199   3e-55   Medicago truncatula
ref|XP_002284430.2|  PREDICTED: proline-rich receptor-like protei...    199   4e-55   Vitis vinifera
ref|XP_010254113.1|  PREDICTED: proline-rich receptor-like protei...    200   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010925846.1|  PREDICTED: proline-rich receptor-like protei...    196   6e-55   
dbj|BAH57220.1|  AT3G24550                                              197   8e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAK43886.1|AF370509_1  protein kinase-like protein                   198   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189098.1|  proline-rich extensin-like receptor kinase 1          197   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795084.1|  PREDICTED: proline-rich receptor-like protei...    196   1e-54   
ref|XP_009102500.1|  PREDICTED: proline-rich receptor-like protei...    196   3e-54   Brassica rapa
gb|AAK21965.1|  receptor protein kinase PERK1                           196   3e-54   Brassica napus [oilseed rape]
gb|KJB54196.1|  hypothetical protein B456_009G025100                    196   3e-54   Gossypium raimondii
ref|XP_008458364.1|  PREDICTED: proline-rich receptor-like protei...    196   4e-54   Cucumis melo [Oriental melon]
ref|XP_006418729.1|  hypothetical protein EUTSA_v10002434mg             196   5e-54   Eutrema salsugineum [saltwater cress]
ref|XP_004512982.1|  PREDICTED: proline-rich receptor-like protei...    195   1e-53   Cicer arietinum [garbanzo]
ref|XP_004139342.1|  PREDICTED: proline-rich receptor-like protei...    195   1e-53   Cucumis sativus [cucumbers]
ref|XP_008781703.1|  PREDICTED: proline-rich receptor-like protei...    194   2e-53   Phoenix dactylifera
gb|KGN65152.1|  hypothetical protein Csa_1G250150                       193   4e-53   Cucumis sativus [cucumbers]
gb|ERM98577.1|  hypothetical protein AMTR_s00109p00039350               190   4e-53   Amborella trichopoda
ref|XP_004150052.1|  PREDICTED: proline-rich receptor-like protei...    193   5e-53   Cucumis sativus [cucumbers]
emb|CDX77417.1|  BnaA07g05550D                                          192   1e-52   
emb|CDY39543.1|  BnaC07g07110D                                          192   1e-52   Brassica napus [oilseed rape]
ref|XP_011093589.1|  PREDICTED: proline-rich receptor-like protei...    192   1e-52   Sesamum indicum [beniseed]
ref|XP_011620537.1|  PREDICTED: proline-rich receptor-like protei...    191   4e-52   Amborella trichopoda
ref|XP_008242654.1|  PREDICTED: proline-rich receptor-like protei...    190   8e-52   Prunus mume [ume]
ref|XP_009419795.1|  PREDICTED: proline-rich receptor-like protei...    190   1e-51   
ref|XP_007204236.1|  hypothetical protein PRUPE_ppa002532mg             189   1e-51   Prunus persica
ref|XP_008361244.1|  PREDICTED: proline-rich receptor-like protei...    188   3e-51   
ref|XP_009374021.1|  PREDICTED: proline-rich receptor-like protei...    188   3e-51   
ref|XP_008337381.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    188   4e-51   
gb|KDO48899.1|  hypothetical protein CISIN_1g014904mg                   181   3e-50   Citrus sinensis [apfelsine]
gb|KJB07173.1|  hypothetical protein B456_001G005700                    186   3e-50   Gossypium raimondii
gb|EPS72303.1|  hypothetical protein M569_02452                         184   1e-49   Genlisea aurea
gb|AFW82074.1|  putative prolin-rich extensin-like receptor prote...    171   1e-48   
gb|ACN40429.1|  unknown                                                 181   2e-48   Picea sitchensis
ref|XP_009380552.1|  PREDICTED: proline-rich receptor-like protei...    179   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO38462.1|  hypothetical protein CISIN_1g046502mg                   179   6e-48   Citrus sinensis [apfelsine]
gb|ACN33630.1|  unknown                                                 171   1e-47   Zea mays [maize]
gb|EMS62683.1|  Proline-rich receptor-like protein kinase PERK1         175   2e-47   Triticum urartu
ref|XP_006654162.1|  PREDICTED: proline-rich receptor-like protei...    175   2e-47   Oryza brachyantha
gb|AGV22099.1|  receptor protein kinase                                 177   2e-47   Brassica juncea var. tumida [zha cai]
ref|XP_007024170.1|  Proline extensin-like receptor kinase 1            176   4e-47   
ref|XP_004287409.1|  PREDICTED: proline-rich receptor-like protei...    176   8e-47   Fragaria vesca subsp. vesca
ref|XP_004960636.1|  PREDICTED: proline-rich receptor-like protei...    175   1e-46   Setaria italica
dbj|BAJ96935.1|  predicted protein                                      175   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002439469.1|  hypothetical protein SORBIDRAFT_09g007240          173   2e-46   
gb|EMT10712.1|  Putative serine/threonine-protein kinase                174   2e-46   
gb|ACG28793.1|  receptor protein kinase PERK1                           174   3e-46   Zea mays [maize]
ref|NP_001148076.1|  LOC100281684                                       174   3e-46   Zea mays [maize]
gb|AFW77531.1|  putative prolin-rich extensin-like receptor prote...    170   9e-46   
ref|XP_003568732.1|  PREDICTED: proline-rich receptor-like protei...    173   1e-45   Brachypodium distachyon [annual false brome]
gb|ACF86764.1|  unknown                                                 170   1e-45   Zea mays [maize]
ref|XP_009413938.1|  PREDICTED: proline-rich receptor-like protei...    172   1e-45   
gb|AFW77530.1|  putative prolin-rich extensin-like receptor prote...    169   2e-45   
gb|KJB64911.1|  hypothetical protein B456_010G072000                    168   4e-45   Gossypium raimondii
ref|XP_010915808.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    171   4e-45   
ref|NP_001145767.1|  uncharacterized LOC100279274                       171   6e-45   Zea mays [maize]
ref|XP_008463394.1|  PREDICTED: proline-rich receptor-like protei...    170   8e-45   Cucumis melo [Oriental melon]
ref|XP_009400136.1|  PREDICTED: proline-rich receptor-like protei...    170   8e-45   
ref|NP_001054941.1|  Os05g0218400                                       166   9e-45   
ref|XP_007135679.1|  hypothetical protein PHAVU_010G149300g             169   1e-44   Phaseolus vulgaris [French bean]
gb|AAO72646.1|  putative receptor protein kinase                        166   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003529582.1|  PREDICTED: proline-rich receptor-like protei...    169   1e-44   Glycine max [soybeans]
gb|EEC78728.1|  hypothetical protein OsI_18915                          166   4e-44   Oryza sativa Indica Group [Indian rice]
gb|KJB64910.1|  hypothetical protein B456_010G072000                    168   4e-44   Gossypium raimondii
gb|AAV25281.1|  putative protein kinase                                 166   6e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KCW53715.1|  hypothetical protein EUGRSUZ_J02973                     167   6e-44   Eucalyptus grandis [rose gum]
gb|KCW53716.1|  hypothetical protein EUGRSUZ_J02973                     166   9e-44   Eucalyptus grandis [rose gum]
ref|XP_010033870.1|  PREDICTED: proline-rich receptor-like protei...    166   1e-43   Eucalyptus grandis [rose gum]
ref|XP_002457091.1|  hypothetical protein SORBIDRAFT_03g001090          162   2e-43   
ref|XP_009764139.1|  PREDICTED: proline-rich receptor-like protei...    165   3e-43   Nicotiana sylvestris
ref|XP_008354402.1|  PREDICTED: proline-rich receptor-like protei...    166   3e-43   
ref|XP_009371460.1|  PREDICTED: proline-rich receptor-like protei...    166   3e-43   Pyrus x bretschneideri [bai li]
gb|KHF99092.1|  Proline-rich receptor-like protein kinase PERK15        165   4e-43   Gossypium arboreum [tree cotton]
gb|KJB18677.1|  hypothetical protein B456_003G065300                    165   4e-43   Gossypium raimondii
ref|XP_009611770.1|  PREDICTED: proline-rich receptor-like protei...    162   5e-42   Nicotiana tomentosiformis
ref|XP_006343065.1|  PREDICTED: proline-rich receptor-like protei...    161   9e-42   Solanum tuberosum [potatoes]
ref|XP_006856033.1|  PREDICTED: proline-rich receptor-like protei...    162   9e-42   Amborella trichopoda
ref|XP_006343064.1|  PREDICTED: proline-rich receptor-like protei...    161   9e-42   Solanum tuberosum [potatoes]
ref|XP_003565887.2|  PREDICTED: proline-rich receptor-like protei...    160   2e-41   
ref|XP_002516042.1|  ATP binding protein, putative                      157   2e-41   
ref|XP_004235663.1|  PREDICTED: proline-rich receptor-like protei...    156   5e-40   Solanum lycopersicum
ref|XP_004235662.1|  PREDICTED: proline-rich receptor-like protei...    156   5e-40   Solanum lycopersicum
emb|CBI32578.3|  unnamed protein product                                151   7e-40   Vitis vinifera
emb|CDM82387.1|  unnamed protein product                                154   7e-40   Triticum aestivum [Canadian hard winter wheat]
emb|CDO98035.1|  unnamed protein product                                154   2e-39   Coffea canephora [robusta coffee]
ref|XP_010688207.1|  PREDICTED: proline-rich receptor-like protei...    155   2e-39   
dbj|BAJ85456.1|  predicted protein                                      154   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001169872.1|  uncharacterized protein LOC100383766               147   3e-39   
ref|XP_010034845.1|  PREDICTED: proline-rich receptor-like protei...    152   4e-39   
ref|XP_009409451.1|  PREDICTED: proline-rich receptor-like protei...    154   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010034847.1|  PREDICTED: proline-rich receptor-like protei...    145   4e-39   
ref|XP_009105891.1|  PREDICTED: proline-rich receptor-like protei...    153   7e-39   Brassica rapa
ref|XP_010026169.1|  PREDICTED: proline-rich receptor-like protei...    153   9e-39   
ref|XP_004967426.1|  PREDICTED: proline-rich receptor-like protei...    153   1e-38   Setaria italica
ref|XP_010688206.1|  PREDICTED: proline-rich receptor-like protei...    151   3e-38   
ref|NP_001042469.1|  Os01g0227200                                       151   4e-38   
ref|NP_175639.1|  proline-rich receptor-like protein kinase PERK15      150   4e-38   Arabidopsis thaliana [mouse-ear cress]
gb|EAY73106.1|  hypothetical protein OsI_00982                          151   4e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_011072361.1|  PREDICTED: proline-rich receptor-like protei...    149   5e-38   Sesamum indicum [beniseed]
ref|XP_006369183.1|  hypothetical protein POPTR_0001s18340g             150   9e-38   
ref|XP_003631608.1|  PREDICTED: proline-rich receptor-like protei...    150   1e-37   Vitis vinifera
ref|XP_011072360.1|  PREDICTED: proline-rich receptor-like protei...    149   1e-37   Sesamum indicum [beniseed]
ref|XP_006392938.1|  hypothetical protein EUTSA_v10011404mg             149   1e-37   
ref|XP_008790437.1|  PREDICTED: putative proline-rich receptor-li...    148   2e-37   
tpg|DAA52780.1|  TPA: putative prolin-rich extensin-like receptor...    147   2e-37   
ref|XP_011010164.1|  PREDICTED: proline-rich receptor-like protei...    148   2e-37   Populus euphratica
gb|EEE62769.1|  hypothetical protein OsJ_17572                          147   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645667.1|  PREDICTED: proline-rich receptor-like protei...    148   2e-37   
gb|KDO56892.1|  hypothetical protein CISIN_1g007892mg                   148   3e-37   Citrus sinensis [apfelsine]
ref|XP_006426969.1|  hypothetical protein CICLE_v10025247mg             148   4e-37   Citrus clementina [clementine]
gb|KDO56891.1|  hypothetical protein CISIN_1g007892mg                   148   4e-37   Citrus sinensis [apfelsine]
ref|XP_002894371.1|  kinase family protein                              148   4e-37   
ref|XP_012073359.1|  PREDICTED: proline-rich receptor-like protei...    147   5e-37   Jatropha curcas
ref|XP_010466843.1|  PREDICTED: proline-rich receptor-like protei...    148   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010041514.1|  PREDICTED: proline-rich receptor-like protei...    140   1e-36   Eucalyptus grandis [rose gum]
ref|XP_008673227.1|  PREDICTED: uncharacterized protein LOC100383...    147   1e-36   
gb|KCW82422.1|  hypothetical protein EUGRSUZ_C03822                     145   1e-36   Eucalyptus grandis [rose gum]
ref|XP_002888452.1|  hypothetical protein ARALYDRAFT_475678             146   2e-36   
ref|XP_007046970.1|  Roline-rich extensin-like receptor kinase 4        146   2e-36   
ref|XP_010545704.1|  PREDICTED: proline-rich receptor-like protei...    146   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_002299708.2|  hypothetical protein POPTR_0001s18340g             145   3e-36   
emb|CDY47531.1|  BnaC03g69310D                                          145   3e-36   Brassica napus [oilseed rape]
ref|XP_009346006.1|  PREDICTED: proline-rich receptor-like protei...    145   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_008338542.1|  PREDICTED: proline-rich receptor-like protei...    145   4e-36   
ref|XP_006307254.1|  hypothetical protein CARUB_v10008870mg             145   4e-36   Capsella rubella
dbj|BAB02941.1|  somatic embryogenesis receptor kinase-like protein     144   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356695.1|  PREDICTED: proline-rich receptor-like protei...    145   6e-36   
ref|NP_195170.2|  proline-rich receptor-like protein kinase PERK5       145   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869145.1|  predicted protein                                  145   7e-36   Arabidopsis lyrata subsp. lyrata
ref|XP_006409147.1|  hypothetical protein EUTSA_v10022596mg             145   7e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010034739.1|  PREDICTED: proline-rich receptor-like protei...    143   8e-36   
ref|XP_010113486.1|  Proline-rich receptor-like protein kinase PERK4    144   8e-36   Morus notabilis
ref|XP_010490110.1|  PREDICTED: proline-rich receptor-like protei...    146   9e-36   
ref|XP_010936290.1|  PREDICTED: proline-rich receptor-like protei...    145   9e-36   Elaeis guineensis
ref|XP_008228537.1|  PREDICTED: proline-rich receptor-like protei...    144   1e-35   Prunus mume [ume]
gb|EYU21456.1|  hypothetical protein MIMGU_mgv1a004031mg                144   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_010936289.1|  PREDICTED: proline-rich receptor-like protei...    145   1e-35   
ref|XP_006418751.1|  hypothetical protein EUTSA_v10002411mg             145   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010513421.1|  PREDICTED: proline-rich receptor-like protei...    144   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007215322.1|  hypothetical protein PRUPE_ppa003567mg             143   2e-35   Prunus persica
emb|CDY02546.1|  BnaA08g01530D                                          143   2e-35   
sp|Q9LK03.3|PERK2_ARATH  RecName: Full=Proline-rich receptor-like...    144   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107140.1|  PREDICTED: proline-rich receptor-like protei...    142   4e-35   Brassica rapa
ref|XP_002886173.1|  predicted protein                                  142   7e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010479734.1|  PREDICTED: proline-rich receptor-like protei...    141   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002509476.1|  somatic embryogenesis receptor kinase, putative    140   1e-34   
ref|XP_008380925.1|  PREDICTED: proline-rich receptor-like protei...    141   1e-34   
ref|XP_010050496.1|  PREDICTED: proline-rich receptor-like protei...    140   2e-34   
ref|XP_010500823.1|  PREDICTED: proline-rich receptor-like protei...    140   2e-34   Camelina sativa [gold-of-pleasure]
ref|NP_179437.1|  proline-rich extensin-like receptor kinase 4          140   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691327.1|  PREDICTED: proline-rich receptor-like protei...    140   2e-34   
ref|XP_010691326.1|  PREDICTED: proline-rich receptor-like protei...    140   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008785658.1|  PREDICTED: proline-rich receptor-like protei...    140   3e-34   Phoenix dactylifera
gb|EMS56036.1|  hypothetical protein TRIUR3_09654                       136   4e-34   Triticum urartu
ref|XP_007042215.1|  Roline-rich extensin-like receptor kinase 4        139   5e-34   
ref|XP_002978933.1|  hypothetical protein SELMODRAFT_177358             137   6e-34   
ref|XP_010462066.1|  PREDICTED: proline-rich receptor-like protei...    139   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010520632.1|  PREDICTED: proline-rich receptor-like protei...    138   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_010414353.1|  PREDICTED: proline-rich receptor-like protei...    139   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006465607.1|  PREDICTED: proline-rich receptor-like protei...    138   1e-33   Citrus sinensis [apfelsine]
gb|EMT01740.1|  Putative serine/threonine-protein kinase                138   1e-33   
ref|XP_006465608.1|  PREDICTED: proline-rich receptor-like protei...    138   1e-33   Citrus sinensis [apfelsine]
gb|KJB27138.1|  hypothetical protein B456_004G280200                    139   1e-33   Gossypium raimondii
gb|EYU40150.1|  hypothetical protein MIMGU_mgv1a002653mg                139   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_010467665.1|  PREDICTED: proline-rich receptor-like protei...    138   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006383219.1|  kinase family protein                              138   2e-33   
ref|XP_006299531.1|  hypothetical protein CARUB_v10015703mg             139   2e-33   Capsella rubella
ref|XP_008241661.1|  PREDICTED: proline-rich receptor-like protei...    137   2e-33   
ref|XP_010939267.1|  PREDICTED: proline-rich receptor-like protei...    137   3e-33   Elaeis guineensis
ref|XP_009102242.1|  PREDICTED: proline-rich receptor-like protei...    137   3e-33   Brassica rapa
emb|CAA18823.1|  putative serine/threonine protein kinase               137   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002991493.1|  hypothetical protein SELMODRAFT_133636             135   5e-33   
ref|XP_010548337.1|  PREDICTED: proline-rich receptor-like protei...    136   6e-33   Tarenaya hassleriana [spider flower]
emb|CBI17536.3|  unnamed protein product                                132   7e-33   Vitis vinifera
ref|XP_010999977.1|  PREDICTED: proline-rich receptor-like protei...    136   7e-33   Populus euphratica
ref|XP_007204613.1|  hypothetical protein PRUPE_ppa002502mg             137   8e-33   Prunus persica
ref|XP_006285233.1|  hypothetical protein CARUB_v10006593mg             136   9e-33   Capsella rubella
gb|EYU17836.1|  hypothetical protein MIMGU_mgv1a002201mg                137   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_010096182.1|  hypothetical protein L484_026916                   130   1e-32   
gb|KHG22016.1|  Proline-rich receptor-like protein kinase PERK1         134   1e-32   Gossypium arboreum [tree cotton]
ref|XP_010479680.1|  PREDICTED: proline-rich receptor-like protei...    130   1e-32   
ref|XP_009371633.1|  PREDICTED: proline-rich receptor-like protei...    135   2e-32   
ref|XP_008338108.1|  PREDICTED: proline-rich receptor-like protei...    135   2e-32   
emb|CDY51224.1|  BnaC09g09790D                                          137   2e-32   Brassica napus [oilseed rape]
gb|KCW53712.1|  hypothetical protein EUGRSUZ_J02968                     133   2e-32   Eucalyptus grandis [rose gum]
emb|CDY65603.1|  BnaA07g36160D                                          135   2e-32   Brassica napus [oilseed rape]
ref|XP_010049680.1|  PREDICTED: proline-rich receptor-like protei...    134   3e-32   
ref|XP_008338107.1|  PREDICTED: proline-rich receptor-like protei...    135   3e-32   
ref|XP_010254881.1|  PREDICTED: proline-rich receptor-like protei...    135   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002279197.1|  PREDICTED: proline-rich receptor-like protei...    134   4e-32   Vitis vinifera
ref|XP_010049677.1|  PREDICTED: proline-rich receptor-like protei...    133   4e-32   
ref|XP_010034738.1|  PREDICTED: proline-rich receptor-like protei...    134   5e-32   
ref|XP_010049676.1|  PREDICTED: proline-rich receptor-like protei...    133   5e-32   Eucalyptus grandis [rose gum]
ref|XP_004509247.1|  PREDICTED: proline-rich receptor-like protei...    133   5e-32   
ref|XP_009353623.1|  PREDICTED: proline-rich receptor-like protei...    133   5e-32   Pyrus x bretschneideri [bai li]
gb|KCW53713.1|  hypothetical protein EUGRSUZ_J02969                     126   5e-32   Eucalyptus grandis [rose gum]
ref|XP_010034844.1|  PREDICTED: proline-rich receptor-like protei...    133   6e-32   Eucalyptus grandis [rose gum]
ref|XP_009112492.1|  PREDICTED: proline-rich receptor-like protei...    134   6e-32   Brassica rapa
ref|XP_004509245.1|  PREDICTED: proline-rich receptor-like protei...    133   6e-32   
ref|XP_002885643.1|  hypothetical protein ARALYDRAFT_319144             132   7e-32   
ref|XP_010489552.1|  PREDICTED: proline-rich receptor-like protei...    134   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011466698.1|  PREDICTED: proline-rich receptor-like protei...    132   8e-32   Fragaria vesca subsp. vesca
ref|XP_002882235.1|  hypothetical protein ARALYDRAFT_340394             130   2e-31   
ref|XP_010437615.1|  PREDICTED: proline-rich receptor-like protei...    133   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006297209.1|  hypothetical protein CARUB_v10013218mg             132   2e-31   Capsella rubella
ref|XP_010034842.1|  PREDICTED: proline-rich receptor-like protei...    132   2e-31   
ref|XP_002882234.1|  hypothetical protein ARALYDRAFT_896220             126   2e-31   
ref|XP_010649160.1|  PREDICTED: proline-rich receptor-like protei...    132   2e-31   Vitis vinifera
emb|CAN75405.1|  hypothetical protein VITISV_010509                     132   2e-31   Vitis vinifera
emb|CDY66134.1|  BnaCnng49640D                                          134   2e-31   Brassica napus [oilseed rape]
ref|XP_010649161.1|  PREDICTED: proline-rich receptor-like protei...    132   2e-31   Vitis vinifera
ref|XP_010481138.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    129   3e-31   
ref|XP_011466697.1|  PREDICTED: proline-rich receptor-like protei...    132   3e-31   Fragaria vesca subsp. vesca
gb|KFK30074.1|  hypothetical protein AALP_AA7G213300                    132   5e-31   Arabis alpina [alpine rockcress]
ref|XP_009411248.1|  PREDICTED: proline-rich receptor-like protei...    132   6e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412225.1|  hypothetical protein EUTSA_v10024434mg             132   6e-31   
ref|XP_011001605.1|  PREDICTED: proline-rich receptor-like protei...    130   6e-31   Populus euphratica
ref|XP_006425697.1|  hypothetical protein CICLE_v10025093mg             131   8e-31   Citrus clementina [clementine]
emb|CDY50610.1|  BnaC03g44010D                                          125   1e-30   Brassica napus [oilseed rape]
ref|XP_008457929.1|  PREDICTED: proline-rich receptor-like protei...    130   2e-30   Cucumis melo [Oriental melon]
ref|XP_004289145.1|  PREDICTED: proline-rich receptor-like protei...    130   2e-30   Fragaria vesca subsp. vesca
ref|XP_010432413.1|  PREDICTED: proline-rich receptor-like protei...    130   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_012072040.1|  PREDICTED: proline-rich receptor-like protei...    129   2e-30   Jatropha curcas
ref|XP_010680801.1|  PREDICTED: proline-rich receptor-like protei...    129   2e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW53422.1|  hypothetical protein EUGRSUZ_J026622                    124   2e-30   Eucalyptus grandis [rose gum]
emb|CDX75434.1|  BnaA01g02680D                                          129   3e-30   
ref|XP_009112498.1|  PREDICTED: proline-rich receptor-like protei...    129   3e-30   Brassica rapa
ref|XP_002521577.1|  somatic embryogenesis receptor kinase, putative    129   3e-30   Ricinus communis
ref|XP_011025764.1|  PREDICTED: proline-rich receptor-like protei...    129   4e-30   Populus euphratica
emb|CDX69059.1|  BnaC01g03940D                                          129   5e-30   
ref|XP_006380754.1|  hypothetical protein POPTR_0007s12680g             128   5e-30   
ref|XP_008453734.1|  PREDICTED: proline-rich receptor-like protei...    129   5e-30   Cucumis melo [Oriental melon]
emb|CDX95494.1|  BnaC01g33860D                                          129   6e-30   
ref|XP_006388225.1|  hypothetical protein POPTR_0275s002101g            124   7e-30   
gb|KHG05454.1|  Proline-rich receptor-like protein kinase PERK4         126   8e-30   Gossypium arboreum [tree cotton]
ref|XP_010447079.1|  PREDICTED: proline-rich receptor-like protei...    128   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_011100125.1|  PREDICTED: proline-rich receptor-like protei...    128   9e-30   
ref|XP_010033869.1|  PREDICTED: proline-rich receptor-like protei...    124   1e-29   
ref|XP_004512025.1|  PREDICTED: proline-rich receptor-like protei...    128   1e-29   Cicer arietinum [garbanzo]
ref|XP_006385464.1|  hypothetical protein POPTR_0003s052201g            123   2e-29   
gb|KJB43513.1|  hypothetical protein B456_007G204000                    127   2e-29   
gb|KHN44498.1|  Proline-rich receptor-like protein kinase PERK4         125   3e-29   
gb|KJB71040.1|  hypothetical protein B456_011G101800                    125   4e-29   
ref|XP_006599385.1|  PREDICTED: proline-rich receptor-like protei...    125   6e-29   
ref|XP_007156929.1|  hypothetical protein PHAVU_002G029200g             125   1e-28   
ref|NP_001132090.1|  uncharacterized protein LOC100193505               118   1e-28   
ref|XP_004292860.1|  PREDICTED: proline-rich receptor-like protei...    125   1e-28   
ref|XP_010033701.1|  PREDICTED: proline-rich receptor-like protei...    123   1e-28   
gb|KDO49101.1|  hypothetical protein CISIN_1g040832mg                   125   2e-28   
ref|XP_006423247.1|  hypothetical protein CICLE_v10029936mg             124   2e-28   
gb|KHN36118.1|  Proline-rich receptor-like protein kinase PERK4         122   2e-28   
ref|XP_006487199.1|  PREDICTED: proline-rich receptor-like protei...    125   2e-28   
gb|KFK30305.1|  hypothetical protein AALP_AA7G244700                    124   2e-28   
ref|XP_004148867.1|  PREDICTED: proline-rich receptor-like protei...    124   3e-28   
ref|XP_008783468.1|  PREDICTED: proline-rich receptor-like protei...    123   4e-28   
ref|XP_009609406.1|  PREDICTED: putative proline-rich receptor-li...    124   5e-28   
ref|XP_009760044.1|  PREDICTED: putative proline-rich receptor-li...    122   7e-28   
ref|XP_004300986.1|  PREDICTED: putative proline-rich receptor-li...    123   8e-28   
emb|CDY61983.1|  BnaC03g73820D                                          123   8e-28   
ref|XP_009108731.1|  PREDICTED: proline-rich receptor-like protei...    122   9e-28   
ref|XP_010688211.1|  PREDICTED: proline-rich receptor-like protei...    121   1e-27   
emb|CDX76282.1|  BnaA08g11180D                                          122   1e-27   
ref|XP_009112357.1|  PREDICTED: putative proline-rich receptor-li...    122   1e-27   
emb|CDY18547.1|  BnaA01g26480D                                          122   1e-27   
emb|CDY46249.1|  BnaC03g66100D                                          122   1e-27   
ref|XP_006366995.1|  PREDICTED: putative proline-rich receptor-li...    120   1e-27   
ref|XP_009395203.1|  PREDICTED: proline-rich receptor-like protei...    120   2e-27   
ref|XP_006573581.1|  PREDICTED: proline-rich receptor-like protei...    121   2e-27   
ref|XP_004149167.1|  PREDICTED: proline-rich receptor-like protei...    121   2e-27   
ref|XP_002885280.1|  hypothetical protein ARALYDRAFT_898257             121   3e-27   
ref|XP_009396676.1|  PREDICTED: putative proline-rich receptor-li...    120   3e-27   
ref|XP_010943774.1|  PREDICTED: proline-rich receptor-like protei...    119   3e-27   
ref|XP_003603906.1|  Cysteine-rich receptor-like protein kinase         120   3e-27   
gb|KHN41988.1|  Proline-rich receptor-like protein kinase PERK4         119   4e-27   
ref|XP_012069889.1|  PREDICTED: putative proline-rich receptor-li...    119   5e-27   
ref|XP_011004787.1|  PREDICTED: proline-rich receptor-like protei...    120   5e-27   
ref|XP_010688208.1|  PREDICTED: proline-rich receptor-like protei...    120   6e-27   
emb|CDX99312.1|  BnaC05g34270D                                          119   2e-26   
ref|XP_003538850.1|  PREDICTED: proline-rich receptor-like protei...    118   2e-26   
ref|XP_009408793.1|  PREDICTED: proline-rich receptor-like protei...    118   2e-26   
ref|XP_008651782.1|  PREDICTED: uncharacterized protein LOC100193...    117   4e-26   
ref|XP_012077569.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    115   4e-26   
ref|XP_010530845.1|  PREDICTED: proline-rich receptor-like protei...    117   6e-26   
ref|XP_010667850.1|  PREDICTED: proline-rich receptor-like protei...    118   6e-26   
ref|XP_006379237.1|  hypothetical protein POPTR_0009s11810g             117   7e-26   
ref|XP_008220026.1|  PREDICTED: proline-rich receptor-like protei...    117   7e-26   
ref|XP_002988273.1|  hypothetical protein SELMODRAFT_159261             114   9e-26   
gb|KHN33761.1|  Proline-rich receptor-like protein kinase PERK5         115   1e-25   
ref|XP_009792123.1|  PREDICTED: proline-rich receptor-like protei...    115   2e-25   
gb|KDP34216.1|  hypothetical protein JCGZ_07787                         114   4e-25   
ref|XP_006579023.1|  PREDICTED: proline-rich receptor-like protei...    114   4e-25   
gb|KJB79200.1|  hypothetical protein B456_013G037700                    114   5e-25   
ref|XP_006406561.1|  hypothetical protein EUTSA_v10020178mg             114   6e-25   
ref|XP_011097118.1|  PREDICTED: proline-rich receptor-like protei...    114   6e-25   
ref|XP_007199659.1|  hypothetical protein PRUPE_ppa001331mg             115   7e-25   
ref|XP_004234613.1|  PREDICTED: proline-rich receptor-like protei...    114   7e-25   
ref|XP_003629471.1|  Receptor protein kinase PERK1                      114   8e-25   
ref|XP_010507157.1|  PREDICTED: putative proline-rich receptor-li...    114   8e-25   
ref|XP_010552539.1|  PREDICTED: putative proline-rich receptor-li...    114   1e-24   
ref|XP_006352129.1|  PREDICTED: putative proline-rich receptor-li...    113   1e-24   
ref|XP_004501111.1|  PREDICTED: putative proline-rich receptor-li...    113   1e-24   
ref|XP_010068105.1|  PREDICTED: proline-rich receptor-like protei...    112   1e-24   
ref|XP_008236877.1|  PREDICTED: putative proline-rich receptor-li...    114   2e-24   
ref|XP_010489925.1|  PREDICTED: putative proline-rich receptor-li...    113   2e-24   
emb|CDP02036.1|  unnamed protein product                                112   2e-24   
emb|CDX82325.1|  BnaA03g34960D                                          113   2e-24   
ref|XP_007226427.1|  hypothetical protein PRUPE_ppa023861mg             113   2e-24   
ref|XP_010034846.1|  PREDICTED: proline-rich receptor-like protei...    112   2e-24   
ref|XP_009802544.1|  PREDICTED: proline-rich receptor-like protei...    112   3e-24   
ref|XP_010034744.1|  PREDICTED: proline-rich receptor-like protei...    110   3e-24   
ref|XP_010465995.1|  PREDICTED: putative proline-rich receptor-li...    112   3e-24   
ref|XP_009593648.1|  PREDICTED: proline-rich receptor-like protei...    112   3e-24   
ref|NP_001044255.1|  Os01g0750600                                       112   3e-24   
gb|EEC71482.1|  hypothetical protein OsI_03745                          112   3e-24   
ref|XP_002465598.1|  hypothetical protein SORBIDRAFT_01g041850          111   4e-24   
ref|XP_006393280.1|  hypothetical protein EUTSA_v10011277mg             112   4e-24   
gb|KCW53714.1|  hypothetical protein EUGRSUZ_J02971                     111   4e-24   
ref|XP_009135598.1|  PREDICTED: putative proline-rich receptor-li...    112   5e-24   
gb|KCW62848.1|  hypothetical protein EUGRSUZ_G00443                     111   5e-24   
ref|XP_007012046.1|  Proline extensin receptor kinase 1                 112   5e-24   
ref|XP_010463392.1|  PREDICTED: uncharacterized protein LOC104744065    112   7e-24   
gb|KHN18204.1|  Proline-rich receptor-like protein kinase PERK1         109   1e-23   
gb|KCW81530.1|  hypothetical protein EUGRSUZ_C02889                     111   1e-23   
ref|XP_002978931.1|  hypothetical protein SELMODRAFT_109804             108   1e-23   
ref|XP_010051220.1|  PREDICTED: proline-rich receptor-like protei...    110   2e-23   
ref|XP_003611975.1|  Cysteine-rich receptor-like protein kinase         110   2e-23   
ref|XP_010313158.1|  PREDICTED: putative proline-rich receptor-li...    110   2e-23   
ref|XP_002979054.1|  hypothetical protein SELMODRAFT_177353             107   2e-23   
ref|XP_010500822.1|  PREDICTED: proline-rich receptor-like protei...    107   3e-23   
ref|XP_007156034.1|  hypothetical protein PHAVU_003G252900g             108   4e-23   
ref|XP_010034839.1|  PREDICTED: proline-rich receptor-like protei...    105   4e-23   
gb|KCW53705.1|  hypothetical protein EUGRSUZ_J02963                     102   4e-23   
ref|XP_003527824.1|  PREDICTED: proline-rich receptor-like protei...    109   4e-23   
emb|CDO97062.1|  unnamed protein product                                107   4e-23   
ref|XP_006646326.1|  PREDICTED: proline-rich receptor-like protei...    108   6e-23   
ref|XP_010034742.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    107   6e-23   
gb|EEE58632.1|  hypothetical protein OsJ_09997                          108   7e-23   
gb|KFK36030.1|  hypothetical protein AALP_AA4G068600                    108   7e-23   
ref|XP_002991492.1|  hypothetical protein SELMODRAFT_133579             106   7e-23   
ref|XP_010034740.1|  PREDICTED: proline-rich receptor-like protei...    106   7e-23   
ref|XP_009147911.1|  PREDICTED: proline-rich receptor-like protei...    107   7e-23   
ref|XP_009147910.1|  PREDICTED: proline-rich receptor-like protei...    107   8e-23   
gb|EEC74798.1|  hypothetical protein OsI_10599                          109   8e-23   
emb|CDX92276.1|  BnaA05g21310D                                          106   8e-23   
gb|AAN60988.1|  Putative DNA cytosine methyltransferase MET2a           109   8e-23   
ref|XP_009596095.1|  PREDICTED: proline-rich receptor-like protei...    108   9e-23   
ref|XP_002309566.1|  hypothetical protein POPTR_0006s25940g             105   1e-22   
ref|XP_009399289.1|  PREDICTED: proline-rich receptor-like protei...    107   1e-22   
dbj|BAK03828.1|  predicted protein                                      107   1e-22   
ref|XP_009147909.1|  PREDICTED: proline-rich receptor-like protei...    107   1e-22   
gb|KHN00551.1|  Proline-rich receptor-like protein kinase PERK4         106   1e-22   
emb|CDY48859.1|  BnaA06g03230D                                          107   1e-22   
ref|XP_009145855.1|  PREDICTED: putative proline-rich receptor-li...    107   2e-22   
ref|XP_010500470.1|  PREDICTED: proline-rich receptor-like protei...    107   2e-22   
ref|XP_003519900.1|  PREDICTED: proline-rich receptor-like protei...    107   2e-22   
ref|XP_006304442.1|  hypothetical protein CARUB_v10011065mg             107   2e-22   
gb|EMT01631.1|  Somatic embryogenesis receptor kinase 1                 103   2e-22   
ref|NP_188511.1|  putative proline-rich receptor-like protein kin...    107   2e-22   
ref|XP_010098070.1|  Proline-rich receptor-like protein kinase PERK1    104   3e-22   
emb|CDY48706.1|  BnaCnng16830D                                          105   3e-22   
ref|XP_004987095.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    107   3e-22   
gb|AAS65791.1|  putative protein kinase                               99.0    3e-22   
ref|XP_010317211.1|  PREDICTED: proline-rich receptor-like protei...    106   4e-22   
ref|NP_175353.1|  proline-rich receptor-like protein kinase PERK7       106   4e-22   
ref|XP_009368018.1|  PREDICTED: proline-rich receptor-like protei...    106   5e-22   
gb|KCW53426.1|  hypothetical protein EUGRSUZ_J02671                     105   5e-22   
ref|XP_010461765.1|  PREDICTED: proline-rich receptor-like protei...    105   6e-22   
ref|XP_011092780.1|  PREDICTED: proline-rich receptor-like protei...    105   6e-22   
ref|XP_009374196.1|  PREDICTED: putative proline-rich receptor-li...    105   6e-22   
ref|XP_011092781.1|  PREDICTED: proline-rich receptor-like protei...    105   6e-22   
ref|XP_006384504.1|  hypothetical protein POPTR_0004s16100g             105   7e-22   
emb|CDY48084.1|  BnaC06g02480D                                          105   8e-22   
ref|XP_010244329.1|  PREDICTED: proline-rich receptor-like protei...    105   1e-21   
ref|XP_002463805.1|  hypothetical protein SORBIDRAFT_01g006470          104   1e-21   
dbj|BAJ94925.1|  predicted protein                                      104   1e-21   
ref|XP_007136173.1|  hypothetical protein PHAVU_009G024200g             104   1e-21   
ref|XP_006845001.1|  PREDICTED: proline-rich receptor-like protei...    104   2e-21   
gb|EMS49853.1|  Proline-rich receptor-like protein kinase PERK5         103   3e-21   
ref|XP_008221869.1|  PREDICTED: proline-rich receptor-like protei...    103   3e-21   
ref|XP_004969960.1|  PREDICTED: proline-rich receptor-like protei...    103   4e-21   
gb|EPS63150.1|  hypothetical protein M569_11637                         103   5e-21   
ref|XP_009619106.1|  PREDICTED: putative proline-rich receptor-li...    102   6e-21   
ref|XP_009392452.1|  PREDICTED: proline-rich receptor-like protei...    102   6e-21   
ref|XP_007137177.1|  hypothetical protein PHAVU_009G106200g             102   6e-21   
gb|KCW86708.1|  hypothetical protein EUGRSUZ_B03317                     102   6e-21   
ref|XP_006651189.1|  PREDICTED: proline-rich receptor-like protei...    102   6e-21   
ref|XP_010044616.1|  PREDICTED: proline-rich receptor-like protei...    102   7e-21   
gb|KCW82440.1|  hypothetical protein EUGRSUZ_C03837                     100   7e-21   
ref|XP_008375924.1|  PREDICTED: putative proline-rich receptor-li...    102   8e-21   
emb|CDO98692.1|  unnamed protein product                                102   1e-20   
emb|CBI16871.3|  unnamed protein product                                100   1e-20   
ref|XP_009421422.1|  PREDICTED: proline-rich receptor-like protei...  99.8    1e-20   
ref|XP_010100454.1|  Proline-rich receptor-like protein kinase PE...    100   2e-20   
ref|XP_010471037.1|  PREDICTED: proline-rich receptor-like protei...    101   2e-20   
ref|XP_010927303.1|  PREDICTED: proline-rich receptor-like protei...  99.0    2e-20   
ref|XP_011019667.1|  PREDICTED: proline-rich receptor-like protei...    101   2e-20   
ref|XP_007227114.1|  hypothetical protein PRUPE_ppa026606mg             101   2e-20   
ref|XP_010415724.1|  PREDICTED: proline-rich receptor-like protei...    101   2e-20   
ref|XP_006300899.1|  hypothetical protein CARUB_v10021266mg             100   3e-20   
dbj|BAB01809.1|  somatic embryogenesis receptor kinase-like protein     100   3e-20   
ref|XP_010427822.1|  PREDICTED: proline-rich receptor-like protei...    100   4e-20   
ref|XP_002279468.1|  PREDICTED: proline-rich receptor-like protei...    100   4e-20   
ref|XP_004981573.1|  PREDICTED: proline-rich receptor-like protei...    100   4e-20   
ref|XP_009775245.1|  PREDICTED: putative proline-rich receptor-li...  99.8    6e-20   
gb|EYU37788.1|  hypothetical protein MIMGU_mgv1a003036mg              99.0    9e-20   
ref|XP_008340040.1|  PREDICTED: proline-rich receptor-like protei...  99.4    1e-19   
ref|XP_006365092.1|  PREDICTED: putative proline-rich receptor-li...  97.8    1e-19   
ref|XP_006390888.1|  hypothetical protein EUTSA_v10018193mg           99.4    1e-19   
ref|XP_008340042.1|  PREDICTED: proline-rich receptor-like protei...  99.4    1e-19   
ref|XP_008340041.1|  PREDICTED: proline-rich receptor-like protei...  99.4    1e-19   
gb|EPS61599.1|  hypothetical protein M569_13198                       98.2    1e-19   
ref|XP_010690899.1|  PREDICTED: putative proline-rich receptor-li...  98.6    1e-19   
ref|XP_010551582.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...  99.0    1e-19   
ref|XP_010315504.1|  PREDICTED: putative proline-rich receptor-li...  98.6    1e-19   
ref|XP_009799537.1|  PREDICTED: proline-rich receptor-like protei...  98.6    2e-19   
emb|CDY41442.1|  BnaA08g20440D                                        98.2    2e-19   
ref|NP_177203.1|  proline-rich extensin-like receptor kinase 13       97.4    4e-19   
emb|CBI28529.3|  unnamed protein product                              97.4    4e-19   
gb|KDP38281.1|  hypothetical protein JCGZ_05167                       97.1    4e-19   
gb|AFK34489.1|  unknown                                               92.4    5e-19   
ref|XP_010651352.1|  PREDICTED: proline-rich receptor-like protei...  97.4    5e-19   
emb|CDX91719.1|  BnaC08g06380D                                        97.1    5e-19   
ref|XP_002887302.1|  hypothetical protein ARALYDRAFT_476166           97.1    5e-19   
ref|XP_006438377.1|  hypothetical protein CICLE_v10033635mg           97.1    6e-19   
gb|KDO82408.1|  hypothetical protein CISIN_1g046750mg                 97.1    6e-19   
ref|XP_009760994.1|  PREDICTED: putative proline-rich receptor-li...  95.9    6e-19   
ref|XP_006484317.1|  PREDICTED: proline-rich receptor-like protei...  97.1    7e-19   
ref|XP_009608488.1|  PREDICTED: proline-rich receptor-like protei...  96.3    8e-19   
ref|XP_006338285.1|  PREDICTED: proline-rich receptor-like protei...  96.7    8e-19   
ref|XP_009110097.1|  PREDICTED: proline-rich receptor-like protei...  96.3    8e-19   
ref|XP_009589596.1|  PREDICTED: putative proline-rich receptor-li...  96.3    1e-18   
ref|XP_009589595.1|  PREDICTED: putative proline-rich receptor-li...  96.3    1e-18   
ref|XP_008459426.1|  PREDICTED: proline-rich receptor-like protei...  96.3    1e-18   
ref|XP_004232101.1|  PREDICTED: proline-rich receptor-like protei...  95.9    1e-18   
ref|XP_008446206.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...  95.9    1e-18   
ref|XP_008389654.1|  PREDICTED: proline-rich receptor-like protei...  95.9    2e-18   
gb|ADN33834.1|  protein kinase family protein                         95.9    2e-18   
ref|XP_008389653.1|  PREDICTED: proline-rich receptor-like protei...  95.9    2e-18   
ref|XP_006306890.1|  hypothetical protein CARUB_v10008453mg           95.5    2e-18   
ref|XP_008389652.1|  PREDICTED: proline-rich receptor-like protei...  95.9    2e-18   
ref|XP_009769580.1|  PREDICTED: proline-rich receptor-like protei...  95.5    2e-18   
ref|XP_011085555.1|  PREDICTED: proline-rich receptor-like protei...  95.5    2e-18   
ref|XP_009600094.1|  PREDICTED: proline-rich receptor-like protei...  95.1    2e-18   
gb|EYU42622.1|  hypothetical protein MIMGU_mgv1a0191422mg             91.7    2e-18   
ref|XP_004489835.1|  PREDICTED: proline-rich receptor-like protei...  93.2    2e-18   
gb|KEH21835.1|  receptor-like kinase                                  95.1    3e-18   
gb|KCW56393.1|  hypothetical protein EUGRSUZ_I02121                   93.2    3e-18   
gb|KFK41458.1|  hypothetical protein AALP_AA2G133300                  94.7    3e-18   
ref|XP_010498864.1|  PREDICTED: proline-rich receptor-like protei...  94.7    3e-18   
ref|XP_006416074.1|  hypothetical protein EUTSA_v10006956mg           94.7    3e-18   
ref|XP_010477647.1|  PREDICTED: proline-rich receptor-like protei...  94.7    3e-18   
gb|KGN52562.1|  hypothetical protein Csa_5G643900                     94.7    3e-18   
ref|XP_008675052.1|  PREDICTED: proline-rich receptor-like protei...  93.2    4e-18   
ref|XP_004135247.2|  PREDICTED: proline-rich receptor-like protei...  94.7    4e-18   
ref|XP_004298569.1|  PREDICTED: proline-rich receptor-like protei...  94.7    4e-18   
gb|KCW53427.1|  hypothetical protein EUGRSUZ_J02672                   90.9    4e-18   
ref|XP_006299846.1|  hypothetical protein CARUB_v10016049mg           94.7    4e-18   
ref|XP_010097823.1|  Proline-rich receptor-like protein kinase PE...  94.7    4e-18   
ref|XP_011656029.1|  PREDICTED: proline-rich receptor-like protei...  94.7    4e-18   
ref|XP_010030811.1|  PREDICTED: proline-rich receptor-like protei...  93.2    4e-18   



>dbj|BAD06582.1| PERK1-like protein kinase [Nicotiana tabacum]
Length=276

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARP L RALED  F++L+DPRL ND+NHNE+ RM+ACAAA VRHSARRRPR
Sbjct  106  YMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPR  165

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYDA QYNEDMKKFRKMALGSQEY
Sbjct  166  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDASQYNEDMKKFRKMALGSQEY  224

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            GSTGQYSNPTSEYGL PSGSSSEGQ T+EMEMGR +KD
Sbjct  225  GSTGQYSNPTSEYGLYPSGSSSEGQPTREMEMGRTKKD  262



>ref|XP_009601165.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Nicotiana tomentosiformis]
Length=667

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARP L RALED  F++L+DPRL ND+NHNE+ RM+ACAAA VRHSARRRPR
Sbjct  497  YMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPR  556

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYDA QYNEDMKKFRKMALGSQEY
Sbjct  557  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDASQYNEDMKKFRKMALGSQEY  615

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            GSTGQYSNPTSEYGL PSGSSSEGQ T+EMEMGR +KD
Sbjct  616  GSTGQYSNPTSEYGLYPSGSSSEGQPTREMEMGRTKKD  653



>ref|XP_009601166.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Nicotiana tomentosiformis]
Length=666

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARP L RALED  F++L+DPRL ND+NHNE+ RM+ACAAA VRHSARRRPR
Sbjct  496  YMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPR  555

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYDA QYNEDMKKFRKMALGSQEY
Sbjct  556  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDASQYNEDMKKFRKMALGSQEY  614

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            GSTGQYSNPTSEYGL PSGSSSEGQ T+EMEMGR +KD
Sbjct  615  GSTGQYSNPTSEYGLYPSGSSSEGQPTREMEMGRTKKD  652



>dbj|BAF43699.1| PERK1-like protein kinase [Nicotiana tabacum]
Length=665

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARP L RALED  F++L+DPRL ND+NHNE+ RM+ACAAA VRHSARRRPR
Sbjct  495  YMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPR  554

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYDA QYNEDMKKFRKMALGSQEY
Sbjct  555  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDASQYNEDMKKFRKMALGSQEY  613

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            GSTGQYSNPTSEYGL PSGSSSEGQ T+EMEMGR +KD
Sbjct  614  GSTGQYSNPTSEYGLYPSGSSSEGQPTREMEMGRTKKD  651



>ref|XP_011078316.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Sesamum 
indicum]
Length=664

 Score =   228 bits (581),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARP+L RALEDGNF+ LVD RL ND NHNEM RM+ACAAA VRHSARRRPR
Sbjct  488  FMDDSLVDWARPVLTRALEDGNFDALVDQRLRNDHNHNEMARMVACAAACVRHSARRRPR  547

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYD  QYNEDMKKFRKMALGSQEY
Sbjct  548  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDTFQYNEDMKKFRKMALGSQEY  606

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
            GS+GQYSNPTSEYGLNPSGSSSEG Q ++EMEM R  KD
Sbjct  607  GSSGQYSNPTSEYGLNPSGSSSEGQQQSREMEMSRRTKD  645



>ref|XP_009781639.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Nicotiana sylvestris]
Length=667

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 3/160 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARP L RALED  F++L+DPRL ND+NHNE+ RM+ACAAA VRHSARRRPR
Sbjct  495  YMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPR  554

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYDA QYNEDMKKFRKMALGSQEY
Sbjct  555  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDASQYNEDMKKFRKMALGSQEY  613

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQ--EMEMGRMRKD  346
            GSTGQYSNPTSEYGL PSGSSSEGQ T+  EMEMGR +KD
Sbjct  614  GSTGQYSNPTSEYGLYPSGSSSEGQQTREMEMEMGRTKKD  653



>ref|XP_009781640.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Nicotiana sylvestris]
Length=666

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 143/160 (89%), Gaps = 3/160 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARP L RALED  F++L+DPRL ND+NHNE+ RM+ACAAA VRHSARRRPR
Sbjct  494  YMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPR  553

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYDA QYNEDMKKFRKMALGSQEY
Sbjct  554  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDASQYNEDMKKFRKMALGSQEY  612

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQ--EMEMGRMRKD  346
            GSTGQYSNPTSEYGL PSGSSSEGQ T+  EMEMGR +KD
Sbjct  613  GSTGQYSNPTSEYGLYPSGSSSEGQQTREMEMEMGRTKKD  652



>ref|XP_002514297.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48251.1| ATP binding protein, putative [Ricinus communis]
Length=670

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + DDSLVDWARPLL RALEDGNF+TL DP+L+ND++HNEM RM+A AAA VRHSARRRPR
Sbjct  507  YADDSLVDWARPLLTRALEDGNFDTLADPKLQNDYDHNEMARMVASAAACVRHSARRRPR  566

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD++LSDLNEGIRPGHS+ Y  SY SSDYD  QYNEDMKKFRKMALGSQEY
Sbjct  567  MSQVVRALEGDVALSDLNEGIRPGHSSLY--SYGSSDYDTSQYNEDMKKFRKMALGSQEY  624

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS PTSEYGL PSGSSSEG  T+EMEMG+M+++
Sbjct  625  GASSEYSGPTSEYGLYPSGSSSEGHNTREMEMGKMKRN  662



>ref|XP_011043470.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Populus euphratica]
Length=654

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALEDGNF+TLVD +L+N+++ NEM RM+ACAAA VRHSARRRPR
Sbjct  490  FMEDSLVDWARPLLTRALEDGNFDTLVDQKLQNNYDQNEMARMVACAAACVRHSARRRPR  549

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
             SQVVRALEGD+SLSDLNEGIRPG+S  YGS Y SSDYD  QYNEDMKKFRKMALGSQEY
Sbjct  550  TSQVVRALEGDVSLSDLNEGIRPGNSRVYGS-YGSSDYDTSQYNEDMKKFRKMALGSQEY  608

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G++ +YS PTSEYGL PSGSSSEGQ T+EMEMG+M+K
Sbjct  609  GASSEYSGPTSEYGLYPSGSSSEGQNTREMEMGKMKK  645



>ref|XP_011043469.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Populus euphratica]
Length=665

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALEDGNF+TLVD +L+N+++ NEM RM+ACAAA VRHSARRRPR
Sbjct  501  FMEDSLVDWARPLLTRALEDGNFDTLVDQKLQNNYDQNEMARMVACAAACVRHSARRRPR  560

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
             SQVVRALEGD+SLSDLNEGIRPG+S  YGS Y SSDYD  QYNEDMKKFRKMALGSQEY
Sbjct  561  TSQVVRALEGDVSLSDLNEGIRPGNSRVYGS-YGSSDYDTSQYNEDMKKFRKMALGSQEY  619

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G++ +YS PTSEYGL PSGSSSEGQ T+EMEMG+M+K
Sbjct  620  GASSEYSGPTSEYGLYPSGSSSEGQNTREMEMGKMKK  656



>ref|XP_006372053.1| hypothetical protein POPTR_0018s08800g [Populus trichocarpa]
 gb|ERP49850.1| hypothetical protein POPTR_0018s08800g [Populus trichocarpa]
Length=672

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 141/157 (90%), Gaps = 1/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALEDGNF+TLVD +L+N+++ NEM RM+ACAAA VRHSARRRPR
Sbjct  508  FMEDSLVDWARPLLTRALEDGNFDTLVDQKLQNNYDQNEMARMVACAAACVRHSARRRPR  567

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
             SQVVRALEGD+SLSDLNEGIRPG+S  YGS Y SSDYD  QYNEDMKKFRKMALGSQEY
Sbjct  568  TSQVVRALEGDVSLSDLNEGIRPGNSRVYGS-YGSSDYDTSQYNEDMKKFRKMALGSQEY  626

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G++ +YS PTSEYGL PSGSSSEGQ T+EMEMG+M+K
Sbjct  627  GASSEYSGPTSEYGLYPSGSSSEGQNTREMEMGKMKK  663



>ref|XP_007013165.1| Proline extensin-like receptor kinase 1 [Theobroma cacao]
 gb|EOY30784.1| Proline extensin-like receptor kinase 1 [Theobroma cacao]
Length=670

 Score =   218 bits (555),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DSLVDWARPLL RAL+DGNF++LVDP+L+ ++NHNEM+RM+ACAAA VRHSARRRPR
Sbjct  509  FIEDSLVDWARPLLTRALDDGNFDSLVDPKLQKEYNHNEMVRMVACAAACVRHSARRRPR  568

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SLSDLNEG+RPG S  Y SSY SSDYD  QYNEDMKKFR+MALG+QEY
Sbjct  569  MSQIVRALEGDASLSDLNEGMRPGQSNVY-SSYGSSDYDTSQYNEDMKKFRRMALGTQEY  627

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS PTSEYGL PSGSS+EGQTT+EMEMGR +K+
Sbjct  628  GASSEYSEPTSEYGLYPSGSSNEGQTTREMEMGRRKKN  665



>ref|XP_010103058.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
 gb|EXB94681.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
Length=479

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARPLL+RALED  +++LVDPRL+++F+ NEM RM+ACAAA VRHSARRRPR
Sbjct  284  YMEDSLVDWARPLLNRALEDRKYDSLVDPRLQDNFDENEMARMVACAAACVRHSARRRPR  343

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL+DLNEGIRPG S  Y SSY SSDYD  QYNED+KKFRK+ALGSQEY
Sbjct  344  MSQIVRALEGDVSLADLNEGIRPGQSNVY-SSYGSSDYDTSQYNEDLKKFRKVALGSQEY  402

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS PTS+YGL PSGSSSEGQTT+EMEMGRM+K+
Sbjct  403  GASSEYSGPTSDYGLYPSGSSSEGQTTREMEMGRMKKN  440



>ref|XP_010249724.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Nelumbo 
nucifera]
Length=632

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 3/157 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++TL DPRL+ D++ + M RM+ACAA+ VRHSARRRPR
Sbjct  471  FMDDSLVDWARPLLTRALEDGNYDTLADPRLDGDYDQSGMARMVACAASCVRHSARRRPR  530

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL+DLNEGIRPGHS  YG SY SSDYD MQYNEDMKKFRKMALGSQEY
Sbjct  531  MSQIVRALEGDVSLADLNEGIRPGHSTVYG-SYGSSDYDTMQYNEDMKKFRKMALGSQEY  589

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+G YS PTSEYGL PSGSS E QTT+EMEMGRM+K
Sbjct  590  ASSG-YSEPTSEYGLYPSGSSGE-QTTREMEMGRMKK  624



>emb|CDP03328.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 137/158 (87%), Gaps = 2/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RAL+D NF+ L D RL+N +N NEM R+ ACAAA VRHSARRRPR
Sbjct  81   FMDDSLVDWARPLLTRALDDENFDQLTDARLQNGYNKNEMARVAACAAACVRHSARRRPR  140

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SSY SSDYD  QYNEDMKKFRKMAL S+EY
Sbjct  141  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSYGSSDYDTAQYNEDMKKFRKMALQSKEY  199

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            GS+ +YS PTSEYGL PSGSSSEGQTT+EME G+++KD
Sbjct  200  GSS-EYSGPTSEYGLYPSGSSSEGQTTREMETGKLKKD  236



>gb|EYU32927.1| hypothetical protein MIMGU_mgv1a002397mg [Erythranthe guttata]
Length=679

 Score =   213 bits (542),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDGNF++L+D RL N+ N NEM RM+ACAAA VRHSARRRPR
Sbjct  514  YMDDSLVDWARPLLTRALEDGNFDSLIDQRLRNEHNANEMARMVACAAACVRHSARRRPR  573

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SS+ SSDYD  QYNEDMKKFRK+AL S+EY
Sbjct  574  MSQVVRALEGDVSLSDLNEGIRPGHSTVY-SSHGSSDYDTNQYNEDMKKFRKIALESKEY  632

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            GS+ QYSNPTSEYGLNPSGSSSEG  T+EME+G+  K
Sbjct  633  GSSDQYSNPTSEYGLNPSGSSSEGGQTREMELGKTTK  669



>gb|KDO48900.1| hypothetical protein CISIN_1g014904mg [Citrus sinensis]
Length=416

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DSLVDWARPLL+RA+EDGNF+TLVDP+L N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  252  FVEDSLVDWARPLLNRAIEDGNFDTLVDPKLHNEYNHNEMARMVACAAACVRHSARRRPR  311

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL+DLNEGIRPG S+ Y  SY SSDYD MQYNED+KKFRKMAL SQEY
Sbjct  312  MSQIVRALEGDASLADLNEGIRPGQSSVY-GSYGSSDYDTMQYNEDLKKFRKMALNSQEY  370

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ +YS PTSEYGL PSGSSSEGQ T+EMEMG+ +K+
Sbjct  371  SASSEYSRPTSEYGLYPSGSSSEGQNTREMEMGKTKKN  408



>ref|XP_010527207.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK1 [Tarenaya hassleriana]
Length=629

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDSLVDWARPLL RA E+G F+ L DP+L N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  463  FTDDSLVDWARPLLSRAGEEGKFDGLADPKLNNEYDDEEMARMVACAAACVRHSARRRPR  522

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEGIRPGHS  Y S  ES+DYD  QYNEDMKKFRKMALG+QEY
Sbjct  523  MSQIVRALEGNVSLSDLNEGIRPGHSTVYSSYGESTDYDTNQYNEDMKKFRKMALGTQEY  582

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G++ +YSNPTSEYG+ PSGSSSE QTT+EMEMG++RK
Sbjct  583  GASSEYSNPTSEYGIYPSGSSSEAQTTREMEMGKIRK  619



>gb|AAS65794.1| putative protein kinase [Arabidopsis thaliana]
Length=223

 Score =   198 bits (504),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L D ++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  63   YVDDSLVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAACVRHSARRRPR  122

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DM KFRKMALG+QEY
Sbjct  123  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMIKFRKMALGTQEY  182

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG+++K
Sbjct  183  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKK  219



>gb|KHN20676.1| Proline-rich receptor-like protein kinase PERK1 [Glycine soja]
Length=475

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALE+ +F++++DPRL+ND++ NEM RM+A AAA +RHSA+RRPR
Sbjct  309  FMEDSLVDWARPLLTRALEEDDFDSIIDPRLQNDYDPNEMARMVASAAACIRHSAKRRPR  368

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEGIRPGHS  Y SS+ESSDYD  QY EDMKKFRKMALG+QEY
Sbjct  369  MSQVVRALEGDVSLADLNEGIRPGHSTMY-SSHESSDYDTAQYKEDMKKFRKMALGTQEY  427

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMR  352
            G++ +YS  TSEYGLNPSGSSSE    QTT+EMEM +M+
Sbjct  428  GASSEYSAATSEYGLNPSGSSSEAQSRQTTREMEMRKMK  466



>ref|XP_012076697.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Jatropha 
curcas]
 gb|KDP33677.1| hypothetical protein JCGZ_07248 [Jatropha curcas]
Length=662

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 3/158 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALEDGNF+TL DP+L+N +++NEM RM+ACAAA VRHSARRRPR
Sbjct  499  FMEDSLVDWARPLLTRALEDGNFDTLADPKLQNSYDNNEMARMVACAAACVRHSARRRPR  558

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD++LSDLNEG+RPGHS+ Y  S   SDYD  QYNEDM +FRKMALGSQEY
Sbjct  559  MSQVVRALEGDVALSDLNEGMRPGHSSLYSGS---SDYDTSQYNEDMIRFRKMALGSQEY  615

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS  TSEYGL PSGSSSEG+ TQEMEMG+M+++
Sbjct  616  GASSEYSGRTSEYGLYPSGSSSEGKNTQEMEMGKMKRN  653



>gb|KHN45639.1| Proline-rich receptor-like protein kinase PERK1 [Glycine soja]
Length=443

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARPLL RALE+ +F++++DPRL+ND++ +EM RM+A AAA +RHSA+RRPR
Sbjct  277  YMEDSLVDWARPLLTRALEEDDFDSIIDPRLQNDYDPHEMARMVASAAACIRHSAKRRPR  336

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEGIRPGHS  Y SS+ESSDYD  QY EDMKKFRKMALG+QEY
Sbjct  337  MSQVVRALEGDVSLADLNEGIRPGHSTMY-SSHESSDYDTAQYKEDMKKFRKMALGTQEY  395

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMR  352
            G++ +YS  TSEYGLNPSGSSSE    QTT+EMEM +M+
Sbjct  396  GASSEYSAATSEYGLNPSGSSSEAQSRQTTREMEMRKMK  434



>gb|KCW82423.1| hypothetical protein EUGRSUZ_C03822 [Eucalyptus grandis]
Length=452

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 5/161 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARP L RALEDGNF++LVDP L+N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  286  FMDDSLVDWARPQLTRALEDGNFDSLVDPSLQNNYNHNEMARMVACAAACVRHSARRRPR  345

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SLSDLNEGIRPGHS  Y SSY SSDYD  QYNED+KKFRKMAL SQEY
Sbjct  346  MSQIVRALEGDVSLSDLNEGIRPGHSGLY-SSYGSSDYDTSQYNEDLKKFRKMALASQEY  404

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMRKD  346
            GS+ +YS PTSEYG+ PSGSSSE    QTT+EMEMGRM+KD
Sbjct  405  GSS-EYSEPTSEYGVYPSGSSSENPSRQTTREMEMGRMKKD  444



>ref|NP_001237102.1| putative receptor protein kinase PERK1 [Glycine max]
 dbj|BAE46451.1| putative receptor protein kinase PERK1 [Glycine max]
 gb|ACM89502.1| PERK1-like protein kinase [Glycine max]
Length=443

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARPLL RALE+ +F++++DPRL+ND++ +EM RM+A AAA +RHSA+RRPR
Sbjct  277  YMEDSLVDWARPLLTRALEEDDFDSIIDPRLQNDYDPHEMARMVASAAACIRHSAKRRPR  336

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEGIRPGHS  Y SS+ESSDYD  QY EDMKKFRKMALG+QEY
Sbjct  337  MSQVVRALEGDVSLADLNEGIRPGHSTMY-SSHESSDYDTAQYKEDMKKFRKMALGTQEY  395

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMR  352
            G++ +YS  TSEYGLNPSGSSSE    QTT+EMEM +M+
Sbjct  396  GASSEYSAATSEYGLNPSGSSSEAQSRQTTREMEMRKMK  434



>ref|XP_010051585.1| PREDICTED: proline-rich receptor-like protein kinase PERK1, partial 
[Eucalyptus grandis]
Length=485

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 5/161 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARP L RALEDGNF++LVDP L+N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  319  FMDDSLVDWARPQLTRALEDGNFDSLVDPSLQNNYNHNEMARMVACAAACVRHSARRRPR  378

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SLSDLNEGIRPGHS  Y SSY SSDYD  QYNED+KKFRKMAL SQEY
Sbjct  379  MSQIVRALEGDVSLSDLNEGIRPGHSGLY-SSYGSSDYDTSQYNEDLKKFRKMALASQEY  437

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMRKD  346
            GS+ +YS PTSEYG+ PSGSSSE    QTT+EMEMGRM+KD
Sbjct  438  GSS-EYSEPTSEYGVYPSGSSSENPSRQTTREMEMGRMKKD  477



>ref|XP_006353460.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Solanum tuberosum]
Length=697

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +++DSLVDWARPLL RALED  F+TLVD RLEND+NHNEM RM+AC AA VRHSA+RRPR
Sbjct  526  YIEDSLVDWARPLLTRALEDEKFDTLVDRRLENDYNHNEMARMVACCAACVRHSAKRRPR  585

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALG-SQE  463
            M+QV+RALEGD+SLSDLNEGI+PGHS  Y SSY SSDYD +QYNEDMKKFRKMAL  SQE
Sbjct  586  MTQVLRALEGDVSLSDLNEGIKPGHSTVY-SSYTSSDYDTLQYNEDMKKFRKMALATSQE  644

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            Y S+ QYSNPTSEYGLNPSGSSSEG  T EME GRM+KD
Sbjct  645  YASSDQYSNPTSEYGLNPSGSSSEGHQTAEMETGRMKKD  683



>ref|XP_003528909.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
isoform 2 [Glycine max]
Length=671

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALE+ +F++++DPRL+ND++ NEM RM+A AAA +RHSA+RRPR
Sbjct  505  FMEDSLVDWARPLLTRALEEDDFDSIIDPRLQNDYDPNEMARMVASAAACIRHSAKRRPR  564

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEGIRPGHS  Y SS+ESSDYD  QY EDMKKFRKMALG+QEY
Sbjct  565  MSQVVRALEGDVSLADLNEGIRPGHSTMY-SSHESSDYDTAQYKEDMKKFRKMALGTQEY  623

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMR  352
            G++ +YS  TSEYGLNPSGSSSE    QTT+EMEM +M+
Sbjct  624  GASSEYSAATSEYGLNPSGSSSEAQSRQTTREMEMRKMK  662



>ref|XP_009757853.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Nicotiana 
sylvestris]
Length=689

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL RALED  F+ LVDPRLEND+NHNEM RM+ACAAA VRHSA+RRPR
Sbjct  518  FTEDSLVDWARPLLTRALEDEKFDALVDPRLENDYNHNEMARMVACAAACVRHSAKRRPR  577

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALG-SQE  463
            M+QV+RALEG +SLSDLNEGI+PGHS  Y SSY SSDYDA+QYNEDMKKFRKMAL  SQE
Sbjct  578  MTQVLRALEGAVSLSDLNEGIKPGHSTVY-SSYTSSDYDALQYNEDMKKFRKMALATSQE  636

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            Y S+GQYSNPTSEYGL PSGSSSEGQ T+EMEM +++KD
Sbjct  637  YESSGQYSNPTSEYGLYPSGSSSEGQRTREMEMDKLKKD  675



>ref|XP_006451164.1| hypothetical protein CICLE_v10007670mg [Citrus clementina]
 gb|ESR64404.1| hypothetical protein CICLE_v10007670mg [Citrus clementina]
Length=664

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DSLVDWARPLL+RA+EDGNF+TLVDP+L N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  500  FVEDSLVDWARPLLNRAIEDGNFDTLVDPKLHNEYNHNEMARMVACAAACVRHSARRRPR  559

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL+DLNEGIRPG S+ Y  SY SSDYD MQYNED+KKFRKMAL SQEY
Sbjct  560  MSQIVRALEGDASLADLNEGIRPGQSSVY-GSYGSSDYDTMQYNEDLKKFRKMALNSQEY  618

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ +YS PTSEYGL PSGSSSEGQ T+EMEMG+ +K+
Sbjct  619  SASSEYSRPTSEYGLYPSGSSSEGQNTREMEMGKTKKN  656



>ref|XP_007152836.1| hypothetical protein PHAVU_004G164000g [Phaseolus vulgaris]
 gb|ESW24830.1| hypothetical protein PHAVU_004G164000g [Phaseolus vulgaris]
Length=663

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLV+WARPLL RALE+ +F++++DPRL+ND++ NEM RM+ACAAAS RHSA+RRPR
Sbjct  496  FMEDSLVEWARPLLTRALEEDDFDSIIDPRLQNDYDPNEMARMVACAAASTRHSAKRRPR  555

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEG++PGHS  Y SS+ESSDYD +QY EDMKKFRKMALG+QEY
Sbjct  556  MSQVVRALEGDVSLSDLNEGVKPGHSTMY-SSHESSDYDTVQYREDMKKFRKMALGTQEY  614

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMRKD  346
            G++ +YS  TSEYGLNPSGSSSE    QTT+EMEM +M K+
Sbjct  615  GASSEYSAATSEYGLNPSGSSSEAQSRQTTREMEMRKMMKN  655



>ref|XP_004251608.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Solanum 
lycopersicum]
Length=685

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +++DSLVDWARPLL RALED  F+ LVD RLEND+NHNEM RM+AC AA VRHSA+RRPR
Sbjct  514  YIEDSLVDWARPLLTRALEDEKFDGLVDRRLENDYNHNEMARMVACCAACVRHSAKRRPR  573

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALG-SQE  463
            M+QV+RALEGD+SLSDLNEGI+PGHS  Y SSY SSDYD +QYNEDMKKFRKMAL  SQE
Sbjct  574  MTQVLRALEGDVSLSDLNEGIKPGHSTVY-SSYTSSDYDTLQYNEDMKKFRKMALATSQE  632

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            Y S+ QYSNPTSEYGLNPSGSSSEG  T EME GRMRKD
Sbjct  633  YASSDQYSNPTSEYGLNPSGSSSEGHQTAEMETGRMRKD  671



>ref|XP_002883531.1| hypothetical protein ARALYDRAFT_479967 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59790.1| hypothetical protein ARALYDRAFT_479967 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L DP++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  484  YVDDSLVDWARPLLNRASEEGDFEGLADPKMGNEYDREEMARMVACAAACVRHSARRRPR  543

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+QEY
Sbjct  544  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMKKFRKMALGTQEY  603

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG+++K
Sbjct  604  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKK  640



>ref|XP_006586722.1| PREDICTED: putative receptor protein kinase PERK1 isoform X1 
[Glycine max]
Length=664

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARPLL RALE+ +F++++DPRL+ND++ +EM RM+A AAA +RHSA+RRPR
Sbjct  498  YMEDSLVDWARPLLTRALEEDDFDSIIDPRLQNDYDPHEMARMVASAAACIRHSAKRRPR  557

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEGIRPGHS  Y SS+ESSDYD  QY EDMKKFRKMALG+QEY
Sbjct  558  MSQVVRALEGDVSLADLNEGIRPGHSTMY-SSHESSDYDTAQYKEDMKKFRKMALGTQEY  616

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMRKD  346
            G++ +YS  TSEYGLNPSGSSSE    QTT+EMEM +M+ +
Sbjct  617  GASSEYSAATSEYGLNPSGSSSEAQSRQTTREMEMRKMKNN  657



>ref|XP_009594845.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Nicotiana 
tomentosiformis]
Length=686

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 2/159 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL RALED  F+ LVD R+END+NHNEM RM+ACAAA VRHSA+RRPR
Sbjct  521  FTEDSLVDWARPLLTRALEDEKFDALVDRRIENDYNHNEMARMVACAAACVRHSAKRRPR  580

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALG-SQE  463
            M+QV+RALEG +SLSDLNEGI+PGHS  Y SSY SSDYDA+QYNEDMKKFRKMAL  SQE
Sbjct  581  MTQVLRALEGAVSLSDLNEGIKPGHSTVY-SSYTSSDYDALQYNEDMKKFRKMALATSQE  639

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            Y S+GQYSNPTSEYGL PSGSSSEGQ T+EMEM +M+KD
Sbjct  640  YESSGQYSNPTSEYGLYPSGSSSEGQRTREMEMDKMKKD  678



>ref|XP_010466870.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Camelina 
sativa]
Length=643

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L DP+++ +++  EM RM+ACAAA VRHS RRRPR
Sbjct  477  YVDDSLVDWARPLLNRASEEGDFEGLADPKMDKEYDREEMARMVACAAACVRHSGRRRPR  536

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+Q+Y
Sbjct  537  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTNQYNDDMKKFRKMALGTQDY  596

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQTT+EMEMG++++
Sbjct  597  GTTGEYSNPTSDYGLYPSGSSSEGQTTREMEMGKIKR  633



>ref|XP_010488565.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Camelina 
sativa]
Length=650

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L DP++ N+++  EM RM+ACAAA VRHS RRRPR
Sbjct  484  YVDDSLVDWARPLLNRASEEGDFEGLADPKMGNEYDKEEMARMVACAAACVRHSGRRRPR  543

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+Q+Y
Sbjct  544  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMKKFRKMALGTQDY  603

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG++++
Sbjct  604  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKR  640



>gb|KHG20318.1| Proline-rich receptor-like protein kinase PERK1 [Gossypium arboreum]
Length=649

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RAL DGNF+ LVDP+L+ ++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  484  FMDDSLVDWARPLLTRAL-DGNFDGLVDPKLQKEYNHNEMTRMVACAAACVRHSARRRPR  542

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SLSDLNEG+RPG S  Y SSY SSDYD  QYNEDMKKFRKMALG+QE+
Sbjct  543  MSQIVRALEGDASLSDLNEGMRPGQSGVY-SSYGSSDYDTSQYNEDMKKFRKMALGTQEF  601

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS PTSEYGL PSGSS+EGQTT+EMEMG+M+++
Sbjct  602  GASSEYSEPTSEYGLYPSGSSNEGQTTREMEMGKMKRN  639



>ref|XP_006297170.1| hypothetical protein CARUB_v10013175mg [Capsella rubella]
 gb|EOA30068.1| hypothetical protein CARUB_v10013175mg [Capsella rubella]
Length=651

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L D ++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  484  YVDDSLVDWARPLLNRASEEGDFEGLADAKMGNEYDREEMARMVACAAACVRHSARRRPR  543

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+QEY
Sbjct  544  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMKKFRKMALGTQEY  603

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG++++
Sbjct  604  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKR  640



>gb|KFK39776.1| hypothetical protein AALP_AA3G286200 [Arabis alpina]
Length=635

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F+ L D ++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  469  YVDDSLVDWARPLLNRASEEGDFDGLADTKMNNEYDREEMARMVACAAACVRHSARRRPR  528

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+QEY
Sbjct  529  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMKKFRKMALGTQEY  588

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG++++
Sbjct  589  GTTGEYSNPTSDYGLYPSGSSSEGQGTREMEMGKIKR  625



>ref|XP_010513600.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Camelina 
sativa]
Length=645

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+++ L DP++ N+++  EM RM+ACAAA VRHS RRRPR
Sbjct  479  YVDDSLVDWARPLLNRASEEGDYDGLADPKMGNEYDKEEMARMVACAAACVRHSGRRRPR  538

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+Q+Y
Sbjct  539  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMKKFRKMALGTQDY  598

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG++++
Sbjct  599  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKR  635



>ref|XP_003620684.1| Somatic embryogenesis receptor kinase [Medicago truncatula]
 gb|AES76902.1| receptor-like kinase [Medicago truncatula]
Length=674

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 11/166 (7%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLV+WARPLL RALE+ N ++L+DPRL+NDF+ NEM RM+ACAAA  RHSA+RRP+
Sbjct  501  YMDDSLVEWARPLLMRALEEDNLDSLIDPRLQNDFDPNEMTRMVACAAACTRHSAKRRPK  560

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEG+RPGHS+ Y +S+ESSDYD  QY EDM KFRKMALG+QEY
Sbjct  561  MSQVVRALEGDVSLADLNEGVRPGHSSVY-NSHESSDYDTQQYKEDMIKFRKMALGTQEY  619

Query  459  GSTGQYSNPTSEYGLNPSGSSSE----------GQTTQEMEMGRMR  352
              + +YS  TSEYGLNPSGSSSE          GQTT+EMEM +M+
Sbjct  620  AGSSEYSGATSEYGLNPSGSSSENQSRQTTREMGQTTREMEMRKMK  665



>ref|XP_002284430.2| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Vitis 
vinifera]
 emb|CBI28068.3| unnamed protein product [Vitis vinifera]
Length=650

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RALEDGNF+TLVDPRL+ D+NH+EM RM+ACAAA VRHSARRRPR
Sbjct  484  FMEDSLVDWARPLLTRALEDGNFDTLVDPRLQKDYNHHEMARMVACAAACVRHSARRRPR  543

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SLSDLNEG+RPG S+ Y SS+ SSDYD  QYNEDM KFRKMAL S++Y
Sbjct  544  MSQIVRALEGDASLSDLNEGMRPGQSSIY-SSHGSSDYDTNQYNEDMIKFRKMALASRDY  602

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ-TTQEMEMGRMRKD  346
            GS+ +YS PTSEYGL PSGSSSEGQ TT+EMEMG+M+KD
Sbjct  603  GSS-EYSGPTSEYGLYPSGSSSEGQRTTREMEMGKMKKD  640



>ref|XP_010254113.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Nelumbo 
nucifera]
 ref|XP_010254114.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Nelumbo 
nucifera]
Length=745

 Score =   200 bits (508),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 3/158 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             M+DSLVDWARPLL +ALEDGN++ LVDPRL+  ++++EM RMIACAAA VRHSA+RRPR
Sbjct  590  IMEDSLVDWARPLLTQALEDGNYDPLVDPRLQKSYDYDEMARMIACAAACVRHSAKRRPR  649

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL+DLNEGIRPGHS  Y SS+ S+DYD MQY EDMKKFRK+ L SQEY
Sbjct  650  MSQMVRALEGDGSLADLNEGIRPGHSTVY-SSHGSTDYDTMQYKEDMKKFRKIVLSSQEY  708

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            GS+ +YS PTSEYGL PSGSS E QTT+EMEMGRM+KD
Sbjct  709  GSS-EYSEPTSEYGLYPSGSSGE-QTTREMEMGRMKKD  744



>ref|XP_010925846.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Elaeis 
guineensis]
Length=499

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++ L+DPRL  ++  NEM RMIACAAA VRHSARRRPR
Sbjct  342  FMDDSLVDWARPLLSRALEDGNYDALIDPRLGKNYIPNEMARMIACAAACVRHSARRRPR  401

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMAL-GSQE  463
            MSQVVRALEGD+SL DLNEG++PGHS  +GS Y SSDYD+ QYNEDMKKFRKMAL  +++
Sbjct  402  MSQVVRALEGDVSLEDLNEGVKPGHSRFFGS-YGSSDYDSGQYNEDMKKFRKMALAATKD  460

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            Y ST +YS PTS+ G NPS SSSEGQ TQEMEMG+M+KD
Sbjct  461  YPST-EYSAPTSDCGQNPSASSSEGQHTQEMEMGKMKKD  498



>dbj|BAH57220.1| AT3G24550 [Arabidopsis thaliana]
Length=615

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L D ++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  449  YVDDSLVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAACVRHSARRRPR  508

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DM KFRKMALG+QEY
Sbjct  509  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMIKFRKMALGTQEY  568

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG+++K
Sbjct  569  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKK  605



>gb|AAK43886.1|AF370509_1 protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP37768.1| At3g24600 [Arabidopsis thaliana]
Length=652

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L D ++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  486  YVDDSLVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAACVRHSARRRPR  545

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DM KFRKMALG+QEY
Sbjct  546  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMIKFRKMALGTQEY  605

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG+++K
Sbjct  606  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKK  642



>ref|NP_189098.1| proline-rich extensin-like receptor kinase 1 [Arabidopsis thaliana]
 sp|Q9LV48.1|PERK1_ARATH RecName: Full=Proline-rich receptor-like protein kinase PERK1; 
AltName: Full=Proline-rich extensin-like receptor kinase 1; 
Short=AtPERK1 [Arabidopsis thaliana]
 dbj|BAB02007.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL10479.1| AT3g24550/MOB24_8 [Arabidopsis thaliana]
 gb|AAL24383.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM13064.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91192.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP37759.1| At3g24550 [Arabidopsis thaliana]
 gb|AEE76920.1| proline-rich extensin-like receptor kinase 1 [Arabidopsis thaliana]
Length=652

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L D ++ N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  486  YVDDSLVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAACVRHSARRRPR  545

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DM KFRKMALG+QEY
Sbjct  546  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMIKFRKMALGTQEY  605

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            G+TG+YSNPTS+YGL PSGSSSEGQ T+EMEMG+++K
Sbjct  606  GTTGEYSNPTSDYGLYPSGSSSEGQATREMEMGKIKK  642



>ref|XP_008795084.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Phoenix 
dactylifera]
Length=530

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL +ALEDGN+++L+DPRL N++N NEM RMIACAAA VRHSARRRPR
Sbjct  366  FMDDSLVDWARPLLSQALEDGNYDSLIDPRLGNNYNPNEMARMIACAAACVRHSARRRPR  425

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +GS Y SSDYD+ QYN DMKKFRKMAL + + 
Sbjct  426  MSQVVRALEGDVSLEDLNEGVRPGHSRFFGS-YGSSDYDSGQYNNDMKKFRKMALAATQD  484

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ ++S PTSEYG NPS SSSEGQ T+EMEMG+  K+
Sbjct  485  YASSEFSAPTSEYGQNPSASSSEGQRTREMEMGKRNKE  522



>ref|XP_009102500.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Brassica 
rapa]
Length=644

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E G+F  L D ++ N ++  EM RM+ACAAA VRHSARRRPR
Sbjct  478  YVDDSLVDWARPLLNRASEQGDFEGLADAKMNNGYDREEMARMVACAAACVRHSARRRPR  537

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPG S  Y S   S+DYD+ QYNEDMKKFRKMALG+QEY
Sbjct  538  MSQIVRALEGNVSLSDLNEGMRPGQSNVYSSYGGSTDYDSSQYNEDMKKFRKMALGTQEY  597

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             +TG+YSNPTS+YGL PSGSSSEGQTT+EMEMG++++
Sbjct  598  NATGEYSNPTSDYGLYPSGSSSEGQTTREMEMGKIKR  634



>gb|AAK21965.1| receptor protein kinase PERK1 [Brassica napus]
Length=647

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E G+F  L D ++ N ++  EM RM+ACAAA VRHSARRRPR
Sbjct  481  YVDDSLVDWARPLLNRASEQGDFEGLADAKMNNGYDREEMARMVACAAACVRHSARRRPR  540

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPG S  Y S   S+DYD+ QYNEDMKKFRKMALG+QEY
Sbjct  541  MSQIVRALEGNVSLSDLNEGMRPGQSNVYSSYGGSTDYDSSQYNEDMKKFRKMALGTQEY  600

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             +TG+YSNPTS+YGL PSGSSSEGQTT+EMEMG++++
Sbjct  601  NATGEYSNPTSDYGLYPSGSSSEGQTTREMEMGKIKR  637



>gb|KJB54196.1| hypothetical protein B456_009G025100 [Gossypium raimondii]
 gb|KJB54197.1| hypothetical protein B456_009G025100 [Gossypium raimondii]
Length=640

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL +AL DGNF+ LVDP+L+ ++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  475  FMDDSLVDWARPLLTKAL-DGNFDGLVDPKLQKEYNHNEMTRMVACAAACVRHSARRRPR  533

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SLSDLNEG++PG S  Y SSY SSDYD  QYNEDMKKFRKMALG+QE+
Sbjct  534  MSQIVRALEGDASLSDLNEGMKPGQSGVY-SSYGSSDYDTSQYNEDMKKFRKMALGTQEF  592

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS PTSE+GL PSGSS+EGQTT+EMEMG+M+++
Sbjct  593  GASSEYSEPTSEFGLYPSGSSNEGQTTREMEMGKMKRN  630



>ref|XP_008458364.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Cucumis 
melo]
Length=672

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL++RALEDGNF+ LVDPRL+N++NHNEM RM+ACAAA VRHSA+RRPRM
Sbjct  509  MEDSLVDWARPLMNRALEDGNFDVLVDPRLQNNYNHNEMARMVACAAACVRHSAKRRPRM  568

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD SLSDLNEG++PG S+ Y SS+ SSDYD  QYNED++KFRKMALGS EYG
Sbjct  569  SQVVRALEGDSSLSDLNEGVKPGQSSMY-SSHGSSDYDTHQYNEDLRKFRKMALGSTEYG  627

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            ++ +YS PTSEYGL PSGSSSEGQTT+EME    +K+
Sbjct  628  ASSEYSGPTSEYGLYPSGSSSEGQTTREMETRTAKKE  664



>ref|XP_006418729.1| hypothetical protein EUTSA_v10002434mg [Eutrema salsugineum]
 gb|ESQ37165.1| hypothetical protein EUTSA_v10002434mg [Eutrema salsugineum]
Length=657

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F  L D +++N+++  EM RM+ACAAA VRHSARRRPR
Sbjct  491  YVDDSLVDWARPLLNRASEEGDFEGLADTKMKNEYDREEMARMVACAAACVRHSARRRPR  550

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPG S  Y S   S+DYD+ QYNEDMKKFRKMALG+Q Y
Sbjct  551  MSQIVRALEGNVSLSDLNEGMRPGQSNVYSSYGGSTDYDSSQYNEDMKKFRKMALGTQGY  610

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             +TG+YSNPTS+YGL PSGSSSEGQTT+EMEMG++++
Sbjct  611  NTTGEYSNPTSDYGLYPSGSSSEGQTTREMEMGKIKR  647



>ref|XP_004512982.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Cicer arietinum]
Length=653

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 135/159 (85%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLV+WARPLL RALE+ + ++L+DPRL+N+F+ NEM RM+ACAAA  RHSA+RRP+
Sbjct  487  YMEDSLVEWARPLLMRALEEDHLDSLIDPRLQNEFDPNEMTRMVACAAACTRHSAKRRPK  546

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL+DLNEGIRPGHS  Y SS+ESSDYD  QY EDM KFRKMALG+QEY
Sbjct  547  MSQVVRALEGDVSLADLNEGIRPGHSTIY-SSHESSDYDTQQYKEDMIKFRKMALGTQEY  605

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMR  352
              + +YS  TSEYGLNPSGSSSE    QTT+EMEM +++
Sbjct  606  AGSSEYSAATSEYGLNPSGSSSENQSRQTTREMEMRKLK  644



>ref|XP_004139342.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Cucumis 
sativus]
 gb|KGN60616.1| hypothetical protein Csa_2G004170 [Cucumis sativus]
Length=672

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL++RALEDGNF+ LVDPRL+N++NHNEM RM+ACAAA VRHSA+RRPRM
Sbjct  509  MEDSLVDWARPLMNRALEDGNFDVLVDPRLQNNYNHNEMARMVACAAACVRHSAKRRPRM  568

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD SLSDLNEG++PG S+ Y SS+ SSDYD  QYNED++KFRK+ALGS EYG
Sbjct  569  SQVVRALEGDSSLSDLNEGVKPGQSSMY-SSHGSSDYDTHQYNEDLRKFRKVALGSTEYG  627

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            ++ +YS PTSEYGL PSGSSSEGQTT+EME    +K+
Sbjct  628  ASSEYSGPTSEYGLYPSGSSSEGQTTREMETRTAKKE  664



>ref|XP_008781703.1| PREDICTED: proline-rich receptor-like protein kinase PERK1, partial 
[Phoenix dactylifera]
Length=622

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++ L DPRL  ++N NEM RMIACAAA VRHSARRRPR
Sbjct  465  FMDDSLVDWARPLLTRALEDGNYDALTDPRLGKNYNPNEMARMIACAAACVRHSARRRPR  524

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMAL-GSQE  463
            MSQVVRALEGD+SL DLNEG++PGHS  +GS Y SS+YD+ QYNEDMKKFRKMA+  +Q+
Sbjct  525  MSQVVRALEGDVSLEDLNEGVKPGHSRFFGS-YGSSEYDSGQYNEDMKKFRKMAMAATQD  583

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            Y ST  +S PTSEYG NPS SSSEGQ T+EMEMG+ +KD
Sbjct  584  YPST-DFSAPTSEYGQNPSASSSEGQHTREMEMGKGKKD  621



>gb|KGN65152.1| hypothetical protein Csa_1G250150 [Cucumis sativus]
Length=606

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDD L+DWARPLL RA EDG++++LVDP+L ++++HNEM RM+ACAAA VRHSARRRPR
Sbjct  443  FMDDGLLDWARPLLLRATEDGHYDSLVDPKLRDNYDHNEMARMVACAAACVRHSARRRPR  502

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVV ALEG+ SLSDLNEGIRPGHS  Y SSY SSDYD  QYNED+KKFRKMAL SQEY
Sbjct  503  MSQVVHALEGESSLSDLNEGIRPGHSTVY-SSYGSSDYDTAQYNEDLKKFRKMALASQEY  561

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEM  364
            GS  +YS  TSEYGL PSGSS +GQTT+EMEM
Sbjct  562  GS--EYSEQTSEYGLYPSGSSGDGQTTREMEM  591



>gb|ERM98577.1| hypothetical protein AMTR_s00109p00039350 [Amborella trichopoda]
Length=473

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 135/160 (84%), Gaps = 8/160 (5%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMD+SLVDWARPLL RALE+GNF++LVDPRL N F  NEM RM+ACAAA VRHSARRRPR
Sbjct  308  FMDESLVDWARPLLLRALEEGNFDSLVDPRLHN-FPINEMRRMVACAAACVRHSARRRPR  366

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+  YNEDMKKFRKMAL SQ+Y
Sbjct  367  MSQIVRALEGDVSLDDLNEGVRPGHSHVY--SYGSSDYDSGMYNEDMKKFRKMALASQDY  424

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMR  352
            GS+ +YSNPTS+YGLNPS SSSEG    + T+EMEM + +
Sbjct  425  GSS-EYSNPTSDYGLNPSASSSEGRQTREQTREMEMAKTK  463



>ref|XP_004150052.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Cucumis 
sativus]
Length=639

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDD L+DWARPLL RA EDG++++LVDP+L ++++HNEM RM+ACAAA VRHSARRRPR
Sbjct  476  FMDDGLLDWARPLLLRATEDGHYDSLVDPKLRDNYDHNEMARMVACAAACVRHSARRRPR  535

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVV ALEG+ SLSDLNEGIRPGHS  Y SSY SSDYD  QYNED+KKFRKMAL SQEY
Sbjct  536  MSQVVHALEGESSLSDLNEGIRPGHSTVY-SSYGSSDYDTAQYNEDLKKFRKMALASQEY  594

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEM  364
            GS  +YS  TSEYGL PSGSS +GQTT+EMEM
Sbjct  595  GS--EYSEQTSEYGLYPSGSSGDGQTTREMEM  624



>emb|CDX77417.1| BnaA07g05550D [Brassica napus]
Length=650

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrr-p  643
            ++DDSLVDWARPLL+RA E G+F  L D ++ N ++  EM RM+ACAAA VRHSARRR  
Sbjct  476  YVDDSLVDWARPLLNRASEQGDFEGLADAKMNNGYDREEMARMVACAAACVRHSARRRPR  535

Query  642  rmSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQE  463
               Q+VRALEG++SLSDLNEG+RPG S  Y S   S+DYD+ QYNEDMKKFRKMALG+QE
Sbjct  536  MSQQIVRALEGNVSLSDLNEGMRPGQSNVYSSYGGSTDYDSSQYNEDMKKFRKMALGTQE  595

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            Y +TG+YSNPTS+YGL PSGSSSEGQTT+EMEMG++++
Sbjct  596  YNATGEYSNPTSDYGLYPSGSSSEGQTTREMEMGKIKR  633



>emb|CDY39543.1| BnaC07g07110D [Brassica napus]
Length=649

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 131/158 (83%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrr-p  643
            ++DDSLVDWARPLL+RA E G+F  L D ++ N ++  EM RM+ACAAA VRHSARRR  
Sbjct  482  YVDDSLVDWARPLLNRASEQGDFEGLADAKMNNGYDREEMARMVACAAACVRHSARRRPR  541

Query  642  rmSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQE  463
               Q+VRALEG++SLSDLNEG+RPG S  Y S   S+DYD+ QYNEDMKKFRKMALG+QE
Sbjct  542  MSQQIVRALEGNVSLSDLNEGMRPGQSNVYSSYGGSTDYDSSQYNEDMKKFRKMALGTQE  601

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
            Y +TG+YSNPTS+YGL PSGSSSEGQTT+EMEMG++++
Sbjct  602  YNATGEYSNPTSDYGLYPSGSSSEGQTTREMEMGKIKR  639



>ref|XP_011093589.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Sesamum 
indicum]
Length=663

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDSLVDWARPLL RALEDGNF+ LVD R++ND+NH EM  M+ACAAA VRHSA+RRPR
Sbjct  499  FTDDSLVDWARPLLTRALEDGNFDVLVDRRIQNDYNHKEMASMVACAAACVRHSAKRRPR  558

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPGHS  Y SSY+SSDYD  QYNEDM KFRKMAL SQEY
Sbjct  559  MSQVVRALEGDVSLSDLNEGIRPGHSTTY-SSYDSSDYDTRQYNEDMIKFRKMALASQEY  617

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+  YSNPTSEYGL PSGSSSEGQ T+EMEMG M+K
Sbjct  618  RSSDLYSNPTSEYGLYPSGSSSEGQQTREMEMGNMKK  654



>ref|XP_011620537.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Amborella 
trichopoda]
Length=634

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 135/160 (84%), Gaps = 8/160 (5%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMD+SLVDWARPLL RALE+GNF++LVDPRL N F  NEM RM+ACAAA VRHSARRRPR
Sbjct  469  FMDESLVDWARPLLLRALEEGNFDSLVDPRLHN-FPINEMRRMVACAAACVRHSARRRPR  527

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+  YNEDMKKFRKMAL SQ+Y
Sbjct  528  MSQIVRALEGDVSLDDLNEGVRPGHSHVY--SYGSSDYDSGMYNEDMKKFRKMALASQDY  585

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMR  352
            GS+ +YSNPTS+YGLNPS SSSEG    + T+EMEM + +
Sbjct  586  GSS-EYSNPTSDYGLNPSASSSEGRQTREQTREMEMAKTK  624



>ref|XP_008242654.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Prunus 
mume]
Length=660

 Score =   190 bits (482),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 136/162 (84%), Gaps = 5/162 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARP+L RALE+ NF+ LVDP+L+N ++ NEM RM+ACAAA VRHSARRRPR
Sbjct  492  FMEDSLVDWARPVLTRALEERNFDGLVDPKLQNGYDPNEMARMVACAAACVRHSARRRPR  551

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPG S  Y SSY SSDYD  QY EDMKKFRKMALGSQEY
Sbjct  552  MSQVVRALEGDVSLSDLNEGIRPGQSNVY-SSYGSSDYDTSQYKEDMKKFRKMALGSQEY  610

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ----TTQEMEMGRMRKD  346
            G + +YS PTSEYGL PSGSSS       TT+EMEMGR++K+
Sbjct  611  GGSSEYSAPTSEYGLYPSGSSSGEGQSRLTTREMEMGRIKKN  652



>ref|XP_009419795.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Musa 
acuminata subsp. malaccensis]
Length=714

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 133/158 (84%), Gaps = 3/158 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++ LVDP+L  ++N +EM RMIACAA  VRHSARRRP+
Sbjct  553  FMDDSLVDWARPLLTRALEDGNYDALVDPKLGKNYNPDEMARMIACAAVCVRHSARRRPK  612

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQV+RALEGD+SL DLNEGIRPGHS  YG SY SSDYD+ QYNEDMKKFRKMAL +QEY
Sbjct  613  MSQVIRALEGDVSLEDLNEGIRPGHSRFYG-SYGSSDYDSNQYNEDMKKFRKMALTTQEY  671

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             + G +S  TSEYG NPS SS+EG+ T E+E+G+ +KD
Sbjct  672  -TGGDHSAETSEYGQNPSSSSTEGRQTHEIEIGK-KKD  707



>ref|XP_007204236.1| hypothetical protein PRUPE_ppa002532mg [Prunus persica]
 gb|EMJ05435.1| hypothetical protein PRUPE_ppa002532mg [Prunus persica]
Length=661

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 134/160 (84%), Gaps = 5/160 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARP+L RALE+ NF+ LVDP+L+N F+ NEM RM+ACAAA VRHSARRRPR
Sbjct  494  FMEDSLVDWARPVLTRALEERNFDGLVDPKLQNSFDPNEMARMVACAAACVRHSARRRPR  553

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPG S  Y SSY SSDYD  QY EDMKKFRKMALGSQEY
Sbjct  554  MSQVVRALEGDVSLSDLNEGIRPGQSNVY-SSYGSSDYDTSQYKEDMKKFRKMALGSQEY  612

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ----TTQEMEMGRMR  352
            G + +YS PTSEYGL PSGSSS       TT+EMEMGR++
Sbjct  613  GGSSEYSAPTSEYGLYPSGSSSGEGQSRLTTREMEMGRIK  652



>ref|XP_008361244.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Malus 
domestica]
Length=668

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARP+L+RALE+ NF+ LVDP+L+N ++ NEM RM+ACAAA VRHSARRRPR
Sbjct  499  YMEDSLVDWARPVLNRALEERNFDELVDPKLQNSYDPNEMARMVACAAACVRHSARRRPR  558

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPG S  Y SS+ SSDYD  QY EDMKKFRKMALGSQEY
Sbjct  559  MSQVVRALEGDVSLSDLNEGIRPGQSNVY-SSHGSSDYDTSQYKEDMKKFRKMALGSQEY  617

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMRKD  346
            G++ +YS PTS+YGL PSGSSS      QTT+EME+GR++K+
Sbjct  618  GASSEYSAPTSDYGLYPSGSSSGEGQSRQTTREMELGRIKKN  659



>ref|XP_009374021.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=660

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 5/161 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARP+L+RALE+ NF+ LVDP+L+N ++ NEM RM+ACAAA VRHSARRRPR
Sbjct  491  YMEDSLVDWARPVLNRALEERNFDELVDPKLQNSYDPNEMARMVACAAACVRHSARRRPR  550

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPG S  Y SSY SSDYD  QY +DMKKFRKMALGSQEY
Sbjct  551  MSQVVRALEGDVSLSDLNEGIRPGQSNVY-SSYGSSDYDTSQYKDDMKKFRKMALGSQEY  609

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMRK  349
            G++ +YS PTS+YGL PSGSSS      QTT+EME+GR++K
Sbjct  610  GASSEYSAPTSDYGLYPSGSSSGEGQSRQTTREMELGRIKK  650



>ref|XP_008337381.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK1 [Malus domestica]
Length=667

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARP+L+RALE+ NF+ LVDP+L+N ++ NEM RM+ACAAA VRHSARRRPR
Sbjct  498  YMEDSLVDWARPVLNRALEERNFDELVDPKLQNSYDPNEMARMVACAAACVRHSARRRPR  557

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGIRPG S  Y SS+ SSDYD  QY EDMKKFRKMALGSQEY
Sbjct  558  MSQVVRALEGDVSLSDLNEGIRPGQSNVY-SSHGSSDYDTSQYKEDMKKFRKMALGSQEY  616

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMRKD  346
            G++ +YS PTS+YGL PSGSSS      QTT+EME+GR++K+
Sbjct  617  GASSEYSAPTSDYGLYPSGSSSGEGQSRQTTREMELGRIKKN  658



>gb|KDO48899.1| hypothetical protein CISIN_1g014904mg [Citrus sinensis]
Length=406

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 132/158 (84%), Gaps = 11/158 (7%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DSLVDWARPLL+RA+EDGNF+TLVDP+L N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  252  FVEDSLVDWARPLLNRAIEDGNFDTLVDPKLHNEYNHNEMARMVACAAACVRHSARRRPR  311

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL+DLNEGIRPG S+ Y  SY SSDYD MQYNED+KKFRKMAL SQEY
Sbjct  312  MSQIVRALEGDASLADLNEGIRPGQSSVY-GSYGSSDYDTMQYNEDLKKFRKMALNSQEY  370

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ +YS PTSEY          GQ T+EMEMG+ +K+
Sbjct  371  SASSEYSRPTSEY----------GQNTREMEMGKTKKN  398



>gb|KJB07173.1| hypothetical protein B456_001G005700 [Gossypium raimondii]
Length=710

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 130/158 (82%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + +DSLV+WARPLL RALEDG FN L+DPRL+ ++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  544  YAEDSLVEWARPLLSRALEDGTFNNLIDPRLQKEYNHNEMARMVACAAACVRHSARRRPR  603

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+ SLSDLNEG+RPG S  Y S   SSDYDA  YNEDMK+ R+ ALGS EY
Sbjct  604  MSQIVRALEGESSLSDLNEGMRPGQSNVYSSYGGSSDYDASHYNEDMKRLRRAALGSLEY  663

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            G++ +YS  TSEYGL PSG S+EGQTT+E+E G  +K+
Sbjct  664  GASSEYSEQTSEYGLYPSG-STEGQTTREIETGSTKKN  700



>gb|EPS72303.1| hypothetical protein M569_02452, partial [Genlisea aurea]
Length=620

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL RAL++GNF++L+D RL N +N NE+ RM+ACAAA VRHSARRRPR
Sbjct  468  YIDDSLVDWARPLLTRALDEGNFDSLIDRRLGNSYNQNELARMVACAAACVRHSARRRPR  527

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            + QVVRALEGD+SL+DLNEGIRPGHSA Y SSY SSDYDA QYNEDM + RK A G+QEY
Sbjct  528  LGQVVRALEGDVSLTDLNEGIRPGHSAFY-SSYGSSDYDASQYNEDMIRLRKTAFGTQEY  586

Query  459  G-STGQYSNPTSEYGLNPS-GSSSEGQTTQEMEM  364
            G  + QYSNPTSEYGLNPS  SSSEG   Q  E+
Sbjct  587  GLGSDQYSNPTSEYGLNPSTSSSSEGLKQQSKEI  620



>gb|AFW82074.1| putative prolin-rich extensin-like receptor protein kinase family 
protein [Zea mays]
Length=186

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG +++LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  18   YMDDSLVDWARPLLMRALEDGEYDSLVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  77

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++SL DLNEG+RPGHS  +GS   SSDYD+ QYNEDMKKF+KMA  +   
Sbjct  78   MSQVVRALEGNVSLEDLNEGVRPGHSRFFGSY-SSSDYDSGQYNEDMKKFKKMAFNNNY-  135

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             ++ QYS PTSEYG  PS SSSEG  TQEME G M+K
Sbjct  136  -TSSQYSAPTSEYGQIPSASSSEGHQTQEMESGAMKK  171



>gb|ACN40429.1| unknown [Picea sitchensis]
Length=656

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 132/156 (85%), Gaps = 5/156 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL RA+EDGN + LVDPR++N++N NEM+R++ACAA+SVRHSARRRPR
Sbjct  467  FAEDSLVDWARPLLARAMEDGNLDALVDPRIQNNYNLNEMMRVVACAASSVRHSARRRPR  526

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M Q+VR LEGD+SL DLNEG+RPGHS  YG S  SSDYD  QY+EDMKKFRKMALGSQE+
Sbjct  527  MGQIVRVLEGDVSLDDLNEGVRPGHSTHYG-SVGSSDYDTNQYSEDMKKFRKMALGSQEH  585

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME--MGR  358
            GS  +YS+PTSEYGLN S SSSE   ++E+E  +GR
Sbjct  586  GS--EYSDPTSEYGLNQSVSSSEYLQSKEVESNIGR  619



>ref|XP_009380552.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Musa 
acuminata subsp. malaccensis]
Length=643

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 136/158 (86%), Gaps = 3/158 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++ LVDP+L  ++N NEM RMIACAAA VRHS+RRRPR
Sbjct  481  FMDDSLVDWARPLLTRALEDGNYDALVDPKLGMNYNPNEMARMIACAAACVRHSSRRRPR  540

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ++RALEGD+SL DL+EGIRPGHS  + SSY SSDYD+ QYNEDMKKFRKMAL +QEY
Sbjct  541  MSQILRALEGDVSLEDLHEGIRPGHS-RFYSSYGSSDYDSGQYNEDMKKFRKMALTTQEY  599

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             S+ +YS PTSEYG NPS SSSEG  TQE+EMG+ +KD
Sbjct  600  ASS-EYSAPTSEYGRNPSASSSEGAQTQEVEMGK-KKD  635



>gb|KDO38462.1| hypothetical protein CISIN_1g046502mg, partial [Citrus sinensis]
Length=608

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 132/158 (84%), Gaps = 7/158 (4%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+D+L   ARPLL+RA+EDGNF+TLVDP+L N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  448  FMEDNL---ARPLLNRAIEDGNFDTLVDPKLHNEYNHNEMARMVACAAACVRHSARRRPR  504

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            +SQ+VR LEGD SL+DLNEGIRPG S+ YGS     DYD MQYNED+KKFRKMAL SQE 
Sbjct  505  ISQIVRTLEGDASLADLNEGIRPGQSSVYGSL----DYDTMQYNEDLKKFRKMALNSQEI  560

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ +Y+ PTS+YGL+ S SSSEG  T+E+EMG+ RK+
Sbjct  561  SASSEYNRPTSDYGLHSSSSSSEGHNTREIEMGKARKN  598



>gb|ACN33630.1| unknown [Zea mays]
Length=282

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG +++LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  114  YMDDSLVDWARPLLMRALEDGEYDSLVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  173

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++SL DLNEG+RPGHS  +GS   SSDYD+ QYNEDMKKF+KMA  +   
Sbjct  174  MSQVVRALEGNVSLEDLNEGVRPGHSRFFGSY-SSSDYDSGQYNEDMKKFKKMAFNNNY-  231

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             ++ QYS PTSEYG  PS SSSEG  TQEME G M+K
Sbjct  232  -TSSQYSAPTSEYGQIPSASSSEGHQTQEMESGAMKK  267



>gb|EMS62683.1| Proline-rich receptor-like protein kinase PERK1 [Triticum urartu]
Length=445

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDGN++ LVD RL  DFN NE+ RMIACAAA VRHSARRRPR
Sbjct  277  YMDDSLVDWARPLLMRALEDGNYDELVDARLGKDFNPNEIARMIACAAACVRHSARRRPR  336

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKF+KMA  + +Y
Sbjct  337  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFKKMAFTTNDY  395

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PS SSSEGQ TQE+E G M+K
Sbjct  396  TSS-QYSAPTSEYGQIPSASSSEGQQTQEIETGTMKK  431



>ref|XP_006654162.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Oryza brachyantha]
Length=444

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN+++LVDPRL  DFN NE+ RMIACAAA VRHSARRRPR
Sbjct  274  FMDDSLVDWARPLLMRALEDGNYDSLVDPRLAKDFNPNEIARMIACAAACVRHSARRRPR  333

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  334  MSQVVRALEGDVSLEDLNEGVRPGHSR-YFGSYSSSDYDSGQYNEDMKKFRKMAFTNNND  392

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             ++ QYS PTSEYG  PS SSSEGQ TQE+E
Sbjct  393  YTSSQYSAPTSEYGQIPSASSSEGQQTQEIE  423



>gb|AGV22099.1| receptor protein kinase [Brassica juncea var. tumida]
Length=640

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E G+F  L D ++ N ++  EM RM+ACAAA VRHSARRRPR
Sbjct  474  YVDDSLVDWARPLLNRASEQGDFEGLADAKMNNGYDREEMARMVACAAACVRHSARRRPR  533

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSD NEG+RPG S  Y S   S+DYD+ Q NEDMKKF KMALG+QEY
Sbjct  534  MSQIVRALEGNVSLSDFNEGMRPGQSNVYSSYGGSTDYDSSQSNEDMKKFGKMALGTQEY  593

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
              TG+ SNP S+YGL P GSSSEGQT +EMEMG++++
Sbjct  594  NPTGESSNPPSDYGLYPFGSSSEGQTPREMEMGKIKR  630



>ref|XP_007024170.1| Proline extensin-like receptor kinase 1 [Theobroma cacao]
 gb|EOY26792.1| Proline extensin-like receptor kinase 1 [Theobroma cacao]
Length=566

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWARPLL +ALE GNF+  VDPRL+ D++ +E+ +M+ACAAA VRHSAR RPR
Sbjct  402  FFDDSIVDWARPLLSQALEQGNFDAFVDPRLQKDYDSSELTQMVACAAACVRHSARHRPR  461

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+ R LEG+MSL DLNEGI PGHS  + SSY SSDY A QY ED+KKFRKMAL SQE 
Sbjct  462  MSQIARTLEGNMSLDDLNEGITPGHSTVF-SSYGSSDYSATQYKEDIKKFRKMALESQEL  520

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ-TTQEMEMGRMRKD  346
            GS+ +YS  TS+YGLNPS SS+EGQ TTQEM+  ++ K+
Sbjct  521  GSS-EYSGHTSDYGLNPSSSSTEGQHTTQEMDTSKVEKE  558



>ref|XP_004287409.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Fragaria 
vesca subsp. vesca]
Length=662

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 10/168 (6%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLV+WARPLL RALE  +F+ LVDPRL N ++HNEM RM+ACAAA VRHSARRRPR
Sbjct  485  YMDDSLVEWARPLLTRALESDDFDELVDPRLRNSYDHNEMARMVACAAACVRHSARRRPR  544

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSS----YESSDYDAMQYNEDMKKFRKMALG  472
            MSQVVRALEGD+SLSDLNEGIRPGHS+ Y S     ++S  YD  Q N D+   RKMAL 
Sbjct  545  MSQVVRALEGDVSLSDLNEGIRPGHSSLYSSHGSSDFDSRPYDTKQRNLDLINHRKMALE  604

Query  471  SQEYGSTGQYS--NPTSEYGLNPSGSSSEGQ----TTQEMEMGRMRKD  346
            SQEYG++ +YS    TSEYGLNPSGSSSEGQ    TTQEME+G+M K+
Sbjct  605  SQEYGASSEYSGGRTTSEYGLNPSGSSSEGQRTRETTQEMELGKMNKN  652



>ref|XP_004960636.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Setaria italica]
Length=672

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG+++ LVDPRL  DF+ NE+ RMIACAAA VRHSARRRPR
Sbjct  507  YMDDSLVDWARPLLMRALEDGDYDELVDPRLGKDFSPNEIARMIACAAACVRHSARRRPR  566

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKFRKMA  +  Y
Sbjct  567  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFRKMAFNNNNY  625

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PS SSSEGQ TQEME G M+K
Sbjct  626  TSS-QYSAPTSEYGQIPSASSSEGQQTQEMESGAMKK  661



>dbj|BAJ96935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDGN++ LVD RL  DFN NE+ RMIACAAA VRHSARRRPR
Sbjct  468  YMDDSLVDWARPLLMRALEDGNYDELVDARLGKDFNPNEIARMIACAAACVRHSARRRPR  527

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKF+KMA  + +Y
Sbjct  528  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFKKMAFTTNDY  586

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PS SSSEGQ TQE+E G M+K
Sbjct  587  TSS-QYSAPTSEYGQIPSASSSEGQQTQEIETGTMKK  622



>ref|XP_002439469.1| hypothetical protein SORBIDRAFT_09g007240 [Sorghum bicolor]
 gb|EES17899.1| hypothetical protein SORBIDRAFT_09g007240 [Sorghum bicolor]
Length=482

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 127/157 (81%), Gaps = 3/157 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG ++ LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  315  YMDDSLVDWARPLLMRALEDGEYDALVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  374

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  375  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFRKMAFNNNY-  432

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             ++ QYS PTSEYG  PS SSSEG  TQEME G M+K
Sbjct  433  -TSSQYSAPTSEYGQIPSASSSEGHQTQEMESGAMKK  468



>gb|EMT10712.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=654

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDGN++ LVD RL  DFN NE+ RMIACAAA VRHSARRRPR
Sbjct  486  YMDDSLVDWARPLLMRALEDGNYDELVDARLGKDFNPNEIARMIACAAACVRHSARRRPR  545

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKF+KMA  + +Y
Sbjct  546  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFKKMAFTTNDY  604

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PS SSSEGQ TQE+E G M+K
Sbjct  605  TSS-QYSAPTSEYGQIPSASSSEGQQTQEIETGTMKK  640



>gb|ACG28793.1| receptor protein kinase PERK1 [Zea mays]
Length=661

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG ++ LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  493  YMDDSLVDWARPLLMRALEDGEYDALVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  552

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDM+KFRK A  +  Y
Sbjct  553  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMQKFRKAAFNNNTY  611

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PSGSSSEG+ TQEME G ++K
Sbjct  612  TSS-QYSAPTSEYGQVPSGSSSEGRQTQEMESGAVKK  647



>ref|NP_001148076.1| LOC100281684 [Zea mays]
 gb|ACG29662.1| receptor protein kinase PERK1 [Zea mays]
Length=689

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG ++ LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  521  YMDDSLVDWARPLLMRALEDGEYDALVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  580

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDM+KFRK A  +  Y
Sbjct  581  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMQKFRKAAFNNNTY  639

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PSGSSSEG+ TQEME G ++K
Sbjct  640  TSS-QYSAPTSEYGQVPSGSSSEGRQTQEMESGAVKK  675



>gb|AFW77531.1| putative prolin-rich extensin-like receptor protein kinase family 
protein [Zea mays]
Length=416

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG ++ LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  247  YMDDSLVDWARPLLMRALEDGEYDALVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  306

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDM+KFRK A  +  Y
Sbjct  307  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMQKFRKTAFNNNTY  365

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             S+ QYS PTSEYG  PSGSSSEG+ TQEME
Sbjct  366  TSS-QYSAPTSEYGQVPSGSSSEGRQTQEME  395



>ref|XP_003568732.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Brachypodium 
distachyon]
Length=652

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDGN++ LVD RL  DFN NE+ RMIACAAA VRHSARRRPR
Sbjct  484  YMDDSLVDWARPLLMRALEDGNYDELVDARLGKDFNPNEIARMIACAAACVRHSARRRPR  543

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKF+KMA  + +Y
Sbjct  544  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFKKMAFTTNDY  602

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             S+ QYS PTSEYG  PS SSSEGQ TQE+E G  +K
Sbjct  603  TSS-QYSAPTSEYGQIPSASSSEGQQTQEIETGTTKK  638



>gb|ACF86764.1| unknown [Zea mays]
 gb|AFW77529.1| putative prolin-rich extensin-like receptor protein kinase family 
protein [Zea mays]
Length=421

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG ++ LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  252  YMDDSLVDWARPLLMRALEDGEYDALVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  311

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDM+KFRK A  +  Y
Sbjct  312  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMQKFRKTAFNNNTY  370

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             S+ QYS PTSEYG  PSGSSSEG+ TQEME
Sbjct  371  TSS-QYSAPTSEYGQVPSGSSSEGRQTQEME  400



>ref|XP_009413938.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Musa 
acuminata subsp. malaccensis]
Length=598

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F D+SLVDWARPLL RAL+DGN++ LVDPRL   +N +EM RM++CAAA VRHSARRRPR
Sbjct  438  FTDESLVDWARPLLARALDDGNYDALVDPRLGKKYNLSEMARMVSCAAACVRHSARRRPR  497

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+ RALEGD  L DLNEGIRPGHS  Y +SY SSDYD+ QY+ED+++FRKM +G++E 
Sbjct  498  MSQIARALEGDTCLEDLNEGIRPGHS-MYHTSYGSSDYDSGQYSEDIREFRKMVMGTEE-  555

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMR  352
             +TG+   PT+EY  NPS SSSEG+ TQE+EMG+ +
Sbjct  556  NATGESIMPTAEYAQNPSTSSSEGRHTQEIEMGKKK  591



>gb|AFW77530.1| putative prolin-rich extensin-like receptor protein kinase family 
protein [Zea mays]
Length=432

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG ++ LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  252  YMDDSLVDWARPLLMRALEDGEYDALVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  311

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDM+KFRK A  +  Y
Sbjct  312  MSQVVRALEGDVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMQKFRKTAFNNNTY  370

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             S+ QYS PTSEYG  PSGSSSEG+ TQEME
Sbjct  371  TSS-QYSAPTSEYGQVPSGSSSEGRQTQEME  400



>gb|KJB64911.1| hypothetical protein B456_010G072000 [Gossypium raimondii]
Length=423

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + +DSLVDWARPLL RA+EDGN+ +L DP+L+ ++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  257  YREDSLVDWARPLLTRAMEDGNYESLADPKLQKEYNHNEMTRMVACAAACVRHSARRRPR  316

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SLSDLNEG+ P   ++  SSYESSDYD  QYNEDMK+FR+MAL +QEY
Sbjct  317  MSQIVRALEGDASLSDLNEGVTP-EQSSVYSSYESSDYDTNQYNEDMKRFRRMALDTQEY  375

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ +YS  T+EYGL PSGSS EGQTT+EMEM +M K+
Sbjct  376  AASSEYSEATTEYGLYPSGSSYEGQTTREMEMRKMMKN  413



>ref|XP_010915808.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK1 [Elaeis guineensis]
Length=643

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL +ALEDGN++ L+D RL N++N NEM RMIACAAA VRHSA+RRPR
Sbjct  482  FMDDSLVDWARPLLTQALEDGNYDALIDSRLRNNYNPNEMARMIACAAACVRHSAKRRPR  541

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEGI+PGHS  + S   S      QYN +MKKFRKMAL + + 
Sbjct  542  MSQVVRALEGDVSLEDLNEGIKPGHSRFFSSYSSSDYDSG-QYNNNMKKFRKMALPTTQD  600

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ ++S PTSEYG NPS SSSEGQ T+EMEMG+  K+
Sbjct  601  YASSEFSAPTSEYGQNPSASSSEGQHTREMEMGKREKE  638



>ref|NP_001145767.1| uncharacterized LOC100279274 [Zea mays]
 gb|ACL52550.1| unknown [Zea mays]
 gb|AFW82072.1| putative prolin-rich extensin-like receptor protein kinase family 
protein [Zea mays]
Length=662

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 3/157 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL RALEDG +++LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  494  YMDDSLVDWARPLLMRALEDGEYDSLVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  553

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++SL DLNEG+RPGHS  +  SY SSDYD+ QYNEDMKKF+KMA  +   
Sbjct  554  MSQVVRALEGNVSLEDLNEGVRPGHSRFF-GSYSSSDYDSGQYNEDMKKFKKMAFNNNY-  611

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
             ++ QYS PTSEYG  PS SSSEG  TQEME G M+K
Sbjct  612  -TSSQYSAPTSEYGQIPSASSSEGHQTQEMESGAMKK  647



>ref|XP_008463394.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Cucumis 
melo]
Length=642

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 3/152 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDD L+DWARPLL RA EDG+++ LVDP+L ++++HNEM RM+ACAAA VRHSARRRPR
Sbjct  471  FMDDGLLDWARPLLLRATEDGHYDGLVDPKLRDNYDHNEMARMVACAAACVRHSARRRPR  530

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVV ALEG+ SLSDLNEGIRPGHS+ Y S   S    A QYNED+KKFRKMAL SQEY
Sbjct  531  MSQVVHALEGESSLSDLNEGIRPGHSSVYSSYGSSDYDTA-QYNEDLKKFRKMALASQEY  589

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEM  364
            GS  ++S  TSEYGL PSGSS +GQTT+EMEM
Sbjct  590  GS--EFSEQTSEYGLYPSGSSGDGQTTREMEM  619



>ref|XP_009400136.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Musa 
acuminata subsp. malaccensis]
Length=668

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++ LVDP+L  +F+ NEM  MIACAAA VRHSARRRPR
Sbjct  506  FMDDSLVDWARPLLTRALEDGNYDALVDPKLGRNFDPNEMACMIACAAACVRHSARRRPR  565

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ++RALEGD+SL DLNEGIRPGHS  Y SS+ SSDYD+ QYNEDMKKFRKMAL + EY
Sbjct  566  MSQIMRALEGDVSLEDLNEGIRPGHSRFY-SSHGSSDYDSSQYNEDMKKFRKMAL-TPEY  623

Query  459  GSTGQYSNPTSEYGLNPSGS-SSEGQTTQEME  367
            GS+  YS PTSEYG +PS S SSEGQ TQE+E
Sbjct  624  GSS-DYSAPTSEYGQHPSASASSEGQHTQEIE  654



>ref|NP_001054941.1| Os05g0218400 [Oryza sativa Japonica Group]
 dbj|BAF16855.1| Os05g0218400, partial [Oryza sativa Japonica Group]
Length=390

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL +ALE+GN+  LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  222  YMDDSLVDWARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  281

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  282  MSQVVRALEGDVSLEDLNEGVRPGHS-RYFGSYSSSDYDSGQYNEDMKKFRKMAF-TNNN  339

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             ++ QYS PTSEYG  PS SSSEGQ TQE+E
Sbjct  340  DTSSQYSAPTSEYGQIPSASSSEGQQTQEVE  370



>ref|XP_007135679.1| hypothetical protein PHAVU_010G149300g [Phaseolus vulgaris]
 gb|ESW07673.1| hypothetical protein PHAVU_010G149300g [Phaseolus vulgaris]
Length=566

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F+DDS+V+WARPLL +A E+GNF+ LVDP+L+ ++NH+EM+RM ACAA+ VRHSAR RPR
Sbjct  408  FLDDSMVEWARPLLSQAFENGNFDGLVDPKLQRNYNHDEMIRMTACAASCVRHSARLRPR  467

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++SL DLNEG  PGHS  +G S+ESS YD++QY+EDMK FRK+AL SQE 
Sbjct  468  MSQVVRALEGNISLEDLNEGSAPGHSRVFG-SFESSSYDSVQYSEDMKNFRKLALESQEQ  526

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMG  361
            G   +YS P+S+YG +PS S+S G Q TQE+E+G
Sbjct  527  G-ISEYSGPSSDYGRHPSVSTSSGQQNTQEIELG  559



>gb|AAO72646.1| putative receptor protein kinase [Oryza sativa Japonica Group]
Length=394

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL +ALE+GN+  LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  226  YMDDSLVDWARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  285

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  286  MSQVVRALEGDVSLEDLNEGVRPGHS-RYFGSYSSSDYDSGQYNEDMKKFRKMAF-TNNN  343

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             ++ QYS PTSEYG  PS SSSEGQ TQE+E
Sbjct  344  DTSSQYSAPTSEYGQIPSASSSEGQQTQEVE  374



>ref|XP_003529582.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Glycine max]
Length=570

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 126/157 (80%), Gaps = 3/157 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F+DDS+V+WARPLL +ALE+GN N LVDPRL+ ++N +EM+RM  CAA  VR+SAR RPR
Sbjct  404  FIDDSMVEWARPLLSQALENGNLNGLVDPRLQTNYNLDEMIRMTTCAATCVRYSARLRPR  463

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++SL DLN+GI PGHS  +G S+ESS YD++QY ED+K F+K+AL SQE 
Sbjct  464  MSQVVRALEGNISLEDLNDGIAPGHSRVFG-SFESSSYDSVQYREDLKNFKKLALESQEQ  522

Query  459  GSTGQYSNPTSEYGLNPSGS-SSEGQTTQEMEMGRMR  352
            G   +YS P+SEYG +PS S SS+ Q TQEMEMG  +
Sbjct  523  G-ISEYSGPSSEYGRHPSVSTSSDQQNTQEMEMGNKK  558



>gb|EEC78728.1| hypothetical protein OsI_18915 [Oryza sativa Indica Group]
Length=442

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL +ALE+GN+  LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  274  YMDDSLVDWARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  333

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  334  MSQVVRALEGDVSLEDLNEGVRPGHS-RYFGSYSSSDYDSGQYNEDMKKFRKMAF-TNNN  391

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             ++ QYS PTSEYG  PS SSSEGQ TQE+E
Sbjct  392  DTSSQYSAPTSEYGQIPSASSSEGQQTQEVE  422



>gb|KJB64910.1| hypothetical protein B456_010G072000 [Gossypium raimondii]
Length=647

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 1/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + +DSLVDWARPLL RA+EDGN+ +L DP+L+ ++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  481  YREDSLVDWARPLLTRAMEDGNYESLADPKLQKEYNHNEMTRMVACAAACVRHSARRRPR  540

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SLSDLNEG+ P   ++  SSYESSDYD  QYNEDMK+FR+MAL +QEY
Sbjct  541  MSQIVRALEGDASLSDLNEGVTP-EQSSVYSSYESSDYDTNQYNEDMKRFRRMALDTQEY  599

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             ++ +YS  T+EYGL PSGSS EGQTT+EMEM +M K+
Sbjct  600  AASSEYSEATTEYGLYPSGSSYEGQTTREMEMRKMMKN  637



>gb|AAV25281.1| putative protein kinase [Oryza sativa Japonica Group]
Length=471

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MDDSLVDWARPLL +ALE+GN+  LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  303  YMDDSLVDWARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  362

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  363  MSQVVRALEGDVSLEDLNEGVRPGHS-RYFGSYSSSDYDSGQYNEDMKKFRKMAF-TNNN  420

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             ++ QYS PTSEYG  PS SSSEGQ TQE+E
Sbjct  421  DTSSQYSAPTSEYGQIPSASSSEGQQTQEVE  451



>gb|KCW53715.1| hypothetical protein EUGRSUZ_J02973 [Eucalyptus grandis]
Length=521

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DS+VDWARPLL +AL+DG F+ +VDP+L  D+   EM RMIACAAA VRHSA+ RPR
Sbjct  357  FVEDSMVDWARPLLAQALKDGIFDAVVDPKLHKDYATEEMTRMIACAAACVRHSAQHRPR  416

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG +S SDLNEGI PGHS AY S + SSDYD  QY ED+KKFR MAL SQE 
Sbjct  417  MTQVVRALEGYLSPSDLNEGIVPGHSIAY-SPHGSSDYDTSQYQEDLKKFRMMALESQEQ  475

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ-TTQEMEMGRMRKD  346
             +T +YS  TSEYGL+PS SSS  Q TTQEM++G+M +D
Sbjct  476  -ATSEYSGLTSEYGLHPSSSSSGFQHTTQEMDLGKMAED  513



>gb|KCW53716.1| hypothetical protein EUGRSUZ_J02973 [Eucalyptus grandis]
Length=538

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DS+VDWARPLL +AL+DG F+ +VDP+L  D+   EM RMIACAAA VRHSA+ RPR
Sbjct  374  FVEDSMVDWARPLLAQALKDGIFDAVVDPKLHKDYATEEMTRMIACAAACVRHSAQHRPR  433

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG +S SDLNEGI PGHS AY S + SSDYD  QY ED+KKFR MAL SQE 
Sbjct  434  MTQVVRALEGYLSPSDLNEGIVPGHSIAY-SPHGSSDYDTSQYQEDLKKFRMMALESQEQ  492

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ-TTQEMEMGRMRKD  346
             +T +YS  TSEYGL+PS SSS  Q TTQEM++G+M +D
Sbjct  493  -ATSEYSGLTSEYGLHPSSSSSGFQHTTQEMDLGKMAED  530



>ref|XP_010033870.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Eucalyptus 
grandis]
Length=558

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F++DS+VDWARPLL +AL+DG F+ +VDP+L  D+   EM RMIACAAA VRHSA+ RPR
Sbjct  394  FVEDSMVDWARPLLAQALKDGIFDAVVDPKLHKDYATEEMTRMIACAAACVRHSAQHRPR  453

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG +S SDLNEGI PGHS AY S + SSDYD  QY ED+KKFR MAL SQE 
Sbjct  454  MTQVVRALEGYLSPSDLNEGIVPGHSIAY-SPHGSSDYDTSQYQEDLKKFRMMALESQEQ  512

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ-TTQEMEMGRMRKD  346
             +T +YS  TSEYGL+PS SSS  Q TTQEM++G+M +D
Sbjct  513  -ATSEYSGLTSEYGLHPSSSSSGFQHTTQEMDLGKMAED  550



>ref|XP_002457091.1| hypothetical protein SORBIDRAFT_03g001090 [Sorghum bicolor]
 gb|EES02211.1| hypothetical protein SORBIDRAFT_03g001090 [Sorghum bicolor]
Length=382

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 117/154 (76%), Gaps = 6/154 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DD+LVDWARPL+ +A EDGN + LVDPRL +++N NEM RMI CAAA VRHS+RRRPRM 
Sbjct  213  DDNLVDWARPLMIKAFEDGNHDALVDPRLGSEYNDNEMARMITCAAACVRHSSRRRPRMG  272

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGS-SYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            QVVRALEGD+SL DLNEG+RPGHS   GS S  +SDYD  QYNED+KKFRKMALG     
Sbjct  273  QVVRALEGDVSLDDLNEGVRPGHSRFMGSHSSSASDYDTNQYNEDLKKFRKMALGGSGLQ  332

Query  456  STGQYSNPTSEYGLNPSGSSSEGQ----TTQEME  367
            S G    PTSEYG NPS SSS+G     TTQE E
Sbjct  333  S-GSAQTPTSEYGQNPSVSSSDGHQATTTTQEAE  365



>ref|XP_009764139.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Nicotiana 
sylvestris]
Length=568

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+DGNF+TL DPRLE +++  EM RM+ CAA  VRH AR RPR
Sbjct  407  YLDDNIVDWARPLLTQALDDGNFDTLADPRLEKNYDSTEMTRMVTCAAVCVRHLARCRPR  466

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++ L DLNEG+RPGHS  Y  SY SSD+D+ QY ED+KKFRKMAL SQ  
Sbjct  467  MSQIVRALEGNLPLDDLNEGLRPGHSGIY-ESYGSSDFDSAQYKEDLKKFRKMALESQAQ  525

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQE  373
             S+ + S PTSE+G +PSGSSSEG +TTQ+
Sbjct  526  NSS-ECSGPTSEFGPHPSGSSSEGLRTTQD  554



>ref|XP_008354402.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Malus 
domestica]
Length=660

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +++DSLV+WARP+L RALE+ NF+ LVDP+L+N ++ NEM RM+ACAAA +RHSARRRPR
Sbjct  491  YVEDSLVEWARPVLTRALEERNFDGLVDPKLQNSYDPNEMARMVACAAACIRHSARRRPR  550

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGI+PG S  Y SSY SSDYD+ QY EDMKKFRKMALGSQEY
Sbjct  551  MSQVVRALEGDVSLSDLNEGIQPGQSNVY-SSYGSSDYDSSQYKEDMKKFRKMALGSQEY  609

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMRKD  346
            G++ +YS PTSEYGL PSGSSS      QTT+EME+GR++K+
Sbjct  610  GASSEYSAPTSEYGLYPSGSSSGEGQSRQTTREMELGRIKKN  651



>ref|XP_009371460.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=659

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +++DSLV+WARP+L RALE+ NF+ LVDP+L+N ++ NEM RM+ACAAA +RHSARRRPR
Sbjct  490  YVEDSLVEWARPVLTRALEERNFDGLVDPKLQNSYDPNEMARMVACAAACIRHSARRRPR  549

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SLSDLNEGI+PG S  Y SSY SSDYD+ QY EDMKKFRKMALGSQEY
Sbjct  550  MSQVVRALEGDVSLSDLNEGIQPGQSNVY-SSYGSSDYDSSQYKEDMKKFRKMALGSQEY  608

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----QTTQEMEMGRMRKD  346
            G++ +YS PTSEYGL PSGSSS      QTT+EME+GR++K+
Sbjct  609  GASSEYSAPTSEYGLYPSGSSSGEGQSRQTTREMELGRIKKN  650



>gb|KHF99092.1| Proline-rich receptor-like protein kinase PERK15 [Gossypium arboreum]
Length=552

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWARPLL +ALE GNF+  VD RL+ D++ +EM RM+ACAAA VRHSAR RPR
Sbjct  389  FFDDSIVDWARPLLSQALEHGNFDAFVDSRLQKDYDSDEMTRMVACAAACVRHSARNRPR  448

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQV+R LEG+M L +LNEGI PGHS  +G S+ESSDY + QY EDMKKFRK+AL SQE 
Sbjct  449  MSQVLRVLEGNMPLDNLNEGITPGHSRVFG-SFESSDYSSAQYKEDMKKFRKIALESQEL  507

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             S+ +YS  TS+YG+NPS SS+EGQ + ++E  +  K+
Sbjct  508  PSS-EYSVVTSDYGVNPSSSSTEGQQSTQIETSKGEKE  544



>gb|KJB18677.1| hypothetical protein B456_003G065300 [Gossypium raimondii]
Length=552

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWARPLL +ALE GNF+  VD RL+ D++ +EM RM+ACAAA VRHSAR RPR
Sbjct  389  FFDDSIVDWARPLLSQALEHGNFDAFVDSRLQKDYDSDEMTRMVACAAACVRHSARNRPR  448

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQV+R LEG+M L +LNEGI PGHS  +G S+ESSDY + QY EDMKKFRK+AL SQE 
Sbjct  449  MSQVLRVLEGNMPLDNLNEGITPGHSRVFG-SFESSDYSSAQYKEDMKKFRKIALESQEL  507

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             S+ +YS  TS+YG+NPS SS+EGQ + ++E  +  K+
Sbjct  508  PSS-EYSVVTSDYGVNPSSSSTEGQQSTQIETSKGEKE  544



>ref|XP_009611770.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Nicotiana 
tomentosiformis]
Length=586

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+D NF+TL DPRLE +++  EM RM+ CAA  VRH ARRRPR
Sbjct  425  YLDDNIVDWARPLLTQALDDDNFDTLADPRLEKNYDSTEMTRMVTCAAVCVRHLARRRPR  484

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++ L DLNEG+RPGHS  Y  SY SSD+D+ QY ED+KKFRKMAL SQ  
Sbjct  485  MSQIVRALEGNLPLDDLNEGLRPGHSGIY-ESYGSSDFDSAQYKEDLKKFRKMALESQAQ  543

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQE  373
             S+ + S PTSE+G +PSGSSSEG +TTQ+
Sbjct  544  NSS-ECSGPTSEFGPHPSGSSSEGLRTTQD  572



>ref|XP_006343065.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
isoform X2 [Solanum tuberosum]
Length=583

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+DGNF+TL DPRL+ +++  EM RM+ CAA  VRH ARRRPR
Sbjct  422  YLDDNIVDWARPLLTQALDDGNFDTLADPRLDKNYDLTEMTRMVTCAAVCVRHLARRRPR  481

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++ L +LN+G+RPGHS  +  SY SSD+DA+QY ED+KKFRKMAL SQ +
Sbjct  482  MSQIVRALEGNLPLDELNDGLRPGHSGIH-ESYGSSDFDAVQYKEDLKKFRKMALESQTH  540

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQ  376
             S+ + S PTSE+G +PSGSSSEG +TTQ
Sbjct  541  NSS-ECSGPTSEFGPHPSGSSSEGLRTTQ  568



>ref|XP_006856033.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Amborella 
trichopoda]
 gb|ERN17500.1| hypothetical protein AMTR_s00059p00070500 [Amborella trichopoda]
Length=674

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 130/158 (82%), Gaps = 3/158 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             M+DSLVDWARPLL RALEDGNF+ LVDP L ++++ +EM R+IAC AA+VRHSARRRPR
Sbjct  517  LMEDSLVDWARPLLTRALEDGNFDELVDPNLGDNYDVDEMARLIACGAATVRHSARRRPR  576

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL DLN+G++PGHS  YG SY SSD ++  Y  D+K+FRK+AL SQE+
Sbjct  577  MSQIVRALEGDSSLDDLNDGVKPGHSRVYG-SYGSSDTESGSYTSDVKRFRKVALASQEF  635

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGR-MRK  349
            GS+ +YS PTSEYGL+PS SSSEG  ++EM+  R +RK
Sbjct  636  GSS-EYSGPTSEYGLHPSSSSSEGPHSREMQPTRPIRK  672



>ref|XP_006343064.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
isoform X1 [Solanum tuberosum]
Length=588

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+DGNF+TL DPRL+ +++  EM RM+ CAA  VRH ARRRPR
Sbjct  427  YLDDNIVDWARPLLTQALDDGNFDTLADPRLDKNYDLTEMTRMVTCAAVCVRHLARRRPR  486

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++ L +LN+G+RPGHS  +  SY SSD+DA+QY ED+KKFRKMAL SQ +
Sbjct  487  MSQIVRALEGNLPLDELNDGLRPGHSGIH-ESYGSSDFDAVQYKEDLKKFRKMALESQTH  545

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQ  376
             S+ + S PTSE+G +PSGSSSEG +TTQ
Sbjct  546  NSS-ECSGPTSEFGPHPSGSSSEGLRTTQ  573



>ref|XP_003565887.2| PREDICTED: proline-rich receptor-like protein kinase PERK1, partial 
[Brachypodium distachyon]
Length=587

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 123/158 (78%), Gaps = 4/158 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPL+ RA EDGN+++LVDP L  +FN NEM RMIACAAA VRHSARRRPRM
Sbjct  417  MDDSLVDWARPLMTRASEDGNYDSLVDPHLGTEFNENEMERMIACAAACVRHSARRRPRM  476

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD+SL DL+EG+RPGHS   G S+ SS+YD  QYNED+KKFRKMALG+   G
Sbjct  477  SQVVRALEGDVSLDDLHEGVRPGHSRFMG-SHTSSEYDTGQYNEDLKKFRKMALGNS--G  533

Query  456  STGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
                   P+SE+G N SG SS+    TQE+EMG  ++D
Sbjct  534  LQSSQLTPSSEHGQNHSGGSSDSHHQTQEIEMGAEKRD  571



>ref|XP_002516042.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46462.1| ATP binding protein, putative [Ricinus communis]
Length=374

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 4/151 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
             DDS+VDWARPLL++ALE G ++ L DP+L+ D++  EM RMIACAAA VRHSAR RPRM
Sbjct  212  FDDSIVDWARPLLNQALESGIYDALADPKLQ-DYDSTEMTRMIACAAACVRHSARLRPRM  270

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ++RALEG+MSL +L++GI PGHS  YG SY S DY + QY ED+K+FRKMAL SQE+ 
Sbjct  271  SQIIRALEGNMSLDELSDGITPGHSTVYG-SYGSIDYSSSQYKEDLKRFRKMALESQEHV  329

Query  456  STGQYSNPTSEYGLNPSGSSSEG-QTTQEME  367
            S+ +YS  TSE+GL PS SS+EG QTTQEME
Sbjct  330  SS-EYSGVTSEFGLQPSSSSTEGQQTTQEME  359



>ref|XP_004235663.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X2 [Solanum lycopersicum]
Length=581

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 122/149 (82%), Gaps = 4/149 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+DGNF+TL DPRL+ +++  EM RM+ CAA  VRH ARRRPR
Sbjct  421  YLDDNIVDWARPLLTQALDDGNFDTLADPRLDKNYDLTEMTRMVTCAAVCVRHLARRRPR  480

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++ L +LN G+RPGHS  +  SY SSD+DA+QY ED+KKFRKMAL SQ +
Sbjct  481  MSQIVRALEGNLPLDELN-GLRPGHSGIH-ESYGSSDFDAVQYKEDLKKFRKMALESQAH  538

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQ  376
             S+ + S PTSE+G +PSGSSSEG +TTQ
Sbjct  539  NSS-ECSGPTSEFGPHPSGSSSEGLRTTQ  566



>ref|XP_004235662.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X1 [Solanum lycopersicum]
Length=586

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 122/149 (82%), Gaps = 4/149 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+DGNF+TL DPRL+ +++  EM RM+ CAA  VRH ARRRPR
Sbjct  426  YLDDNIVDWARPLLTQALDDGNFDTLADPRLDKNYDLTEMTRMVTCAAVCVRHLARRRPR  485

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++ L +LN G+RPGHS  +  SY SSD+DA+QY ED+KKFRKMAL SQ +
Sbjct  486  MSQIVRALEGNLPLDELN-GLRPGHSGIH-ESYGSSDFDAVQYKEDLKKFRKMALESQAH  543

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQ  376
             S+ + S PTSE+G +PSGSSSEG +TTQ
Sbjct  544  NSS-ECSGPTSEFGPHPSGSSSEGLRTTQ  571



>emb|CBI32578.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 121/155 (78%), Gaps = 5/155 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARP+L RALEDGN+  LVDPRLE ++   EM+R+IACAAA +RHSARRRP+M
Sbjct  135  MEDSLVDWARPILLRALEDGNYEELVDPRLEKNYKPQEMVRLIACAAACIRHSARRRPKM  194

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ VRALEGD+SL DLNEG++PG S+ +GS   S+DYD   YN DMKKFR+MAL SQ+Y 
Sbjct  195  SQTVRALEGDVSLDDLNEGVKPGQSSVFGSD-GSTDYDKGSYNADMKKFRRMALSSQDYE  253

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMR  352
            S+ +Y   TS+YG N + SS+ G +   +E+G+ R
Sbjct  254  SSTEYGF-TSDYGNNEASSSASGDS---LELGQRR  284



>emb|CDM82387.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPL+ +ALEDGN + LVDP L  DF+ NEM RMIACAAA VRHSARRRPRM
Sbjct  268  MDDSLVDWARPLMTQALEDGNHDALVDPHLGIDFSDNEMARMIACAAACVRHSARRRPRM  327

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD+SL DL+EG+RPGHS   G S+ SS+YD  QYNED+KKFRKMALG+  + 
Sbjct  328  SQVVRALEGDVSLDDLHEGVRPGHSRFMG-SHASSEYDTSQYNEDLKKFRKMALGTSSFQ  386

Query  456  STGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
            S+    +       +PS  SS+G + TQE+E+G  ++D
Sbjct  387  SSQLTPSSDEHERQDPSVQSSDGHRQTQEVELGTTKRD  424



>emb|CDO98035.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 116/144 (81%), Gaps = 2/144 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +AL+DGNF+TL DPRL  D++  EM RM+ACAAA VRH ARRRPR
Sbjct  402  YLDDNIVDWARPLLTQALDDGNFDTLADPRLRKDYDSTEMARMVACAAACVRHLARRRPR  461

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SL +LNEGI+PGHS  Y  SY SSD+D  QY E++KKFRKMAL  +E 
Sbjct  462  MSQIVRALEGNISLEELNEGIKPGHSTRY-DSYGSSDFDTAQYKEELKKFRKMALEFEEQ  520

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG  388
             +  + S PTS++GL PS SSSEG
Sbjct  521  -NLSECSGPTSDFGLQPSASSSEG  543



>ref|XP_010688207.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Beta 
vulgaris subsp. vulgaris]
Length=717

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 127/180 (71%), Gaps = 24/180 (13%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + DDSLVDWARPLL RALE+ NF TLVD  L+N+FN +EM RM+ACAAA VRHSARRRPR
Sbjct  532  YTDDSLVDWARPLLTRALEENNFETLVDQHLQNNFNPSEMARMVACAAACVRHSARRRPR  591

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++SLSDLNEGIRPG S+ Y S   S    + QY +DMKKFR+MAL S EY
Sbjct  592  MSQVVRALEGEVSLSDLNEGIRPGQSSIYSSYGSSDYDTS-QYKDDMKKFRQMALASTEY  650

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG----------------------QTTQEMEMGRMRKD  346
            GS+ +Y   TSEYG+ PSGSSSE                       QTT+E EMG+M+ D
Sbjct  651  GSS-EYGGTTSEYGMYPSGSSSEAQSRQTTREMKGDSRGFSEGQSRQTTRETEMGKMKGD  709



>dbj|BAJ85456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 122/160 (76%), Gaps = 8/160 (5%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPL+ +ALEDGN + LVDP L  DFN NEM RMIACAAA VRH ARRRPRM
Sbjct  464  MDDSLVDWARPLMTKALEDGNHDALVDPHLGTDFNDNEMARMIACAAACVRHFARRRPRM  523

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD+SL DL+EG+RPGHS   G S+ SS+YD  QYNED+KKFRKMALG+  + 
Sbjct  524  SQVVRALEGDVSLDDLHEGVRPGHSRFMG-SHASSEYDTSQYNEDLKKFRKMALGTSSFQ  582

Query  456  STGQYSNPTSEY---GLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+ Q++  + E+     NP   SS+   TQE+E+G  ++D
Sbjct  583  SS-QHTPSSGEHEHEHQNPPVPSSQ---TQEVELGTTKRD  618



>ref|NP_001169872.1| uncharacterized protein LOC100383766 [Zea mays]
 gb|ACN35130.1| unknown [Zea mays]
Length=207

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DD+LVDWARPL+ +A EDGN + LVDPRL +++N NEM RMIACAAA VRHS+RRRPRM 
Sbjct  46   DDNLVDWARPLMIKAFEDGNHDALVDPRLGSEYNDNEMARMIACAAACVRHSSRRRPRMG  105

Query  633  QVVRALEGDMSLSDLNEGIRPGHS---AAYGSSYESSDYDAMQYNEDMKKFRKMALGSQE  463
            QVVRALEGD+SL DLNEG+RPGHS    +YGSS  +SDYD  QY ED+KKFRKMALG   
Sbjct  106  QVVRALEGDVSLDDLNEGVRPGHSRFVGSYGSS--TSDYDTSQYKEDLKKFRKMALGGSG  163

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
              S+   + PTSE+G NPS S S          G  R+D
Sbjct  164  LQSSSAQT-PTSEHGENPSVSVSSSDGDGGGGTGEERED  201



>ref|XP_010034845.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Eucalyptus 
grandis]
Length=461

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DS+VDWARPLL  ALEDGNF+ +VDP+L  D+   EM RMIACAAA VRHSAR RP 
Sbjct  241  FAEDSMVDWARPLLTLALEDGNFDVIVDPKLNKDYVTEEMTRMIACAAACVRHSARHRPP  300

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG++SL+DLNEGI PGHS  Y S  +S DY+  Q  ED KKF  MAL SQE 
Sbjct  301  MTQVVRALEGNLSLNDLNEGIMPGHSRVY-SRCQSLDYETSQDQEDSKKFGMMALESQEQ  359

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
             +T ++S   SE GL PS SSS G QTTQ+M+MG+M +D
Sbjct  360  -ATSEFSGHNSEDGLQPSNSSSGGQQTTQKMDMGKMAED  397



>ref|XP_009409451.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Musa 
acuminata subsp. malaccensis]
Length=622

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARPLL RALEDGN++ LVDP+L  +FN NEM  MIACAAA +RH ARRRPR
Sbjct  469  FMDDSLVDWARPLLARALEDGNYDALVDPKLGENFNPNEMAHMIACAAACLRHLARRRPR  528

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M Q+VRALEGD+SL DLN+GIRPGHS    SSY+SS  D+ +YNE MKKFRKMAL +QEY
Sbjct  529  MGQIVRALEGDVSLEDLNKGIRPGHS-RLYSSYDSSGSDSGRYNEVMKKFRKMALMAQEY  587

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGR  358
             S+ +Y+ PT     NPS SS E Q TQE EMG+
Sbjct  588  ASS-EYNAPT-----NPSASSGEDQHTQETEMGK  615



>ref|XP_010034847.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Eucalyptus 
grandis]
Length=156

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 114/154 (74%), Gaps = 9/154 (6%)
 Frame = -2

Query  804  LVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmSQVV  625
            +VDWAR      LEDG F+ +VDP+L  D+   EM R IACAAA V HSAR RPRM+QVV
Sbjct  1    MVDWAR------LEDGKFDAIVDPKLHKDYATEEMTRTIACAAACVCHSARHRPRMTQVV  54

Query  624  RALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGSTGQ  445
            RALEG +SLSDLNEGI PGHS AY S + SSD D  QY ED+KKFR MAL SQE  +T +
Sbjct  55   RALEGYLSLSDLNEGIVPGHSIAY-SPHGSSDDDTSQYQEDLKKFRMMALESQEQ-ATSE  112

Query  444  YSNPTSEYGLNPSGSSSE-GQTTQEMEMGRMRKD  346
            YS  TSEYGL+PS SSS   QTTQEM++G+M +D
Sbjct  113  YSGLTSEYGLHPSSSSSGFQQTTQEMDLGKMAED  146



>ref|XP_009105891.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Brassica 
rapa]
Length=664

 Score =   153 bits (387),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + D+SLVDWARPLL RALE+ NF  LVDP+L N+++  EM RM+ACAA  VRHSARRRPR
Sbjct  506  YADNSLVDWARPLLTRALEERNFEGLVDPKLNNEYDREEMARMVACAATCVRHSARRRPR  565

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M QV R LEG++S SDLN+GI+PG S  Y S   S+DYD  + NE + K R+ ALG+QEY
Sbjct  566  MDQVTRVLEGNISPSDLNQGIKPGDSNVYSSYGGSTDYDMSEENEGINKLRRKALGAQEY  625

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
              + +YSNPTSEY L  +G S+EG+TT+EME   +++
Sbjct  626  SESSEYSNPTSEYDLYSTGWSTEGRTTREMETRTIKR  662



>ref|XP_010026169.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Eucalyptus 
grandis]
Length=606

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 116/139 (83%), Gaps = 3/139 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             M+DSLVDWARP+L +A++DGN+N LVDPRLEN+FN +EM RM+ACA+AS+RHSA++RP+
Sbjct  466  VMEDSLVDWARPVLTQAIDDGNYNELVDPRLENNFNPHEMARMVACASASIRHSAKKRPK  525

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRAL+GD SL DLNEG+RPGHS+ +G++  SSDYDA  YN DMK+FRK+AL SQ+Y
Sbjct  526  MSQIVRALDGDASLDDLNEGVRPGHSSVFGTN-SSSDYDAGSYNADMKRFRKVALSSQDY  584

Query  459  GST--GQYSNPTSEYGLNP  409
            GS+  G  S  + E G +P
Sbjct  585  GSSDFGASSGESREMGRSP  603



>ref|XP_004967426.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Setaria italica]
Length=628

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 118/161 (73%), Gaps = 5/161 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+ +A EDGN + LVDPRL +++N NEM RMIACAAA VRHS+RRRPRM
Sbjct  456  MDDNLVDWARPLMTKAFEDGNHDALVDPRLGSEYNDNEMARMIACAAACVRHSSRRRPRM  515

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAM-QYNEDMKKFRKMALGSQEY  460
             QVVRALEGD+SL DLNEG+RPGHS   GS   S+      QY ED+KKFRKM LG    
Sbjct  516  GQVVRALEGDVSLDDLNEGVRPGHSRFMGSYSSSASDYDTNQYKEDLKKFRKMVLGGSGV  575

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ--TTQEMEM-GRMRKD  346
             S G    PTSEYG NPS SS +G   TTQE E+ G +RKD
Sbjct  576  QS-GSQETPTSEYGRNPSASSGDGHQTTTQETEVAGSVRKD  615



>ref|XP_010688206.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Beta 
vulgaris subsp. vulgaris]
Length=625

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 5/153 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            +DDSLVDWARPLL RA E+ NF+TLVD  L+N+FN +EM R++ACAAA +RHSAR RPRM
Sbjct  465  LDDSLVDWARPLLIRAQEENNFDTLVDRHLQNNFNRSEMARLVACAAACIRHSARSRPRM  524

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQV RALEG++SLS LNEGI PG S  Y SSYESSDYD   + +D KKFR+  L S EYG
Sbjct  525  SQVYRALEGEVSLSYLNEGIGPGQSPNY-SSYESSDYDTSHFKDDTKKFRQTVLASTEYG  583

Query  456  STGQYSNPTSEYGLNPSGSSSEG---QTTQEME  367
            S+ +Y   TSEYGLN S SS+E    QTT+EM+
Sbjct  584  SS-EYGGTTSEYGLNLSSSSTEAQSRQTTREMK  615



>ref|NP_001042469.1| Os01g0227200 [Oryza sativa Japonica Group]
 dbj|BAB78668.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAF04383.1| Os01g0227200 [Oryza sativa Japonica Group]
 dbj|BAG95975.1| unnamed protein product [Oryza sativa Japonica Group]
Length=597

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 119/161 (74%), Gaps = 9/161 (6%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPL+ RA +DGN++ LVDPRL  ++N NEM RMIACAAA VRHSARRRPRM
Sbjct  430  MDDSLVDWARPLMMRASDDGNYDALVDPRLGQEYNGNEMARMIACAAACVRHSARRRPRM  489

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD+SL DLNEG+RPGHS   G SY S++YD   YNED+KKFRKMA GS    
Sbjct  490  SQVVRALEGDVSLDDLNEGVRPGHSRFLG-SYNSNEYDTGHYNEDLKKFRKMAFGSGNLE  548

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQ----EMEMGRMRKD  346
            S+ Q + PT      P+ S S G   Q    EMEMG ++KD
Sbjct  549  SS-QQTQPTE---FVPNRSVSMGDARQIPETEMEMGSLKKD  585



>ref|NP_175639.1| proline-rich receptor-like protein kinase PERK15 [Arabidopsis 
thaliana]
 sp|Q9C821.1|PEK15_ARATH RecName: Full=Proline-rich receptor-like protein kinase PERK15; 
AltName: Full=Proline-rich extensin-like receptor kinase 
15; Short=AtPERK15 [Arabidopsis thaliana]
 gb|AAG51550.1|AC037424_15 protein kinase, putative; 60711-62822 [Arabidopsis thaliana]
 gb|AAS49120.1| At1g52290 [Arabidopsis thaliana]
 dbj|BAD95250.1| protein kinase [Arabidopsis thaliana]
 gb|AEE32778.1| proline-rich receptor-like protein kinase PERK15 [Arabidopsis 
thaliana]
Length=509

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 123/159 (77%), Gaps = 5/159 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL DGNF+ LVDPRLENDF+ NEM RM+ACAAASVRHSA+RRP+MS
Sbjct  352  DDSIVDWAKPLMIQALNDGNFDGLVDPRLENDFDINEMTRMVACAAASVRHSAKRRPKMS  411

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++S+ DL EG  PG S  Y S   SSDY + QY ED+KKF+KMA  S+ +GS
Sbjct  412  QIVRAFEGNISIDDLTEGAAPGQSTIY-SLDGSSDYSSTQYKEDLKKFKKMAFESKTFGS  470

Query  453  TGQYSNPTSEYGLNPSGSSS--EGQ-TTQEMEMGRMRKD  346
            + + S  TS+ G NPSGSSS  EGQ TTQE+E  +  KD
Sbjct  471  S-ECSGLTSDNGQNPSGSSSITEGQRTTQEIEPEKNTKD  508



>gb|EAY73106.1| hypothetical protein OsI_00982 [Oryza sativa Indica Group]
Length=597

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 119/161 (74%), Gaps = 9/161 (6%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPL+ RA +DGN++ LVDPRL  ++N NEM RMIACAAA VRHSARRRPRM
Sbjct  430  MDDSLVDWARPLMMRASDDGNYDALVDPRLGQEYNGNEMARMIACAAACVRHSARRRPRM  489

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQVVRALEGD+SL DLNEG+RPGHS   G SY S++YD   YNED+KKFRKMA GS    
Sbjct  490  SQVVRALEGDVSLDDLNEGVRPGHSRFLG-SYNSNEYDTGHYNEDLKKFRKMAFGSGNLE  548

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQ----EMEMGRMRKD  346
            S+ Q + PT      P+ S S G   Q    EMEMG ++KD
Sbjct  549  SS-QQTQPTE---FVPNRSVSMGDARQIPETEMEMGSLKKD  585



>ref|XP_011072361.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Sesamum indicum]
Length=454

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 123/156 (79%), Gaps = 7/156 (4%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +ALE  NF+++ DPRL+ D++  EM RM+ACA+  VRH ARRRPR
Sbjct  300  YLDDNIVDWARPLLTQALESDNFDSVADPRLQKDYDSIEMPRMVACASVCVRHLARRRPR  359

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDA----MQYNEDMKKFRKMALG  472
            MSQ++RALEG++SL +L+EG++PGHSA Y  S+ SSDYDA    +QY ED+ KFRKMAL 
Sbjct  360  MSQIIRALEGNLSLDELSEGVQPGHSAIY-DSHGSSDYDASYDTIQYKEDLIKFRKMALE  418

Query  471  SQEYGSTGQYSNPTSEYGLNPSGSSSEG-QTTQEME  367
            S E  +T + S PTSE+G  PSGSSSEG + TQE++
Sbjct  419  SVEI-TTSECSGPTSEFGHQPSGSSSEGLRNTQEIQ  453



>ref|XP_006369183.1| hypothetical protein POPTR_0001s18340g [Populus trichocarpa]
 gb|ERP65752.1| hypothetical protein POPTR_0001s18340g [Populus trichocarpa]
Length=574

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 120/167 (72%), Gaps = 13/167 (8%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F+DDS+VDWARPLL +ALEDGNF+ +VDP+L+ D++ NEM+RMI CAAA VRH  R RPR
Sbjct  406  FIDDSIVDWARPLLKQALEDGNFDAVVDPKLQ-DYDSNEMIRMICCAAACVRHLGRFRPR  464

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+M L +LNEGI PG S  Y S+  SSDY   QY ED+KKFRK+AL S E+
Sbjct  465  MSQIVRALEGNMPLGELNEGITPGPSMVYSSA--SSDYTNRQYEEDLKKFRKLALESPEH  522

Query  459  ---------GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
                      S+ + + PTSE G NP  SS+EGQ T+  EM   RK+
Sbjct  523  DSRVNPLASTSSQECTEPTSESGRNPFRSSTEGQQTKP-EMDSQRKE  568



>ref|XP_003631608.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Vitis 
vinifera]
Length=664

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 121/155 (78%), Gaps = 5/155 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARP+L RALEDGN+  LVDPRLE ++   EM+R+IACAAA +RHSARRRP+M
Sbjct  510  MEDSLVDWARPILLRALEDGNYEELVDPRLEKNYKPQEMVRLIACAAACIRHSARRRPKM  569

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ VRALEGD+SL DLNEG++PG S+ +GS   S+DYD   YN DMKKFR+MAL SQ+Y 
Sbjct  570  SQTVRALEGDVSLDDLNEGVKPGQSSVFGSD-GSTDYDKGSYNADMKKFRRMALSSQDYE  628

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMR  352
            S+ +Y   TS+YG N + SS+ G +   +E+G+ R
Sbjct  629  SSTEYGF-TSDYGNNEASSSASGDS---LELGQRR  659



>ref|XP_011072360.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Sesamum indicum]
Length=556

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 123/156 (79%), Gaps = 7/156 (4%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD++VDWARPLL +ALE  NF+++ DPRL+ D++  EM RM+ACA+  VRH ARRRPR
Sbjct  402  YLDDNIVDWARPLLTQALESDNFDSVADPRLQKDYDSIEMPRMVACASVCVRHLARRRPR  461

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDA----MQYNEDMKKFRKMALG  472
            MSQ++RALEG++SL +L+EG++PGHSA Y  S+ SSDYDA    +QY ED+ KFRKMAL 
Sbjct  462  MSQIIRALEGNLSLDELSEGVQPGHSAIY-DSHGSSDYDASYDTIQYKEDLIKFRKMALE  520

Query  471  SQEYGSTGQYSNPTSEYGLNPSGSSSEG-QTTQEME  367
            S E  +T + S PTSE+G  PSGSSSEG + TQE++
Sbjct  521  SVEI-TTSECSGPTSEFGHQPSGSSSEGLRNTQEIQ  555



>ref|XP_006392938.1| hypothetical protein EUTSA_v10011404mg [Eutrema salsugineum]
 gb|ESQ30224.1| hypothetical protein EUTSA_v10011404mg [Eutrema salsugineum]
Length=510

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 6/154 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL DGNFN LVDPRLE++F+ +EM  M+ACAAASVRHSA+RRP+MS
Sbjct  348  DDSIVDWAKPLMIQALNDGNFNGLVDPRLEDNFDISEMTSMVACAAASVRHSAKRRPKMS  407

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG+ PGHS  Y S   SSDY + QY ED+KKF++MAL SQ +GS
Sbjct  408  QIVRAFEGNISLDDLTEGVTPGHSTIY-SLDGSSDYSSTQYKEDLKKFKRMALESQTFGS  466

Query  453  TGQYSNPTSEYGLNPSGSSS---EGQ--TTQEME  367
            +      TS+ G NPSGSSS   EGQ  TTQE+E
Sbjct  467  SECSGLTTSDNGQNPSGSSSSITEGQRTTTQEIE  500



>ref|XP_008790437.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK6 [Phoenix dactylifera]
Length=459

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 117/146 (80%), Gaps = 5/146 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RAL D N++ LVDPRLEN++N  EM RMIACAAA VRHSA+RRP+
Sbjct  308  FMEDSLVDWARPLLSRALSDENYDELVDPRLENNYNAIEMQRMIACAAACVRHSAKRRPK  367

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL DLNEG++PG S  + S   SSDY++  Y+ +M++FR++ALGS+E+
Sbjct  368  MSQIVRALEGDTSLEDLNEGVKPGQSTYFNS---SSDYESGSYSANMRQFRRVALGSEEF  424

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQT  382
              + +YS  TSEYGLN S +SS G +
Sbjct  425  --SNEYSGQTSEYGLNASDTSSSGDS  448



>tpg|DAA52780.1| TPA: putative prolin-rich extensin-like receptor protein kinase 
family protein [Zea mays]
Length=374

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DD+LVDWARPL+ +A EDGN + LVDPRL +++N NEM RMIACAAA VRHS+RRRPRM 
Sbjct  213  DDNLVDWARPLMIKAFEDGNHDALVDPRLGSEYNDNEMARMIACAAACVRHSSRRRPRMG  272

Query  633  QVVRALEGDMSLSDLNEGIRPGHS---AAYGSSYESSDYDAMQYNEDMKKFRKMALGSQE  463
            QVVRALEGD+SL DLNEG+RPGHS    +YGSS  +SDYD  QY ED+KKFRKMALG   
Sbjct  273  QVVRALEGDVSLDDLNEGVRPGHSRFVGSYGSS--TSDYDTSQYKEDLKKFRKMALGGSG  330

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
              S+   + PTSE+G NPS S S          G  R+D
Sbjct  331  LQSSSAQT-PTSEHGENPSVSVSSSDGDGGGGTGEERED  368



>ref|XP_011010164.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Populus 
euphratica]
 ref|XP_011010165.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Populus 
euphratica]
Length=444

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 120/167 (72%), Gaps = 13/167 (8%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F+DDS+VDWARPLL +ALEDGNF+ +VDP+L+ D++ NEM++MI CAAA VRH  R RPR
Sbjct  276  FIDDSIVDWARPLLKQALEDGNFDAVVDPKLQ-DYDSNEMIQMICCAAACVRHLGRFRPR  334

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+M L +LNEGI PG S  Y S+  SSDY   QY ED+KKFRK+AL S E+
Sbjct  335  MSQIVRALEGNMPLGELNEGITPGLSMVYSSA--SSDYTIRQYEEDLKKFRKLALESPEH  392

Query  459  ---------GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
                      S+ + + PTSE G NP  SS+EGQ T+  EM   RK+
Sbjct  393  DSRANPLASTSSQECTEPTSESGRNPFRSSTEGQQTKP-EMDSQRKE  438



>gb|EEE62769.1| hypothetical protein OsJ_17572 [Oryza sativa Japonica Group]
Length=396

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             +D      ARPLL +ALE+GN+  LVDPRL  DFN NEM RMIACAAA VRHSARRRPR
Sbjct  228  LLDFKFESKARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPR  287

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEGD+SL DLNEG+RPGHS  Y  SY SSDYD+ QYNEDMKKFRKMA  +   
Sbjct  288  MSQVVRALEGDVSLEDLNEGVRPGHS-RYFGSYSSSDYDSGQYNEDMKKFRKMAF-TNNN  345

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEME  367
             ++ QYS PTSEYG  PS SSSEGQ TQE+E
Sbjct  346  DTSSQYSAPTSEYGQIPSASSSEGQQTQEVE  376



>ref|XP_006645667.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
[Oryza brachyantha]
Length=475

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 112/145 (77%), Gaps = 3/145 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPL+ RA EDGN + LVDPRL  ++N NEM RMIACAAA VRHSARRRPRM
Sbjct  304  MDDSLVDWARPLMTRASEDGNHDALVDPRLGQEYNSNEMARMIACAAACVRHSARRRPRM  363

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGS-SYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            SQVVRALEGD+SL DLNEG+RPGHS   GS S    +YD   YNED+KKFRKMA GS   
Sbjct  364  SQVVRALEGDVSLDDLNEGVRPGHSRFLGSYSSNEYEYDTGHYNEDLKKFRKMAFGSGGL  423

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ  385
             ST Q++ PT+E+G NPS S  +G 
Sbjct  424  EST-QHA-PTNEFGQNPSVSVGDGH  446



>gb|KDO56892.1| hypothetical protein CISIN_1g007892mg [Citrus sinensis]
Length=579

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWA+P L + L DGNF+ LVD +LE +++  EM RM ACAAA +RHSARRRPR
Sbjct  410  FADDSMVDWAKPFLAQGLADGNFDALVDQKLE-EYDSAEMTRMAACAAACIRHSARRRPR  468

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+M L DLNEGI PGHS  YG SY  SDY++MQY EDMKKFRK+AL S E 
Sbjct  469  MSQIVRALEGNMPLDDLNEGITPGHSTIYG-SYGGSDYNSMQYREDMKKFRKIALESVEL  527

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEME  367
            GS+  YS  TS+YG NP  SS+E  Q TQE E
Sbjct  528  GSS-DYSGLTSDYGQNPPSSSTEDRQATQETE  558



>ref|XP_006426969.1| hypothetical protein CICLE_v10025247mg [Citrus clementina]
 gb|ESR40209.1| hypothetical protein CICLE_v10025247mg [Citrus clementina]
Length=578

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWA+P L + L DGNF+ LVD +LE +++  EM RM ACAAA +RHSARRRPR
Sbjct  410  FADDSMVDWAKPFLAQGLADGNFDALVDQKLE-EYDSAEMTRMAACAAACIRHSARRRPR  468

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+M L DLNEGI PGHS  YG SY  SDY++MQY EDMKKFRK+AL S E 
Sbjct  469  MSQIVRALEGNMPLDDLNEGITPGHSTIYG-SYGGSDYNSMQYREDMKKFRKIALESVEL  527

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEME  367
            GS+  YS  TS+YG NP  SS+E  Q TQE E
Sbjct  528  GSS-DYSGLTSDYGQNPPSSSTEDRQATQETE  558



>gb|KDO56891.1| hypothetical protein CISIN_1g007892mg [Citrus sinensis]
Length=586

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWA+P L + L DGNF+ LVD +LE +++  EM RM ACAAA +RHSARRRPR
Sbjct  417  FADDSMVDWAKPFLAQGLADGNFDALVDQKLE-EYDSAEMTRMAACAAACIRHSARRRPR  475

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+M L DLNEGI PGHS  YG SY  SDY++MQY EDMKKFRK+AL S E 
Sbjct  476  MSQIVRALEGNMPLDDLNEGITPGHSTIYG-SYGGSDYNSMQYREDMKKFRKIALESVEL  534

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEME  367
            GS+  YS  TS+YG NP  SS+E  Q TQE E
Sbjct  535  GSS-DYSGLTSDYGQNPPSSSTEDRQATQETE  565



>ref|XP_002894371.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70630.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDSLVDWA+PL+ + L  GNF+ LVDPRLENDF+ NEM RM+ACAAASVRHSA+RRP+MS
Sbjct  365  DDSLVDWAKPLMIQVLNGGNFDGLVDPRLENDFDINEMTRMVACAAASVRHSAKRRPKMS  424

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++S+ DL EG  PGHS  Y S   SSDY + QY ED+KKF+KMAL SQ +GS
Sbjct  425  QIVRAFEGNISIDDLTEGAAPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMALESQTFGS  483

Query  453  TGQYSNPTSEYGLNPSGSSS--EGQ-TTQEME  367
            + + S  TS+ G NPS SSS  EGQ TTQE+E
Sbjct  484  S-ECSGLTSDNGQNPSVSSSITEGQRTTQEIE  514



>ref|XP_012073359.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Jatropha 
curcas]
 gb|KDP37232.1| hypothetical protein JCGZ_06288 [Jatropha curcas]
Length=567

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 123/152 (81%), Gaps = 4/152 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
             DDS+VDWARPLL +ALE+G ++ LVDP+L+ D++  EM RM++CA A +RHSAR RPRM
Sbjct  406  FDDSIVDWARPLLKQALEEGIYDALVDPKLQ-DYDSTEMTRMMSCAKACIRHSARLRPRM  464

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG+MSL DL++GI PG+S  Y  SY SSDY++ QY +D+KKFRK+AL SQE  
Sbjct  465  SQIVRALEGNMSLDDLSDGITPGNSMIY-ESYGSSDYNSSQYTKDLKKFRKIALESQEVA  523

Query  456  STGQYSNPTSEYGLNPSGSSSEG-QTTQEMEM  364
            S+ +YS  TSEYGL+ S +S+EG QTTQ++E+
Sbjct  524  SS-EYSGVTSEYGLHHSSTSTEGQQTTQDVEL  554



>ref|XP_010466843.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Camelina 
sativa]
Length=680

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 115/155 (74%), Gaps = 5/155 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GNF  +VD +L N+++  EM RM+ACAAA VR +ARRRPRM 
Sbjct  525  DNSLVDWARPLLNQVSEVGNFEAVVDTKLNNEYDREEMARMVACAAACVRSTARRRPRMD  584

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QV R LEG++S SDLN+GI PGHS  YGSS  S+DYD+ Q NE + KFRK+ L +Q+   
Sbjct  585  QVARVLEGNISPSDLNQGITPGHSNVYGSSGGSTDYDSSQDNEGVNKFRKVGLETQDL--  642

Query  453  TGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
               YSNP SEY L PS SS+E QTT+EMEMG  ++
Sbjct  643  ---YSNPISEYDLYPSWSSTEIQTTREMEMGNAKR  674



>ref|XP_010041514.1| PREDICTED: proline-rich receptor-like protein kinase PERK1, partial 
[Eucalyptus grandis]
Length=205

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL +ALE   F+ +VDP+L  D++  E+ RMIACAAA V HSA+ RP 
Sbjct  41   FDEDSLVDWARPLLTQALEGDKFDAIVDPKLNKDYDTEELTRMIACAAACVHHSAQHRPP  100

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG++SLSDL EGI PGHS  Y    ESS+Y   +  ED    R MAL SQE 
Sbjct  101  MTQVVRALEGNLSLSDLKEGIMPGHSRVYKRC-ESSEYGTNKDQEDSTILRMMALESQEQ  159

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
             +T ++S P SEY L P  SSS G QT+QEM+MG+M +D
Sbjct  160  -ATSEFSCPYSEYDLQPYNSSSGGQQTSQEMDMGKMAED  197



>ref|XP_008673227.1| PREDICTED: uncharacterized protein LOC100383766 isoform X1 [Zea 
mays]
Length=611

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DD+LVDWARPL+ +A EDGN + LVDPRL +++N NEM RMIACAAA VRHS+RRRPRM 
Sbjct  450  DDNLVDWARPLMIKAFEDGNHDALVDPRLGSEYNDNEMARMIACAAACVRHSSRRRPRMG  509

Query  633  QVVRALEGDMSLSDLNEGIRPGHS---AAYGSSYESSDYDAMQYNEDMKKFRKMALGSQE  463
            QVVRALEGD+SL DLNEG+RPGHS    +YGSS  +SDYD  QY ED+KKFRKMALG   
Sbjct  510  QVVRALEGDVSLDDLNEGVRPGHSRFVGSYGSS--TSDYDTSQYKEDLKKFRKMALGGSG  567

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
              S+   + PTSE+G NPS S S          G  R+D
Sbjct  568  LQSSSAQT-PTSEHGENPSVSVSSSDGDGGGGTGEERED  605



>gb|KCW82422.1| hypothetical protein EUGRSUZ_C03822 [Eucalyptus grandis]
Length=447

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDSLVDWARP L RALEDGNF++LVDP L+N++NHNEM RM+ACAAA VRHSARRRPR
Sbjct  286  FMDDSLVDWARPQLTRALEDGNFDSLVDPSLQNNYNHNEMARMVACAAACVRHSARRRPR  345

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALG  472
            MSQ+VRALEGD+SLSDLNEGIRPGHS    SSY SSDYD  QYNED+KKFRKMAL 
Sbjct  346  MSQIVRALEGDVSLSDLNEGIRPGHSGL-YSSYGSSDYDTSQYNEDLKKFRKMALA  400



>ref|XP_002888452.1| hypothetical protein ARALYDRAFT_475678 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64711.1| hypothetical protein ARALYDRAFT_475678, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=621

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 116/157 (74%), Gaps = 14/157 (9%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DDSLVDWARPLL+RA E+G+F+ L D ++ N+++  EM RM+AC AA VRHSARRRPR
Sbjct  469  YVDDSLVDWARPLLNRASEEGDFDGLADSKMGNEYDKEEMARMVACTAACVRHSARRRPR  528

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG++SLSDLNEG+RPGHS  Y S   S+DYD  QYN+DMKKFRKMALG+Q  
Sbjct  529  MSQIVRALEGNVSLSDLNEGMRPGHSNVYSSYGGSTDYDTSQYNDDMKKFRKMALGTQRV  588

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
                +                SEGQ T+EMEMG++++
Sbjct  589  RHNRRI--------------HSEGQATREMEMGKIKR  611



>ref|XP_007046970.1| Roline-rich extensin-like receptor kinase 4 [Theobroma cacao]
 gb|EOX91127.1| Roline-rich extensin-like receptor kinase 4 [Theobroma cacao]
Length=587

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPLL RALEDGN + L DPRLE ++NH+EM RM+ACAAAS+RHSA++RP+M
Sbjct  449  MEDSLVDWARPLLARALEDGNHDELADPRLELNYNHHEMQRMVACAAASIRHSAKKRPKM  508

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGD SL DLNEGI+PGHSA Y SS  SS+Y A  YN DMKKFR++AL SQE+G
Sbjct  509  SQIVRALEGDSSLDDLNEGIKPGHSAVY-SSGVSSEYSASSYNADMKKFRQLALSSQEFG  567

Query  456  ST  451
             +
Sbjct  568  GS  569



>ref|XP_010545704.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Tarenaya 
hassleriana]
Length=578

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 122/158 (77%), Gaps = 3/158 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWA+PL+ + L DGNF+ LVDP+LE +++ +EM RM+ACAAASVRHSA+RRP+
Sbjct  418  FADDSIVDWAKPLMMQVLSDGNFDVLVDPKLERNYDTSEMTRMVACAAASVRHSAKRRPK  477

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+MS+ DL EG  PGHS  Y S   S DY + QY ED++KF+KMAL SQ +
Sbjct  478  MSQIVRALEGNMSIDDLTEGSAPGHSTIY-SMDGSEDYSSAQYKEDLQKFKKMALESQTF  536

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRK  349
            GS+ ++S  TS+ G NPS SS+EG + T+E+E  R  K
Sbjct  537  GSS-EFSGVTSDNGQNPSASSTEGPRNTRELEPERSEK  573



>ref|XP_002299708.2| hypothetical protein POPTR_0001s18340g [Populus trichocarpa]
 gb|EEE84513.2| hypothetical protein POPTR_0001s18340g [Populus trichocarpa]
Length=575

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 115/168 (68%), Gaps = 14/168 (8%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhs-arrrp  643
            F+DDS+VDWARPLL +ALEDGNF+ +VDP+L+ D++ NEM+RMI CAAA VRH    R  
Sbjct  406  FIDDSIVDWARPLLKQALEDGNFDAVVDPKLQ-DYDSNEMIRMICCAAACVRHLGRFRPR  464

Query  642  rmSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQE  463
               Q+VRALEG+M L +LNEGI PG S  Y S+  SSDY   QY ED+KKFRK+AL S E
Sbjct  465  MSQQIVRALEGNMPLGELNEGITPGPSMVYSSA--SSDYTNRQYEEDLKKFRKLALESPE  522

Query  462  Y---------GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            +          S+ + + PTSE G NP  SS+EGQ T+  EM   RK+
Sbjct  523  HDSRVNPLASTSSQECTEPTSESGRNPFRSSTEGQQTKP-EMDSQRKE  569



>emb|CDY47531.1| BnaC03g69310D [Brassica napus]
Length=517

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL D NF+ LVDPRLE +F+ +EM R++ACAAASVRHSA+ RP+MS
Sbjct  357  DDSIVDWAKPLMIQALNDSNFDGLVDPRLEGNFDISEMTRVVACAAASVRHSAKLRPKMS  416

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG+ PGHS  Y S   SSDY + QY ED+KKF+KMAL SQ +GS
Sbjct  417  QIVRAFEGNLSLDDLTEGVTPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMALESQTFGS  475

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            +      TS+ G NPSGSSS  EG +TTQE+E
Sbjct  476  SECSGLTTSDNGQNPSGSSSITEGLRTTQEIE  507



>ref|XP_009346006.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=568

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 124/159 (78%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+V+WARPLL +ALE GNF+ LVD RL+ND+N +EM  M+ACAAA VRHS RRRPR
Sbjct  408  FTDDSMVEWARPLLAKALETGNFDALVDVRLQNDYNTSEMACMLACAAACVRHSGRRRPR  467

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQVVRALEG++S  +LNEGI PG S  +  SY SS+Y+A +Y ED+ KFRK+AL SQE 
Sbjct  468  MSQVVRALEGNLSPDELNEGIIPGQSTVF--SYGSSEYNASEYKEDLNKFRKLALESQEQ  525

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
            G T + S P+S++ L  S SS EG QTT+EME+G+ +KD
Sbjct  526  G-TSENSGPSSDFDLLQSTSSGEGQQTTREMELGKTKKD  563



>ref|XP_008338542.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Malus 
domestica]
Length=661

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL RALED N+  LVD RL+N++N NEM RM+ACAAAS+RHSAR+R +M
Sbjct  523  MDDSLVDWARPLLTRALEDNNYAELVDIRLDNNYNPNEMARMVACAAASIRHSARKRAKM  582

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGD+SL DLNEG +PG S+ + +S  SSDYD   YN DMKKFRK+AL SQE+G
Sbjct  583  SQIVRALEGDVSLDDLNEGTKPGKSSMFNASGGSSDYDTQAYNADMKKFRKLALSSQEFG  642

Query  456  ST  451
            S+
Sbjct  643  SS  644



>ref|XP_006307254.1| hypothetical protein CARUB_v10008870mg [Capsella rubella]
 gb|EOA40152.1| hypothetical protein CARUB_v10008870mg [Capsella rubella]
Length=517

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL DG+F+ LVDPRLE+ F+ +EM RM+ACAAASVRHSA+RRP++S
Sbjct  357  DDSIVDWAKPLMIQALNDGSFDGLVDPRLEHGFDVSEMTRMVACAAASVRHSAKRRPKIS  416

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG  PGHS  Y S   SSDY + QY ED+KKF+KMA  SQ +G 
Sbjct  417  QIVRAFEGNISLDDLTEGSAPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMAYESQTFGG  475

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            + + S  TS+ G NPSGSSS  EG +TTQE+E
Sbjct  476  SSECSGLTSDNGQNPSGSSSITEGHRTTQEIE  507



>dbj|BAB02941.1| somatic embryogenesis receptor kinase-like protein [Arabidopsis 
thaliana]
Length=458

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 112/155 (72%), Gaps = 5/155 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GNF  +VD +L N+++  EM RM+ACAAA VR +A RRPRM 
Sbjct  303  DNSLVDWARPLLNQVSELGNFEVVVDKKLNNEYDKEEMARMVACAAACVRSTAPRRPRMD  362

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QV R LEG++S SDLN+GI PGHS  YGSS  S+DYD+ Q NE M KFRK+ L +Q+   
Sbjct  363  QVARVLEGNISPSDLNQGITPGHSNVYGSSGGSTDYDSSQDNEGMNKFRKVGLETQDL--  420

Query  453  TGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
               YSNP SEY L PS SS++GQTTQ    G +++
Sbjct  421  ---YSNPISEYDLYPSWSSTDGQTTQGKATGNIKR  452



>ref|XP_009356695.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Pyrus 
x bretschneideri]
Length=658

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL RALED N+  LVD RL+N++N NEM RM+ACAAAS+RHSAR+R +M
Sbjct  520  MDDSLVDWARPLLTRALEDNNYAELVDIRLDNNYNPNEMARMVACAAASIRHSARKRAKM  579

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGD+SL DLNEG +PG S+ + +S  SSDYD   YN DMKKFRK+AL SQE+G
Sbjct  580  SQIVRALEGDVSLDDLNEGTKPGKSSMFNASGGSSDYDTQAYNADMKKFRKLALTSQEFG  639

Query  456  ST  451
            S+
Sbjct  640  SS  641



>ref|NP_195170.2| proline-rich receptor-like protein kinase PERK5 [Arabidopsis 
thaliana]
 sp|Q8GX23.1|PERK5_ARATH RecName: Full=Proline-rich receptor-like protein kinase PERK5; 
AltName: Full=Proline-rich extensin-like receptor kinase 5; 
Short=AtPERK5 [Arabidopsis thaliana]
 dbj|BAC43092.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAO64890.1| At4g34440 [Arabidopsis thaliana]
 gb|AEE86377.1| proline-rich receptor-like protein kinase PERK5 [Arabidopsis 
thaliana]
Length=670

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 119/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL  +A +DG++N L DPRLE +++H EM++M +CAAA++RHSARRRP+M
Sbjct  518  MEDSLVDWARPLCLKAAQDGDYNQLADPRLELNYSHQEMVQMASCAAAAIRHSARRRPKM  577

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGDMS+ DL+EG RPG S        SS+YDA  Y  DMKKF+K+AL ++EY 
Sbjct  578  SQIVRALEGDMSMDDLSEGTRPGQSTYLSPGSVSSEYDASSYTADMKKFKKLALENKEYQ  637

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+ +Y   TSEYGLNPS SSSE     EM  G M+++
Sbjct  638  SS-EYGG-TSEYGLNPSASSSE-----EMNRGSMKRN  667



>ref|XP_002869145.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45404.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 120/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL  +A +DG+++ L DPRLE ++NH EM++M +CAAA++RHSARRRP+M
Sbjct  517  MEDSLVDWARPLCLKAAQDGDYSQLADPRLELNYNHQEMVQMASCAAAAIRHSARRRPKM  576

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGDMS+ DL+EG RPG S        SS+YDA  Y+ DMKKF+K+AL ++EY 
Sbjct  577  SQIVRALEGDMSMEDLSEGTRPGQSTYLSPGSVSSEYDASSYSADMKKFKKLALENKEYQ  636

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+ +Y   TSEYGLNPS SSSE     EM  G M+++
Sbjct  637  SS-EYGG-TSEYGLNPSASSSE-----EMNRGSMKRN  666



>ref|XP_006409147.1| hypothetical protein EUTSA_v10022596mg [Eutrema salsugineum]
 gb|ESQ50600.1| hypothetical protein EUTSA_v10022596mg [Eutrema salsugineum]
Length=630

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 3/136 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARP++ RALEDGNFN L DPRLE +++  EM RM+ CAAAS+RHS R+RP+M
Sbjct  486  MDDTLVDWARPIMARALEDGNFNELADPRLEGNYSPQEMARMVTCAAASIRHSGRKRPKM  545

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL  LNEG++PGHS  YG+S  SSDY    YN DMKKFR++AL SQE+ 
Sbjct  546  SQIVRALEGEVSLDALNEGVKPGHSNIYGTSGTSSDYSQTSYNADMKKFRQIALSSQEFQ  605

Query  456  ST---GQYSNPTSEYG  418
            S+   G  SN + E G
Sbjct  606  SSECEGSSSNDSREIG  621



>ref|XP_010034739.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Eucalyptus 
grandis]
Length=425

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = -2

Query  804  LVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmSQVV  625
            L   A+PLL +ALEDG F+ LVDP+L  D++  EM +MIAC AA VRHSAR RPRM+QV+
Sbjct  266  LAYLAKPLLTQALEDGKFDALVDPKLHKDYDTKEMTQMIACGAACVRHSARLRPRMTQVL  325

Query  624  RALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGSTGQ  445
            RALEG++SLSDLNEGI PGHS AY S Y SSDYD  +Y ED+KK R MAL SQE  +T +
Sbjct  326  RALEGNLSLSDLNEGIVPGHSRAY-SPYGSSDYDTSRYQEDLKKLRMMALESQEQ-ATSE  383

Query  444  YSNPTSEYGLNPSGSSSE-GQTTQEMEMGRMRKD  346
            +S  TSE GL+ S SSS   QTTQEM++G+M +D
Sbjct  384  FSGLTSECGLHASSSSSGFQQTTQEMDLGKMAED  417



>ref|XP_010113486.1| Proline-rich receptor-like protein kinase PERK4 [Morus notabilis]
 gb|EXC35513.1| Proline-rich receptor-like protein kinase PERK4 [Morus notabilis]
Length=626

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            +DDSLVDWARPL  RALEDG ++ LVDPRLEN++N  EM RM+A AAAS+RHSAR+RP+M
Sbjct  487  IDDSLVDWARPLFQRALEDGIYDELVDPRLENNYNPREMARMVASAAASIRHSARKRPKM  546

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGD+SL DLNEG+RPG S  Y SS  SSDYDA  Y+ DMKKFRKMAL SQE+ 
Sbjct  547  SQIVRALEGDVSLDDLNEGVRPGQSTIYTSS-GSSDYDANAYDADMKKFRKMALTSQEFV  605

Query  456  ST--GQYSNPTSE  424
            S+  G  SN + E
Sbjct  606  SSDFGTSSNDSRE  618



>ref|XP_010490110.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Camelina 
sativa]
Length=851

 Score =   146 bits (369),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 5/155 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GNF  +VD +L N+++  EM RM+ACAAA VR +ARRRPRM 
Sbjct  696  DNSLVDWARPLLNQVSEVGNFEAVVDTKLNNEYDREEMARMVACAAACVRSTARRRPRMD  755

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QV R LEG++S SDLN+GI PGHS  YGSS  S+DYD+ Q N+ + KFRK+ L +Q+   
Sbjct  756  QVARVLEGNISPSDLNQGITPGHSNVYGSSGGSTDYDSSQDNKGVNKFRKVGLETQDL--  813

Query  453  TGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
               YSNP SEY L PS SS+E QTT+EMEMG  ++
Sbjct  814  ---YSNPISEYDLYPSWSSTEIQTTREMEMGNAKR  845



>ref|XP_010936290.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X2 [Elaeis guineensis]
Length=650

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             M+DSLVDWARPLL RAL D N+  LVDPRLEN++N  EM RMIACAAA VRHSA++RP+
Sbjct  499  LMEDSLVDWARPLLSRALSDENYEELVDPRLENNYNATEMQRMIACAAACVRHSAKKRPK  558

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD +L DLNEG++PG S  + S   SSD+++  Y+  M++FR+ ALGS+E+
Sbjct  559  MSQIVRALEGDTALEDLNEGVKPGQSTYFNS---SSDFESGSYSAKMRRFRRTALGSEEF  615

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG  388
              + +YS  TSEYGLN S SSS G
Sbjct  616  --SNEYSGQTSEYGLNASDSSSSG  637



>ref|XP_008228537.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Prunus 
mume]
Length=575

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 125/160 (78%), Gaps = 5/160 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+V+WARPLL +ALE GNF+ +VD RL+ND+N  EM  M+ACAAA VRHS RRRPR
Sbjct  409  FTDDSMVEWARPLLAQALETGNFDAIVDVRLQNDYNTGEMACMLACAAACVRHSGRRRPR  468

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGS--Q  466
            MSQVVRALEG++S  +LNEG+ PGHS  Y SSY SSDY+  +Y ED++KFRK+AL S  Q
Sbjct  469  MSQVVRALEGNLSPDELNEGVIPGHSTIY-SSYGSSDYNTGEYKEDLQKFRKLALESQEQ  527

Query  465  EYGSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRK  349
            E G++G  S P+SE+  + S SS EG QT+QE+E+G+ +K
Sbjct  528  EQGTSG-ISGPSSEFDQHQSASSGEGQQTSQEIELGKTKK  566



>gb|EYU21456.1| hypothetical protein MIMGU_mgv1a004031mg [Erythranthe guttata]
Length=548

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            ++DD+++DWARPLL +ALE  NF+ + DPRL  D++  EM RM+ACA+  VRH ARRRP 
Sbjct  394  YLDDNIIDWARPLLTQALESDNFDGVADPRLLKDYDSIEMARMVACASVCVRHLARRRPP  453

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSD----YDAMQYNEDMKKFRKMALG  472
            MSQ++RALEG+++L +LNEG++PGHS  Y SS+ SSD    YD  QY ED+ KFRKMAL 
Sbjct  454  MSQIIRALEGNLNLEELNEGLKPGHSRKYDSSHGSSDFDISYDTTQYREDLIKFRKMALE  513

Query  471  SQEYGSTGQYSNPTSEYGLNPSGSSSE  391
            S E+ +T ++S PTS++G  PSGSSSE
Sbjct  514  SVEH-TTSEFSGPTSDFGRRPSGSSSE  539



>ref|XP_010936289.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Elaeis guineensis]
Length=695

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             M+DSLVDWARPLL RAL D N+  LVDPRLEN++N  EM RMIACAAA VRHSA++RP+
Sbjct  544  LMEDSLVDWARPLLSRALSDENYEELVDPRLENNYNATEMQRMIACAAACVRHSAKKRPK  603

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD +L DLNEG++PG S  + S   SSD+++  Y+  M++FR+ ALGS+E+
Sbjct  604  MSQIVRALEGDTALEDLNEGVKPGQSTYFNS---SSDFESGSYSAKMRRFRRTALGSEEF  660

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG  388
              + +YS  TSEYGLN S SSS G
Sbjct  661  --SNEYSGQTSEYGLNASDSSSSG  682



>ref|XP_006418751.1| hypothetical protein EUTSA_v10002411mg [Eutrema salsugineum]
 gb|ESQ37187.1| hypothetical protein EUTSA_v10002411mg [Eutrema salsugineum]
Length=760

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 123/162 (76%), Gaps = 5/162 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + D+SLVDWARPLL +ALE+ NF  LVD +L N+++  EM RM+ACAAA VRH+ARRRPR
Sbjct  583  YADNSLVDWARPLLMQALEESNFEGLVDTKLNNEYDREEMARMVACAAACVRHTARRRPR  642

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMA-LGSQ-  466
            M QV R LEG++S SDLN+GIRPG S  Y S   S+DYD+ Q N+ M KFRKM+ LG+Q 
Sbjct  643  MDQVARVLEGNISPSDLNQGIRPGDSNVYSSYGGSTDYDSSQDNDGMNKFRKMSTLGTQE  702

Query  465  EYGSTGQYSNPTSEYGLNPSGSSSEG---QTTQEMEMGRMRK  349
            E+G++ +YSN TSEY L  +G S+EG   QTT+EME G +++
Sbjct  703  EFGASSEYSNATSEYDLYSTGWSTEGQSRQTTREMETGNVKR  744



>ref|XP_010513421.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Camelina 
sativa]
Length=679

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 114/155 (74%), Gaps = 5/155 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GNF  +VD +L N+++  EM RM+ACAAA VR +ARRRPRM 
Sbjct  524  DNSLVDWARPLLNQVSEVGNFEAVVDTKLNNEYDREEMARMVACAAACVRSTARRRPRMD  583

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QV R LEG++S SDLN+GI PG+S  YGSS   +DYD+ Q NE + KFRKM L +Q+   
Sbjct  584  QVARVLEGNISPSDLNQGITPGNSNVYGSSGGRTDYDSSQDNEGVNKFRKMGLETQDL--  641

Query  453  TGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
               YSNP SEY L PS SS+E QTT+EMEMG  ++
Sbjct  642  ---YSNPISEYDLYPSWSSTEIQTTREMEMGNAKR  673



>ref|XP_007215322.1| hypothetical protein PRUPE_ppa003567mg [Prunus persica]
 gb|EMJ16521.1| hypothetical protein PRUPE_ppa003567mg [Prunus persica]
Length=565

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 126/161 (78%), Gaps = 5/161 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+V+WARP+L +ALE GNF+ +VD RL+ND+N  EM  M+ACAAA VRHS RRRPR
Sbjct  399  FTDDSMVEWARPMLAQALETGNFDAIVDVRLQNDYNTGEMACMLACAAACVRHSGRRRPR  458

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGS--Q  466
            MSQVVRALEG++S  +LNEG+ PGHS  Y SSY SSDY+  +Y ED++KFRK+AL S  Q
Sbjct  459  MSQVVRALEGNLSPDELNEGVIPGHSTIY-SSYGSSDYNTSEYKEDLQKFRKLALESQEQ  517

Query  465  EYGSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
            E G++G  S P+SE+  + S SS EG QT+QE+E+G+ +K+
Sbjct  518  EQGTSG-ISGPSSEFDQHQSASSGEGQQTSQEIELGKTKKN  557



>emb|CDY02546.1| BnaA08g01530D [Brassica napus]
Length=513

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL D NF  LVDPRLE +F+ +EM R++ACAAASVRHSA+RRP+MS
Sbjct  357  DDSIVDWAKPLMIQALNDSNFYGLVDPRLEGNFDISEMSRVVACAAASVRHSAKRRPKMS  416

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG+ PGHS  Y S   SSDY + QY ED+KKF+KMAL SQ +GS
Sbjct  417  QIVRAFEGNISLDDLTEGVTPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMALESQTFGS  475

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            +      TS+ G NPSGSSS  EG +TTQE+E
Sbjct  476  SECSGLTTSDNGQNPSGSSSITEGLRTTQEIE  507



>sp|Q9LK03.3|PERK2_ARATH RecName: Full=Proline-rich receptor-like protein kinase PERK2; 
AltName: Full=Proline-rich extensin-like receptor kinase 2; 
Short=AtPERK2; AltName: Full=Somatic embryogenesis receptor 
kinase-like protein [Arabidopsis thaliana]
Length=717

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 112/155 (72%), Gaps = 5/155 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GNF  +VD +L N+++  EM RM+ACAAA VR +A RRPRM 
Sbjct  562  DNSLVDWARPLLNQVSELGNFEVVVDKKLNNEYDKEEMARMVACAAACVRSTAPRRPRMD  621

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QV R LEG++S SDLN+GI PGHS  YGSS  S+DYD+ Q NE M KFRK+ L +Q+   
Sbjct  622  QVARVLEGNISPSDLNQGITPGHSNVYGSSGGSTDYDSSQDNEGMNKFRKVGLETQDL--  679

Query  453  TGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRK  349
               YSNP SEY L PS SS++GQTTQ    G +++
Sbjct  680  ---YSNPISEYDLYPSWSSTDGQTTQGKATGNIKR  711



>ref|XP_009107140.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Brassica 
rapa]
Length=517

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL D NF  LV+PRLE +F+ +EM R++ACAAASVRHSA+RRP+MS
Sbjct  357  DDSIVDWAKPLMIQALNDSNFYGLVEPRLEGNFDISEMTRVVACAAASVRHSAKRRPKMS  416

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG+ PGHS  Y S   SSDY + QY ED+KKF+KMAL SQ +GS
Sbjct  417  QIVRAFEGNISLDDLTEGVTPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMALESQTFGS  475

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            +      TS+ G NPSGSSS  EG +TTQE+E
Sbjct  476  SECSGLTTSDNGQNPSGSSSITEGLRTTQEIE  507



>ref|XP_002886173.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62432.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+ RALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  497  MDDTLVDWARPLMARALEDGNFNELADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  556

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL  LNEG++PGHS  YG+S  SSDY    YN DMKKFR++AL SQE+ 
Sbjct  557  SQIVRALEGEVSLDALNEGVKPGHSNVYGTSGTSSDYSQTSYNADMKKFRQIALSSQEFP  616

Query  456  ST---GQYSNPTSEYG  418
             +   G  SN + E G
Sbjct  617  ISDCEGTSSNDSREMG  632



>ref|XP_010479734.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Camelina 
sativa]
Length=514

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DD +VDWA+PL+ +AL DG+F+ LVDPRLE+ F+ +EM RM+ACAAASVRHSA+RRP+MS
Sbjct  356  DDCIVDWAKPLMIQALNDGSFDGLVDPRLEDKFDISEMTRMVACAAASVRHSAKRRPKMS  415

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG  PGHS  Y S   SSDY + QY ED+KKF+KMA  SQ +GS
Sbjct  416  QIVRAFEGNISLDDLTEGSAPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMAYESQTFGS  474

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            + + S  TS+ G NPSGSSS  EG +TTQE+E
Sbjct  475  S-ECSGLTSDNGQNPSGSSSITEGNRTTQEIE  505



>ref|XP_002509476.1| somatic embryogenesis receptor kinase, putative [Ricinus communis]
 gb|EEF50863.1| somatic embryogenesis receptor kinase, putative [Ricinus communis]
Length=482

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MD+SLVDWARP+   ALE+G+F+ L DPRLE +++  EM RM+ACA A+VRHSARRR +M
Sbjct  328  MDESLVDWARPICASALENGDFSELADPRLEGNYDPAEMARMVACAGAAVRHSARRRAKM  387

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMAL-GSQEY  460
            SQ+VRALEGD+SL  LNEG++PG S  + S+  SSD D   Y+ DM+KFRK+ +  SQEY
Sbjct  388  SQIVRALEGDVSLEHLNEGVKPGQSTVFSSTSGSSDNDTTSYSADMRKFRKVVMDNSQEY  447

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEM  370
             S+ +Y + TSEYGLNPS SSSE  T   M
Sbjct  448  ESS-EYGH-TSEYGLNPSSSSSEATTKSGM  475



>ref|XP_008380925.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Malus 
domestica]
Length=538

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 121/159 (76%), Gaps = 5/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+V+WARPLL +ALE GNF+ LVD RL+ND+N +EM  M++CAAA VRHSARRRPR
Sbjct  379  FTDDSMVEWARPLLAQALETGNFDALVDVRLQNDYNTSEMACMLSCAAACVRHSARRRPR  438

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQ-E  463
            MSQVVRALEG++S  +LNEGI PG S  +  SY SS+Y+A +Y ED+ KFRK+AL  + +
Sbjct  439  MSQVVRALEGNLSADELNEGIIPGQSTVF--SYGSSEYNASEYKEDLNKFRKLALALEIQ  496

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
               T + S P+S++G+  SG     QTTQE+E+G+ +K+
Sbjct  497  EQETSENSGPSSDFGMLSSGERQ--QTTQEIELGKTKKN  533



>ref|XP_010050496.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Eucalyptus 
grandis]
Length=588

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 119/157 (76%), Gaps = 13/157 (8%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            + +SLVDW RPLL RAL+D NFN+LVDPRL+N++NH+EM+RM++CAAA +RHSARRRPRM
Sbjct  437  LHESLVDWVRPLLARALDDENFNSLVDPRLQNNYNHDEMVRMVSCAAACIRHSARRRPRM  496

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VR+LEG+MSLSD++EG+RPGHS  + +S            E+++K RKMA G+Q+Y 
Sbjct  497  SQIVRSLEGEMSLSDIDEGVRPGHSTVHANS------------EELRKIRKMAFGNQDY-  543

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+ +Y   T E G   SGSS +  +++EME  RM ++
Sbjct  544  SSSEYGESTGESGTYRSGSSGDAHSSREMETRRMMRN  580



>ref|XP_010500823.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X1 [Camelina sativa]
Length=513

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 120/152 (79%), Gaps = 5/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL  G+F+ LVDPRLE++F+ +EM RM+ACAAASVRHSA+RRP+MS
Sbjct  355  DDSIVDWAKPLMIQALNGGSFDGLVDPRLEHEFDISEMTRMVACAAASVRHSAKRRPKMS  414

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL DL EG  PGHS  Y S   SSDY + QY ED+KKF+KMA  SQ +GS
Sbjct  415  QIVRAFEGNISLDDLTEGSAPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMAYESQTFGS  473

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            + + S  TS+ G NPSGSSS  EG +TTQE+E
Sbjct  474  S-ECSGLTSDNGQNPSGSSSITEGNRTTQEIE  504



>ref|NP_179437.1| proline-rich extensin-like receptor kinase 4 [Arabidopsis thaliana]
 sp|Q9ZNQ8.1|PERK4_ARATH RecName: Full=Proline-rich receptor-like protein kinase PERK4; 
AltName: Full=Proline-rich extensin-like receptor kinase 4; 
Short=AtPERK4 [Arabidopsis thaliana]
 gb|AAD12219.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAM15257.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC06772.1| proline-rich extensin-like receptor kinase 4 [Arabidopsis thaliana]
Length=633

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+ RALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  490  MDDTLVDWARPLMARALEDGNFNELADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  549

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            SQ+VRALEG++SL  LNEG++PGHS  YGS   SSDY    YN DMKKFR++AL SQE+
Sbjct  550  SQIVRALEGEVSLDALNEGVKPGHSNVYGSLGASSDYSQTSYNADMKKFRQIALSSQEF  608



>ref|XP_010691327.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=553

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 9/159 (6%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDS+V+WARPLL +ALE G+F+ LVDPRLE D+N +EM +MIACAA  VR SARRRP+
Sbjct  389  FMDDSMVEWARPLLTQALEGGSFHELVDPRLE-DYNSSEMAQMIACAAVCVRSSARRRPQ  447

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYD-AMQYNEDMKKFRKMALGSQE  463
            MSQVVRALEG++S  DL + I P + A +G    SSDYD + QY +D+KKFRK+AL SQE
Sbjct  448  MSQVVRALEGNLSAEDLLKEIAPDNRAFHG----SSDYDSSAQYKQDLKKFRKLALESQE  503

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQT--TQEMEMGRMR  352
              STG+YS  T+E+G+ PS SS+E Q   TQE+E G+ +
Sbjct  504  Q-STGEYSVFTNEHGVPPSTSSTENQPDDTQEIETGKSK  541



>ref|XP_010691326.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=554

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 9/159 (6%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FMDDS+V+WARPLL +ALE G+F+ LVDPRLE D+N +EM +MIACAA  VR SARRRP+
Sbjct  390  FMDDSMVEWARPLLTQALEGGSFHELVDPRLE-DYNSSEMAQMIACAAVCVRSSARRRPQ  448

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYD-AMQYNEDMKKFRKMALGSQE  463
            MSQVVRALEG++S  DL + I P + A +G    SSDYD + QY +D+KKFRK+AL SQE
Sbjct  449  MSQVVRALEGNLSAEDLLKEIAPDNRAFHG----SSDYDSSAQYKQDLKKFRKLALESQE  504

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQT--TQEMEMGRMR  352
              STG+YS  T+E+G+ PS SS+E Q   TQE+E G+ +
Sbjct  505  Q-STGEYSVFTNEHGVPPSTSSTENQPDDTQEIETGKSK  542



>ref|XP_008785658.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Phoenix 
dactylifera]
Length=634

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 115/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARP+L RAL + NF+ LVDPRLEND+N  EM RMIACAAA VRHSARRRP+
Sbjct  483  FMEDSLVDWARPVLSRALSNENFDELVDPRLENDYNAIEMQRMIACAAACVRHSARRRPK  542

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL DLNEG++PG S+ + S   SSDY++  Y+ +M++FR++ LG +E+
Sbjct  543  MSQIVRALEGDTSLEDLNEGVKPGQSSYFNS---SSDYESGSYSANMRQFRRVVLGGEEF  599

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQ  385
              + +Y+  T++YGLN S  SS G+
Sbjct  600  --SNEYTGQTNDYGLNASDLSSSGE  622



>gb|EMS56036.1| hypothetical protein TRIUR3_09654 [Triticum urartu]
Length=296

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 6/148 (4%)
 Frame = -2

Query  792  ARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmSQVVRALE  613
            ARPL+ +ALEDGN + LVDP +  DFN NEM RMIACAAA VRHSARRRPRMSQVVRALE
Sbjct  134  ARPLMTQALEDGNHDALVDPHMGIDFNDNEMARMIACAAACVRHSARRRPRMSQVVRALE  193

Query  612  GDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGSTGQYSNP  433
            GD+SL DL+EG+RPGHS   G S+ SS+YD  QYNED+KKFRKMALG+  + S+ Q +  
Sbjct  194  GDVSLDDLHEGVRPGHSRFMG-SHASSEYDTSQYNEDLKKFRKMALGTSSFQSS-QLTPS  251

Query  432  TSEY---GLNPSGSSSEG-QTTQEMEMG  361
            + E+     NP   SS+G Q TQE+E+G
Sbjct  252  SGEHEQEHQNPPVPSSDGHQQTQEVELG  279



>ref|XP_007042215.1| Roline-rich extensin-like receptor kinase 4 [Theobroma cacao]
 gb|EOX98046.1| Roline-rich extensin-like receptor kinase 4 [Theobroma cacao]
Length=631

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 3/136 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MD+SLVDWARPL   A+EDGNF+ LVDPRLEN+F  +EM+RM+ACAAA VRHSARRRP+M
Sbjct  482  MDESLVDWARPLCASAMEDGNFSQLVDPRLENNFVQHEMVRMVACAAACVRHSARRRPKM  541

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
             Q+VRALE D+S+ DLN+ +RPG S+ + SS  S DYD   +  DMKK RKMAL  Q+YG
Sbjct  542  RQIVRALEDDVSMDDLNDAMRPGQSSRF-SSMASYDYDTDAHGIDMKKIRKMALDCQDYG  600

Query  456  STGQYSNPTSEYGLNP  409
            S+  Y N TSEYGLNP
Sbjct  601  SS-DYGN-TSEYGLNP  614



>ref|XP_002978933.1| hypothetical protein SELMODRAFT_177358 [Selaginella moellendorffii]
 gb|EFJ19890.1| hypothetical protein SELMODRAFT_177358 [Selaginella moellendorffii]
Length=402

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 5/135 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLV+WARP L +A+E+G+ + +VD RL N +N NEMLRM+  AAA VRHSA +RPRM+
Sbjct  228  DESLVEWARPYLTQAIENGDLDGIVDERLAN-YNENEMLRMVEAAAACVRHSASKRPRMA  286

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QVVRALE D ++SDLN+G++PGHS    S++ S+DYD+ QY  DMK+FRK   GSQE+GS
Sbjct  287  QVVRALESDGAISDLNQGVKPGHS----SNFTSADYDSNQYASDMKRFRKAVFGSQEHGS  342

Query  453  TGQYSNPTSEYGLNP  409
            +     PTSEYG+NP
Sbjct  343  SEHSGPPTSEYGMNP  357



>ref|XP_010462066.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Camelina 
sativa]
Length=512

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ +AL  G+F+ LVDPRLE++F+ +EM RM+ACAAASVRHSA+RRP+MS
Sbjct  353  DDSIVDWAKPLMIQALNGGSFDGLVDPRLEDEFDISEMTRMVACAAASVRHSAKRRPKMS  412

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++S+ DL EG  PGHS  Y S   SSDY + QY ED+KKF+KMA  SQ +GS
Sbjct  413  QIVRAFEGNISIDDLTEGSAPGHSTIY-SLDGSSDYSSTQYKEDLKKFKKMAYESQTFGS  471

Query  453  TGQYSNPTSEYGLNPSGSSS--EG-QTTQEME  367
            + + S  TS  G NPSGSSS  EG +TTQE+E
Sbjct  472  S-ECSVLTSHNGQNPSGSSSITEGNRTTQEIE  502



>ref|XP_010520632.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Tarenaya 
hassleriana]
Length=573

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 118/152 (78%), Gaps = 8/152 (5%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +MD+SLVDWARPLL RA ED  F  L DPR+E +++  EM RM+ACAAA VRHSARRRPR
Sbjct  425  YMDESLVDWARPLLTRAQEDRKFEALTDPRME-EYDREEMARMVACAAACVRHSARRRPR  483

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+MSL++L+EG++PGHS+AY S  ES+DYD ++YNED+ +FRKMA G    
Sbjct  484  MSQIVRALEGEMSLNNLSEGVKPGHSSAYSS--ESTDYDNVKYNEDLSRFRKMAFG----  537

Query  459  GSTGQYSNPTSE-YGLNPSGSSSEGQTTQEME  367
            G++ +YS  +S+ Y   PSGSSSE  +  E E
Sbjct  538  GTSSEYSGQSSDFYPPYPSGSSSEQTSNPERE  569



>ref|XP_010414353.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Camelina 
sativa]
Length=632

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+ +ALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  489  MDDTLVDWARPLMVQALEDGNFNVLADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  548

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            SQ+VRALEG++SL  L EG++PGHS  YGSS  SSDY    YN DMKKFR++AL SQE+
Sbjct  549  SQIVRALEGEVSLDALTEGVKPGHSNIYGSSGASSDYSQTSYNADMKKFRQIALSSQEF  607



>ref|XP_006465607.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
isoform X1 [Citrus sinensis]
Length=588

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 118/159 (74%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWA PLL + L DGNF+ LVD +LE +++  EM RM ACAAA +RHSARRRPR
Sbjct  417  FADDSMVDWATPLLAQGLADGNFDALVDQKLE-EYDSAEMARMAACAAACIRHSARRRPR  475

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+  L DLNEGI PGHS  YG SY  SDY++MQY EDMKKFRK+AL S E 
Sbjct  476  MSQIVRALEGNTPLDDLNEGITPGHSTIYG-SYGGSDYNSMQYREDMKKFRKIALESVEL  534

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
            GS+  YS  TS+YG NP  SS+E  Q TQE E  +  KD
Sbjct  535  GSS-DYSGLTSDYGQNPPSSSTEDRQATQETEPNKAEKD  572



>gb|EMT01740.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=493

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -2

Query  792  ARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmSQVVRALE  613
            ARPL+ +ALEDGN + LVDP L  DFN NEM RMIACAAA VRHSARRRPRMSQVVRALE
Sbjct  334  ARPLMTQALEDGNHDALVDPHLGIDFNDNEMARMIACAAACVRHSARRRPRMSQVVRALE  393

Query  612  GDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGSTGQYSNP  433
            GD+SL DL+EG+RPGHS   G S+ SS+YD  QYNED+KKFRKMALG+  + S+    + 
Sbjct  394  GDVSLDDLHEGVRPGHSRFMG-SHASSEYDTSQYNEDLKKFRKMALGTSSFQSSQLTPSS  452

Query  432  TSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
                   PS  SS+G Q TQE+E+G  ++D
Sbjct  453  GEHEHQEPSVPSSDGHQQTQEVELGTRKRD  482



>ref|XP_006465608.1| PREDICTED: proline-rich receptor-like protein kinase PERK1-like 
isoform X2 [Citrus sinensis]
Length=581

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 118/159 (74%), Gaps = 4/159 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+VDWA PLL + L DGNF+ LVD +LE +++  EM RM ACAAA +RHSARRRPR
Sbjct  410  FADDSMVDWATPLLAQGLADGNFDALVDQKLE-EYDSAEMARMAACAAACIRHSARRRPR  468

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEG+  L DLNEGI PGHS  YG SY  SDY++MQY EDMKKFRK+AL S E 
Sbjct  469  MSQIVRALEGNTPLDDLNEGITPGHSTIYG-SYGGSDYNSMQYREDMKKFRKIALESVEL  527

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
            GS+  YS  TS+YG NP  SS+E  Q TQE E  +  KD
Sbjct  528  GSS-DYSGLTSDYGQNPPSSSTEDRQATQETEPNKAEKD  565



>gb|KJB27138.1| hypothetical protein B456_004G280200 [Gossypium raimondii]
Length=700

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + DD L DWARPLL +AL+DG+F+   DP+L  +++HNEM+RM+ACAAA V+ SAR RPR
Sbjct  532  YKDDGLADWARPLLTKALDDGSFDCFADPKLGKEYDHNEMVRMVACAAACVQLSARDRPR  591

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+ RALEGD+S+SDLN+   P HS  + SS+E+SD D  Q+NED +  ++M L SQ Y
Sbjct  592  MSQITRALEGDVSMSDLNDSASPEHSNIH-SSHENSDIDTSQHNEDTEGSKRMVLDSQGY  650

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQ  376
            G++G+Y  P++EYG NP GS +E  + Q
Sbjct  651  GASGEYGEPSTEYGSNPFGSINESCSNQ  678



>gb|EYU40150.1| hypothetical protein MIMGU_mgv1a002653mg [Erythranthe guttata]
Length=649

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPLL +ALE+GN+  LVDPRLE ++  +E+ RMIACAAAS+RHSARRRPRM
Sbjct  494  MEDSLVDWARPLLTQALENGNYAELVDPRLEGNYVPHEIARMIACAAASIRHSARRRPRM  553

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSD-YDAMQYNEDMKKFRKMALGSQEY  460
            SQ+VRAL+GD SL DLNEG++PG S AY  +  + D YD   YN D+ KFR+M + +QE 
Sbjct  554  SQIVRALDGDSSLEDLNEGVKPGQSQAYNPANTNRDIYDTGAYNADLMKFRQMVMSTQEV  613

Query  459  GSTGQYSNPTSEYGLNPSGSSSE  391
             ST +Y   TSEYGLNPS SS +
Sbjct  614  NST-EYGATTSEYGLNPSVSSGD  635



>ref|XP_010467665.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Camelina 
sativa]
Length=631

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+ +ALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  488  MDDTLVDWARPLMVQALEDGNFNELADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  547

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            SQ+VRALEG++SL  L EG++PGHS  YGSS  SSDY    YN DMKKFR++AL SQE+
Sbjct  548  SQIVRALEGEVSLDALTEGVKPGHSNIYGSSGASSDYSQTSYNADMKKFRQIALSSQEF  606



>ref|XP_006383219.1| kinase family protein [Populus trichocarpa]
 gb|ERP61016.1| kinase family protein [Populus trichocarpa]
Length=598

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL+  +L+ GN+N LVDP LEN++NH EM RMIACAAAS+RHSAR+RP+M
Sbjct  446  MEDSLVDWARPLMITSLDTGNYNELVDPMLENNYNHQEMQRMIACAAASIRHSARKRPKM  505

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQV RALEGD+ L DLNEG +PG S+ +  S  S+DYDA  YN DMKKFR++AL SQE+G
Sbjct  506  SQVARALEGDVLLDDLNEGTKPGQSSVFSGSNGSADYDASSYNADMKKFRQVALNSQEFG  565

Query  456  S  454
            S
Sbjct  566  S  566



>ref|XP_006299531.1| hypothetical protein CARUB_v10015703mg [Capsella rubella]
 gb|EOA32429.1| hypothetical protein CARUB_v10015703mg [Capsella rubella]
Length=697

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GN+  +VD +L N+++  EM RM+ACAAA VR +ARRRPRM 
Sbjct  541  DNSLVDWARPLLNQVSEIGNYEVVVDTKLNNEYDREEMARMVACAAACVRSTARRRPRMD  600

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMA-LGSQEYG  457
            QV R LEG++S SDLN+GI PGHS  YGSS  S+DYD+ Q N+ M KFRK+  L +Q+  
Sbjct  601  QVARVLEGNISPSDLNQGITPGHSNVYGSSGGSTDYDSSQDNDGMNKFRKVGMLETQDL-  659

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEM  364
                YSNP SEY L PS SS+E QTT+EMEM
Sbjct  660  ----YSNPISEYDLYPSLSSTEVQTTREMEM  686



>ref|XP_008241661.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Prunus 
mume]
Length=621

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 4/140 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL+R+LE+GN   LVD RL+N+FN  EM RM+ACAAAS+RHSAR+RP+M
Sbjct  474  MDDSLVDWARPLLNRSLEEGNHLELVDIRLDNNFNPQEMARMVACAAASIRHSARKRPKM  533

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSY--ESSDYDAMQYNEDMKKFRKMALGSQE  463
            SQ+VRALEGD+SL DLNEG +PG S+ + ++    SSDYD   YN DMKKFRK+AL SQE
Sbjct  534  SQIVRALEGDVSLDDLNEGTKPGQSSMFNAAAGGGSSDYDTQAYNADMKKFRKLALSSQE  593

Query  462  YGST--GQYSNPTSEYGLNP  409
            +GS+  G  SN + E    P
Sbjct  594  FGSSEFGTSSNDSREMSGTP  613



>ref|XP_010939267.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Elaeis 
guineensis]
Length=617

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            FM+DSLVDWARPLL RAL DG+F+ L+DPRLEND+N  EM RMIACAAA VRHSARRRP+
Sbjct  495  FMEDSLVDWARPLLSRALSDGDFDELIDPRLENDYNAMEMQRMIACAAACVRHSARRRPK  554

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD SL DLNEG+RPG S  + S   SSDYD   Y   M+KFR+ ALGS+E+
Sbjct  555  MSQIVRALEGDTSLEDLNEGVRPGQSTYFNS---SSDYDTGSYGSHMRKFRRAALGSEEF  611



>ref|XP_009102242.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Brassica 
rapa]
 ref|XP_009102243.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Brassica 
rapa]
Length=610

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARP++ RALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  469  MDDTLVDWARPIMARALEDGNFNELADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  528

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG+MSL  LNE ++PG+S  YG+S  S+DY    YN DMKKFR +AL SQE+ 
Sbjct  529  SQIVRALEGEMSLDALNESVKPGNSKVYGTSGTSTDYSQTSYNADMKKFRHVALSSQEFQ  588

Query  456  ST  451
            S+
Sbjct  589  SS  590



>emb|CAA18823.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAB80161.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=674

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 119/168 (71%), Gaps = 18/168 (11%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL  +A +DG++N L DPRLE +++H EM++M +CAAA++RHSARRRP+M
Sbjct  511  MEDSLVDWARPLCLKAAQDGDYNQLADPRLELNYSHQEMVQMASCAAAAIRHSARRRPKM  570

Query  636  SQV-----------VRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKF  490
            SQV           VRALEGDMS+ DL+EG RPG S        SS+YDA  Y  DMKKF
Sbjct  571  SQVQKLIPLVGSIIVRALEGDMSMDDLSEGTRPGQSTYLSPGSVSSEYDASSYTADMKKF  630

Query  489  RKMALGSQEYGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            +K+AL ++EY S+ +Y   TSEYGLNPS SSSE     EM  G M+++
Sbjct  631  KKLALENKEYQSS-EYGG-TSEYGLNPSASSSE-----EMNRGSMKRN  671



>ref|XP_002991493.1| hypothetical protein SELMODRAFT_133636 [Selaginella moellendorffii]
 gb|EFJ07415.1| hypothetical protein SELMODRAFT_133636 [Selaginella moellendorffii]
Length=402

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 5/135 (4%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLV+WARP L +A+E+G+ + +VD RL N +N NEMLRM+  AAA VRHSA +RPRM+
Sbjct  228  DESLVEWARPYLTQAIENGDLDGIVDERLAN-YNENEMLRMVEAAAACVRHSASKRPRMA  286

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QVVRALE D ++S LN+G++PGHS    S++ S+DYD+ QY  DMK+FRK   GSQE+GS
Sbjct  287  QVVRALESDGAISGLNQGVKPGHS----SNFTSADYDSNQYASDMKRFRKAVFGSQEHGS  342

Query  453  TGQYSNPTSEYGLNP  409
            +     PTSEYG+NP
Sbjct  343  SEHSGPPTSEYGMNP  357



>ref|XP_010548337.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Tarenaya 
hassleriana]
 ref|XP_010548338.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Tarenaya 
hassleriana]
Length=591

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARP++ RALEDGNF+ L DPRLE  +N  EM+RM+ CAAAS+RHSAR+RP+M
Sbjct  450  MEDSLVDWARPVMARALEDGNFDELSDPRLEGSYNRQEMVRMVTCAAASIRHSARKRPKM  509

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL DL+EG++PGHS  YGS   SS+Y    Y  DMKKFR+MAL SQE+ 
Sbjct  510  SQIVRALEGEVSLDDLSEGVKPGHSNVYGSG-TSSEYSQTAYQADMKKFRQMALSSQEFM  568

Query  456  STGQYSNPTSEYGLNPSG  403
            ++   S+ + E G  P+G
Sbjct  569  NSDGSSHDSEEMG--PTG  584



>emb|CBI17536.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 8/150 (5%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
              ++SLVDWARPLL RAL DGN++ LVD  LEN++N  EM RM+ACAAAS+RHSA+RRP+
Sbjct  135  IFEESLVDWARPLLSRALADGNYDELVDRFLENNYNTQEMARMVACAAASIRHSAKRRPK  194

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL DLN+  +   S AY +S  SS+Y+   YN DM+KF+KMAL SQE+
Sbjct  195  MSQIVRALEGDVSLEDLNDVTKTNQSPAYSTSM-SSEYNTRMYNADMEKFKKMALSSQEF  253

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEM  370
            GS+    + TSEYG NPS S +    +QEM
Sbjct  254  GSS---EDGTSEYGQNPSSSDN----SQEM  276



>ref|XP_010999977.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Populus 
euphratica]
Length=592

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 4/140 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL+  +L+ GN+N LVDP LEN +NH EM RMIACAAAS+RHSAR+RP+M
Sbjct  446  MEDSLVDWARPLMITSLDTGNYNELVDPMLENHYNHQEMQRMIACAAASIRHSARKRPKM  505

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQV RALEGD+ L DLNEG +PG S+ +  S  SSDYD   YN DMK+FR++AL SQE+G
Sbjct  506  SQVARALEGDVLLDDLNEGTKPGQSSIFSGSNGSSDYDTSSYNADMKRFRQVALNSQEFG  565

Query  456  ST--GQYSNPTSEYGLNPSG  403
            S   G  SN +   G  PSG
Sbjct  566  SNELGTSSNESPVTG--PSG  583



>ref|XP_007204613.1| hypothetical protein PRUPE_ppa002502mg [Prunus persica]
 gb|EMJ05812.1| hypothetical protein PRUPE_ppa002502mg [Prunus persica]
Length=665

 Score =   137 bits (344),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 109/140 (78%), Gaps = 4/140 (3%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL+R+LE+GN   LVD RL+N+FN  EM RM+ACAAAS+RHSAR+RP+M
Sbjct  518  MDDSLVDWARPLLNRSLEEGNNLELVDIRLDNNFNLQEMARMVACAAASIRHSARKRPKM  577

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSY--ESSDYDAMQYNEDMKKFRKMALGSQE  463
            SQ+VRALEGD+SL DLNEG +PG S+ + ++    SSDYD   YN DMKKFRK+AL SQE
Sbjct  578  SQIVRALEGDVSLDDLNEGTKPGQSSMFNATAGGGSSDYDTQAYNADMKKFRKLALSSQE  637

Query  462  YGST--GQYSNPTSEYGLNP  409
            +GS+  G  SN + E    P
Sbjct  638  FGSSEFGTSSNDSREMSGTP  657



>ref|XP_006285233.1| hypothetical protein CARUB_v10006593mg [Capsella rubella]
 gb|EOA18131.1| hypothetical protein CARUB_v10006593mg [Capsella rubella]
Length=676

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL  +A +DG++N L DPRLE +++  EM RM +CAAA++RHSARRRP+M
Sbjct  524  MEDSLVDWARPLCLKAAQDGDYNQLADPRLELNYDQQEMARMASCAAAAIRHSARRRPKM  583

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGDMS+ DL+EG RPG S        SS+YDA  Y+ DMKKF+K+AL ++EY 
Sbjct  584  SQIVRALEGDMSMEDLSEGTRPGQSTYLSPGSASSEYDASSYSADMKKFKKLALENKEYQ  643

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+ +Y   TSEYGLNPS SSSE     EM  G M+++
Sbjct  644  SS-EYGG-TSEYGLNPSASSSE-----EMHRGSMKRN  673



>gb|EYU17836.1| hypothetical protein MIMGU_mgv1a002201mg [Erythranthe guttata]
Length=702

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 112/157 (71%), Gaps = 11/157 (7%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
             M+DSLVDWARPLL +A EDGN+N LVDPRLE ++   E+ RM+ACAAAS+RHSARRRPR
Sbjct  546  IMEDSLVDWARPLLSKASEDGNYNGLVDPRLEGNYVPQEIARMVACAAASIRHSARRRPR  605

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSS-YESSDYDAMQYNEDMKKFRKMALGSQE  463
            MSQ+ RALEGD SL DLNEG++PG S  Y  +      YD   YN DM KFR+M + SQ+
Sbjct  606  MSQIARALEGDSSLDDLNEGVKPGQSNVYNPNGSREGAYDTGAYNADMVKFRQMVMSSQD  665

Query  462  YGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMR  352
            + S+  Y   TSEYGLNPS SSSE       EMG+ R
Sbjct  666  FNSS-DYG--TSEYGLNPSSSSSE-------EMGKSR  692



>ref|XP_010096182.1| hypothetical protein L484_026916 [Morus notabilis]
 gb|EXB63577.1| hypothetical protein L484_026916 [Morus notabilis]
Length=222

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 113/141 (80%), Gaps = 6/141 (4%)
 Frame = -2

Query  792  ARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmSQVVRALE  613
            ARPL  +ALEDGN++ LVDPRLEN++  +EM RM+ACAAAS+RHSARRRP+MSQ+VRALE
Sbjct  79   ARPLCLKALEDGNYDELVDPRLENNYVPHEMARMVACAAASIRHSARRRPKMSQIVRALE  138

Query  612  GDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGSTGQYSNP  433
            GD+SL DLNEG++PG S+ +GSS E   Y+A  Y+ +M+K RK AL SQEYGS+ +Y   
Sbjct  139  GDVSLEDLNEGVKPGQSSYFGSSSEI--YEAGSYSANMRKLRKKALDSQEYGSS-EY-GA  194

Query  432  TSEYGLNPSGSSSEGQTTQEM  370
            TSEYGLNPS SS +  +T E+
Sbjct  195  TSEYGLNPSSSSDD--STHEI  213



>gb|KHG22016.1| Proline-rich receptor-like protein kinase PERK1 [Gossypium arboreum]
Length=395

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            + +DSL DWARPLL +AL+DG+F+ L DP+L  +++HNEM+RM+ACAAA V+ SAR RPR
Sbjct  218  YKEDSLADWARPLLTKALDDGSFDCLADPKLGREYDHNEMVRMVACAAACVQLSARDRPR  277

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ++RALEGD+S+SDLN+   P HS  + SS+E+SD    Q+NE+ ++ ++M L SQ Y
Sbjct  278  MSQIIRALEGDVSMSDLNDSASPEHSNIH-SSHENSDIHTSQHNENTEESKRMVLDSQGY  336

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQ  376
            G++ +YS P++EYG NP  S +E  + Q
Sbjct  337  GASVEYSEPSTEYGSNPFISINESCSNQ  364



>ref|XP_010479680.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Camelina 
sativa]
Length=238

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 107/142 (75%), Gaps = 7/142 (5%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            DDS+VDWA+PL+ + L+DGNFN  VDPRLENDF+  EM R++ACAAASVRH+A+RRP M+
Sbjct  98   DDSIVDWAKPLMAKGLKDGNFNGFVDPRLENDFDVIEMTRVVACAAASVRHAAKRRPTMT  157

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            Q+VRA EG++SL+D+ EG+    S  Y S   SSDY + QY ED+KKF+KMAL SQ +GS
Sbjct  158  QIVRAFEGNISLADITEGVASEDSTGY-SLDGSSDYCSTQYREDLKKFKKMALESQTFGS  216

Query  453  TGQYSNPTSEYG--LNPSGSSS  394
            +G     TSE G  L PS SSS
Sbjct  217  SGL----TSENGQDLEPSSSSS  234



>ref|XP_009371633.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Pyrus 
x bretschneideri]
Length=663

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL R+LEDGN+  LVD  L+N++N  EM RM+ACAAAS+RHSA++RP+M
Sbjct  525  MDDSLVDWARPLLTRSLEDGNYTELVDIGLDNNYNPQEMARMVACAAASIRHSAKKRPKM  584

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL +LNEG +PG S+ + +   SSDYD   YN DMKKFRK+AL SQE G
Sbjct  585  SQIVRALEGEVSLDNLNEGTKPGQSSMFNAGGGSSDYDTQAYNADMKKFRKLALSSQELG  644

Query  456  ST  451
            S+
Sbjct  645  SS  646



>ref|XP_008338108.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X2 [Malus domestica]
Length=666

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL R+LEDGN+  LVD  L+N++N  EM RM+ACAAAS+RHSA++RP+M
Sbjct  528  MDDSLVDWARPLLTRSLEDGNYTELVDIGLDNNYNPQEMARMVACAAASIRHSAKKRPKM  587

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL +LNEG +PG S+ + +   SSDYD   YN DMKKFRK+AL SQE G
Sbjct  588  SQIVRALEGEVSLDNLNEGTKPGQSSMFNAGGGSSDYDTQAYNADMKKFRKLALSSQELG  647

Query  456  ST  451
            S+
Sbjct  648  SS  649



>emb|CDY51224.1| BnaC09g09790D [Brassica napus]
Length=946

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARP++ RALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  484  MDDTLVDWARPIMVRALEDGNFNELADVRLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  543

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL  L EG++PGHS  YG+S  SSDY    YN DMKKFR++AL +Q++ 
Sbjct  544  SQIVRALEGEVSLDVLYEGVKPGHSNIYGTSGTSSDYSQTSYNADMKKFRQIALSTQDFQ  603

Query  456  STGQYSNPTSEYGLNP  409
            S+   + P  EY   P
Sbjct  604  SSEAVTEP--EYTSGP  617



>gb|KCW53712.1| hypothetical protein EUGRSUZ_J02968 [Eucalyptus grandis]
Length=395

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 111/159 (70%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL +ALE   F+ +VDP+L  D+   E+  MIACAAA VRHSAR RP 
Sbjct  229  FDEDSLVDWARPLLTQALEGDKFDAIVDPKLNKDYATEELTWMIACAAACVRHSARHRPP  288

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG++SLSDL EGI PGHS  Y    ESS+YD  Q  ED   F+  AL SQE 
Sbjct  289  MTQVVRALEGNLSLSDLKEGIMPGHSRVYNRC-ESSEYDTNQDQEDSMIFKMRALESQEQ  347

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTT-QEMEMGRMRKD  346
             +T ++S P SE  L P  SSS GQ T QEM+MG+M +D
Sbjct  348  -ATSEFSCPYSEDDLQPYNSSSGGQQTPQEMDMGKMAED  385



>emb|CDY65603.1| BnaA07g36160D [Brassica napus]
Length=618

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARP++ RALEDGNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  477  MDDTLVDWARPIMARALEDGNFNELADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  536

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG+ SL  LNE ++PG+S  YG+S  S+DY    YN DMKKFR +AL SQE+ 
Sbjct  537  SQIVRALEGETSLDALNESVKPGNSKVYGTSGTSTDYSQTSYNADMKKFRHVALSSQEFQ  596

Query  456  ST  451
            S+
Sbjct  597  SS  598



>ref|XP_010049680.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X4 [Eucalyptus grandis]
Length=502

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 108/157 (69%), Gaps = 9/157 (6%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MD SLV+WARP L R LEDGNF++LVDPRL+ND+ H+EM RM+ACAAA V HS   RP+M
Sbjct  340  MDVSLVNWARPQLTRYLEDGNFDSLVDPRLQNDYKHDEMARMVACAAACVCHSLGHRPKM  399

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            S++VRALEGD+ LSDL+ G+RPG S      + +SD    QY   +K  RKM L  QE+G
Sbjct  400  SKIVRALEGDLPLSDLSGGMRPGLS-ILCRGWGNSDCGTSQY---LKMSRKMPLACQEHG  455

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+  +  P S     PSG     QTTQ++EMGRM +D
Sbjct  456  SS-HHGEPIS----GPSGKGPNCQTTQDLEMGRMERD  487



>ref|XP_008338107.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Malus domestica]
Length=714

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDDSLVDWARPLL R+LEDGN+  LVD  L+N++N  EM RM+ACAAAS+RHSA++RP+M
Sbjct  576  MDDSLVDWARPLLTRSLEDGNYTELVDIGLDNNYNPQEMARMVACAAASIRHSAKKRPKM  635

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL +LNEG +PG S+ + +   SSDYD   YN DMKKFRK+AL SQE G
Sbjct  636  SQIVRALEGEVSLDNLNEGTKPGQSSMFNAGGGSSDYDTQAYNADMKKFRKLALSSQELG  695

Query  456  ST  451
            S+
Sbjct  696  SS  697



>ref|XP_010254881.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Nelumbo 
nucifera]
Length=640

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 13/158 (8%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            +M+DSLVDWARP+L RA+ DGN++ LVDPRLEN +  +EM  M+ CAAAS+RHSARRRP+
Sbjct  496  YMEDSLVDWARPILTRAMTDGNYSQLVDPRLENRYEPSEMANMVTCAAASIRHSARRRPK  555

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL DLNEG++PG S  +G    SS+YDA  YN DM KFRKMAL SQE 
Sbjct  556  MSQIVRALEGDVSLDDLNEGVKPGQSTVFG-VIGSSEYDANAYNADMIKFRKMALESQEM  614

Query  459  GSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
             S        SEYG    GSSS G +    + G  R+D
Sbjct  615  SS--------SEYG---DGSSS-GDSADMNQSGNQRRD  640



>ref|XP_002279197.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Vitis 
vinifera]
 emb|CBI36117.3| unnamed protein product [Vitis vinifera]
Length=551

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 114/157 (73%), Gaps = 3/157 (2%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            ++S+VDWARPLL +ALE+  +  LVDP L+ D+N+NEM RM+ACAA  VR+ AR RPRMS
Sbjct  389  NESIVDWARPLLTQALEESKYGALVDPNLQKDYNYNEMARMVACAAVCVRYLARLRPRMS  448

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QVVRALEG++ L DLNEGI PGHS ++   Y SSD D +  +ED+KKFRKMAL S E GS
Sbjct  449  QVVRALEGNLPLDDLNEGIIPGHS-SFHCRYGSSDDDTIHGSEDLKKFRKMALESHEQGS  507

Query  453  TGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
              + + P S    + S SS EG QT +E+EM + +++
Sbjct  508  I-ECTVPISASDPHTSNSSFEGQQTCKEVEMEKHKEN  543



>ref|XP_010049677.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Eucalyptus grandis]
Length=532

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 108/157 (69%), Gaps = 9/157 (6%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MD SLV+WARP L R LEDGNF++LVDPRL+ND+ H+EM RM+ACAAA V HS   RP+M
Sbjct  370  MDVSLVNWARPQLTRYLEDGNFDSLVDPRLQNDYKHDEMARMVACAAACVCHSLGHRPKM  429

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            S++VRALEGD+ LSDL+ G+RPG S      + +SD    QY   +K  RKM L  QE+G
Sbjct  430  SKIVRALEGDLPLSDLSGGMRPGLS-ILCRGWGNSDCGTSQY---LKMSRKMPLACQEHG  485

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+  +  P S     PSG     QTTQ++EMGRM +D
Sbjct  486  SS-HHGEPIS----GPSGKGPNCQTTQDLEMGRMERD  517



>ref|XP_010034738.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Eucalyptus 
grandis]
Length=616

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 111/159 (70%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL +ALE   F+ +VDP+L  D++  E+  MIACA A VRHSAR RP 
Sbjct  428  FDEDSLVDWARPLLTQALEGDEFDAIVDPKLNKDYDTEELTWMIACATACVRHSARHRPP  487

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG++SLSDL EGI P HS  Y    ESS+Y   +  ED   FR MAL SQE 
Sbjct  488  MTQVVRALEGNLSLSDLKEGIMPAHSRVYNRC-ESSEYGTNKDQEDSTIFRMMALESQEQ  546

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
             +T ++S P S Y L P  SSS G QT+QEM+MG+M +D
Sbjct  547  -ATSEFSCPYSAYDLQPYNSSSGGQQTSQEMDMGKMAED  584



>ref|XP_010049676.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X1 [Eucalyptus grandis]
Length=557

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 108/157 (69%), Gaps = 9/157 (6%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MD SLV+WARP L R LEDGNF++LVDPRL+ND+ H+EM RM+ACAAA V HS   RP+M
Sbjct  395  MDVSLVNWARPQLTRYLEDGNFDSLVDPRLQNDYKHDEMARMVACAAACVCHSLGHRPKM  454

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            S++VRALEGD+ LSDL+ G+RPG S      + +SD    QY   +K  RKM L  QE+G
Sbjct  455  SKIVRALEGDLPLSDLSGGMRPGLS-ILCRGWGNSDCGTSQY---LKMSRKMPLACQEHG  510

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+  +  P S     PSG     QTTQ++EMGRM +D
Sbjct  511  SS-HHGEPIS----GPSGKGPNCQTTQDLEMGRMERD  542



>ref|XP_004509247.1| PREDICTED: proline-rich receptor-like protein kinase PERK4-like 
isoform X3 [Cicer arietinum]
Length=525

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALE-DGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            MD+SLVDWARPLL+RALE DGNF  LVDP LE ++NH EM+RM ACAA+S+RHSA++R +
Sbjct  402  MDESLVDWARPLLNRALEEDGNFRELVDPFLEGNYNHQEMIRMAACAASSIRHSAKKRSK  461

Query  639  mSQVVRALEGDMSLSDLNEGI--RPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQ  466
            MSQ+VRALEGD+SL DL EG+    G+S+AY SS  SSDYD +QYN DM KFRK  + SQ
Sbjct  462  MSQIVRALEGDVSLEDLKEGMMKTSGNSSAYTSSAGSSDYDTVQYNADMMKFRKAIMSSQ  521

Query  465  EYG  457
            E+G
Sbjct  522  EFG  524



>ref|XP_009353623.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Pyrus 
x bretschneideri]
Length=568

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 119/160 (74%), Gaps = 7/160 (4%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+V+WARPLL  ALE G F+ LVD RL+ND+N +EM  M+ACAAA VRHSARRRPR
Sbjct  409  FTDDSMVEWARPLLAEALETGKFDALVDVRLQNDYNTSEMACMLACAAACVRHSARRRPR  468

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALG--SQ  466
            MSQVVRALEG++S  +LNEGI PG S  +  SY SS+Y A +Y ED+ KFRK+AL   SQ
Sbjct  469  MSQVVRALEGNLSADELNEGIIPGQSTVF--SYGSSEYKASEYKEDLNKFRKLALAIESQ  526

Query  465  EYGSTGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            E   T + S P+S++GL  SG     QTTQE+E+G+ +K+
Sbjct  527  EQ-ETSENSGPSSDFGLLSSGEGQ--QTTQEIELGKTKKN  563



>gb|KCW53713.1| hypothetical protein EUGRSUZ_J02969 [Eucalyptus grandis]
Length=147

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = -2

Query  804  LVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmSQVV  625
            +VDWARPLL  ALEDGNF+ +VDP+L  D+   EM RMIACAAA VRHSAR RP M+QVV
Sbjct  1    MVDWARPLLTLALEDGNFDVIVDPKLNKDYVTEEMTRMIACAAACVRHSARHRPPMTQVV  60

Query  624  RALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGSTGQ  445
            RALEG++SL+DLNEGI PGHS  Y S  +S DY+  Q  ED KKF  MAL SQE  +T +
Sbjct  61   RALEGNLSLNDLNEGIMPGHSRVY-SRCQSLDYETSQDQEDSKKFGMMALESQEQ-ATSE  118

Query  444  YSNPTSEYGLNPS  406
            +S   SE GL PS
Sbjct  119  FSGHNSEDGLQPS  131



>ref|XP_010034844.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 [Eucalyptus 
grandis]
Length=515

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 111/159 (70%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL +ALE   F+ +VDP+L  D+   E+  MIACAAA VRHSAR RP 
Sbjct  349  FDEDSLVDWARPLLTQALEGDKFDAIVDPKLNKDYATEELTWMIACAAACVRHSARHRPP  408

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVVRALEG++SLSDL EGI PGHS  Y    ESS+YD  Q  ED   F+  AL SQE 
Sbjct  409  MTQVVRALEGNLSLSDLKEGIMPGHSRVYNRC-ESSEYDTNQDQEDSMIFKMRALESQEQ  467

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
             +T ++S P SE  L P  SSS G QT QEM+MG+M +D
Sbjct  468  -ATSEFSCPYSEDDLQPYNSSSGGQQTPQEMDMGKMAED  505



>ref|XP_009112492.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Brassica 
rapa]
Length=621

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARP++ RALE+GNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  480  MDDTLVDWARPIMVRALEEGNFNELADVRLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  539

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
             Q+VRALEG++SL  L EG++PGHS  YG+S  SSDY    YN DMKKFR++AL SQ++ 
Sbjct  540  RQIVRALEGEVSLDVLYEGVKPGHSNIYGTSGTSSDYSQTSYNADMKKFRQIALSSQDFQ  599

Query  456  ST  451
            S+
Sbjct  600  SS  601



>ref|XP_004509245.1| PREDICTED: proline-rich receptor-like protein kinase PERK4-like 
isoform X1 [Cicer arietinum]
 ref|XP_004509246.1| PREDICTED: proline-rich receptor-like protein kinase PERK4-like 
isoform X2 [Cicer arietinum]
Length=539

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALE-DGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            MD+SLVDWARPLL+RALE DGNF  LVDP LE ++NH EM+RM ACAA+S+RHSA++R +
Sbjct  416  MDESLVDWARPLLNRALEEDGNFRELVDPFLEGNYNHQEMIRMAACAASSIRHSAKKRSK  475

Query  639  mSQVVRALEGDMSLSDLNEGI--RPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQ  466
            MSQ+VRALEGD+SL DL EG+    G+S+AY SS  SSDYD +QYN DM KFRK  + SQ
Sbjct  476  MSQIVRALEGDVSLEDLKEGMMKTSGNSSAYTSSAGSSDYDTVQYNADMMKFRKAIMSSQ  535

Query  465  EYG  457
            E+G
Sbjct  536  EFG  538



>ref|XP_002885643.1| hypothetical protein ARALYDRAFT_319144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61902.1| hypothetical protein ARALYDRAFT_319144 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 111/148 (75%), Gaps = 5/148 (3%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            D+SLVDWARPLL++  E GNF  +VD +L N+++  EM R++ACAAA VR +ARRRPRM 
Sbjct  300  DNSLVDWARPLLNQVSEIGNFEAVVDTKLNNEYDREEMARVVACAAACVRSTARRRPRMD  359

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QVVR LEG++S  DLN+GI PGHS  YGSS  S+DYD+ Q +E M +FRKM L +Q+   
Sbjct  360  QVVRVLEGNISPLDLNQGITPGHSNVYGSSGGSTDYDSSQDSEGMNRFRKMGLETQDL--  417

Query  453  TGQYSNPTSEYGLNPSGSSSEGQTTQEM  370
               Y+NP SEY L PS SS++GQTT+EM
Sbjct  418  ---YTNPISEYDLYPSWSSTDGQTTREM  442



>ref|XP_010489552.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 [Camelina 
sativa]
Length=631

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+ +ALEDG FN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  488  MDDTLVDWARPLMVQALEDGKFNVLADARLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  547

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            SQ+VRALEG++SL  L EG++P HS  YGSS  SSDY    YN DMKKFR++AL SQE+
Sbjct  548  SQIVRALEGEVSLDALTEGVKPEHSNIYGSSGASSDYSQTSYNADMKKFRQIALSSQEF  606



>ref|XP_011466698.1| PREDICTED: proline-rich receptor-like protein kinase PERK1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=545

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F DDS+V+WARPLL +ALE GNF+ LVD RL+ND+N +EM  M+ACAAA VRHSAR RP+
Sbjct  378  FTDDSMVEWARPLLAQALEKGNFDGLVDARLQNDYNSSEMACMVACAAACVRHSARHRPK  437

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMAL-GSQE  463
            MSQV+RALEG++S  +LNEG+ PGHS  Y SS ES+ Y   +Y +DM KFRK+AL  SQE
Sbjct  438  MSQVLRALEGNLSPDELNEGVIPGHSMIYSSS-ESTQYSTQEYKQDMLKFRKLALEESQE  496

Query  462  Y-GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
                  + S P+S++G + S SS EG QTT+++E GR  KD
Sbjct  497  LDQGISETSGPSSDFGQHQSASSGEGQQTTKDIEYGRTDKD  537



>ref|XP_002882235.1| hypothetical protein ARALYDRAFT_340394 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58494.1| hypothetical protein ARALYDRAFT_340394 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+ SLVDWARPL  +A +DG++N L DPRLE ++NH EM++M +CAAA++RHS RRRP+M
Sbjct  212  MEYSLVDWARPLCLKAAQDGDYNQLADPRLELNYNHPEMVQMASCAAAAIRHSTRRRPKM  271

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGDMS+ DL+EG RPG S        SS+Y+A  Y  DMKKF+K+AL ++EY 
Sbjct  272  SQIVRALEGDMSMDDLSEGTRPGQSKYLRPGSVSSEYNASSYTADMKKFKKLALENKEYQ  331

Query  456  STGQYSNPTSEYGLNP  409
            S+ +Y   TSEYGLNP
Sbjct  332  SS-EYGG-TSEYGLNP  345



>ref|XP_010437615.1| PREDICTED: proline-rich receptor-like protein kinase PERK5 [Camelina 
sativa]
Length=672

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+DSLVDWARPL  +A +DG++N L D RLE +++  EM RM +CAAA++RHSARRRP+M
Sbjct  520  MEDSLVDWARPLCLKAAQDGDYNQLADSRLELNYDQQEMARMASCAAAAIRHSARRRPKM  579

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGDMS+ DL+EG RPG S        SS+YDA  Y+ DMKKF+K+AL S+EY 
Sbjct  580  SQIVRALEGDMSMEDLSEGTRPGQSTYLSPGSVSSEYDASSYSADMKKFKKLALESKEYQ  639

Query  456  STGQYSNPTSEYGLNPSGSSSEGQTTQEMEMGRMRKD  346
            S+ +Y   TSEYGLNPS SSSE     EM  G M+++
Sbjct  640  SS-EYGG-TSEYGLNPSASSSE-----EMNRGSMKRN  669



>ref|XP_006297209.1| hypothetical protein CARUB_v10013218mg [Capsella rubella]
 gb|EOA30107.1| hypothetical protein CARUB_v10013218mg [Capsella rubella]
Length=626

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARPL+  +LEDGNFN L D RLE ++N  EM RM+ CAAAS+R+S R+RP+M
Sbjct  483  MDDTLVDWARPLMASSLEDGNFNELADARLEGNYNPQEMARMVTCAAASIRYSGRKRPKM  542

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            SQ+VRALEG++SL  LNEG++PG S  YGSS  SSDY    YN DMKKFR++AL S E+
Sbjct  543  SQIVRALEGEVSLDALNEGVKPGQSNIYGSSGASSDYSQTSYNADMKKFRQIALSSTEF  601



>ref|XP_010034842.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Eucalyptus 
grandis]
 gb|KCW53711.1| hypothetical protein EUGRSUZ_J02967 [Eucalyptus grandis]
Length=544

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
            F +DSLVDWARPLL  ALE   F+ +VDP+L  D++  +M RMIACAAA VRHSAR RP 
Sbjct  380  FDEDSLVDWARPLLTEALEGDKFDAIVDPKLNKDYDTEDMTRMIACAAACVRHSARHRPP  439

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            M+QVV+ALEG++SLS+L EGI PGHS  Y    ESS+YD  Q  ED   F+  AL SQE 
Sbjct  440  MTQVVQALEGNLSLSNLKEGIMPGHSRVYNRC-ESSEYDTNQDQEDSMIFKMRALESQEQ  498

Query  459  GSTGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
             +T ++S P SE  L P  SSS G QTTQE +MG+M +D
Sbjct  499  -ATSEFSCPYSEDDLQPYNSSSGGQQTTQERDMGKMAED  536



>ref|XP_002882234.1| hypothetical protein ARALYDRAFT_896220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58493.1| hypothetical protein ARALYDRAFT_896220 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            M+ SLVDWARPL  +A +DG++N L D RLE ++NH EM++M +CAAA++RHS RRRP+M
Sbjct  51   MEYSLVDWARPLCLKAAQDGDYNQLADLRLELNYNHQEMVQMASCAAAAIRHSTRRRPKM  110

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEGDMS+ DL+EG RPG S        SS+Y+A  Y  DMKKF+K+AL ++EY 
Sbjct  111  SQIVRALEGDMSMDDLSEGTRPGQSKYLRPGSVSSEYNASSYTADMKKFKKLALENKEYQ  170

Query  456  STGQYSNPTSEYGLNP  409
            S+ +Y   TSEYGLNP
Sbjct  171  SS-EYGG-TSEYGLNP  184



>ref|XP_010649160.1| PREDICTED: proline-rich receptor-like protein kinase PERK4 isoform 
X1 [Vitis vinifera]
Length=635

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = -2

Query  819  FMDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrpr  640
              ++SLVDWARPLL RAL DGN++ LVD  LEN++N  EM RM+ACAAAS+RHSA+RRP+
Sbjct  491  IFEESLVDWARPLLSRALADGNYDELVDRFLENNYNTQEMARMVACAAASIRHSAKRRPK  550

Query  639  mSQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEY  460
            MSQ+VRALEGD+SL DLN+  +   S AY +S  SS+Y+   YN DM+KF+KMAL SQE+
Sbjct  551  MSQIVRALEGDVSLEDLNDVTKTNQSPAYSTSM-SSEYNTRMYNADMEKFKKMALSSQEF  609

Query  459  GSTGQYSNPTSEYGLNPSGS  400
            GS+    + TSEYG NPS S
Sbjct  610  GSS---EDGTSEYGQNPSSS  626



>emb|CAN75405.1| hypothetical protein VITISV_010509 [Vitis vinifera]
Length=603

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 114/157 (73%), Gaps = 3/157 (2%)
 Frame = -2

Query  813  DDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprmS  634
            ++S+VDWARPLL +ALE+  ++ LVDP L+ D+N+NEM RM+ACAA  VR+ AR RPRMS
Sbjct  441  NESIVDWARPLLTQALEESKYDALVDPNLQKDYNYNEMARMVACAAVCVRYLARLRPRMS  500

Query  633  QVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYGS  454
            QVVRALEG++ L DLNEGI PGHS ++   Y SSD D +  +ED+KKFRKMAL S E G 
Sbjct  501  QVVRALEGNLPLDDLNEGIIPGHS-SFHCRYGSSDDDTIHGSEDLKKFRKMALESHEQGR  559

Query  453  TGQYSNPTSEYGLNPSGSSSEG-QTTQEMEMGRMRKD  346
              + + P S    + S SS EG QT +E+EM + +++
Sbjct  560  I-ECTVPISASDPHTSNSSFEGQQTCKEVEMEKHKEN  595



>emb|CDY66134.1| BnaCnng49640D [Brassica napus]
Length=920

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  816  MDDSLVDWARPLLHRALEDGNFNTLVDPRLENDFNHNEMLRMIacaaasvrhsarrrprm  637
            MDD+LVDWARP++ RALE+GNFN L D RLE ++N  EM RM+ CAAAS+RHS R+RP+M
Sbjct  484  MDDTLVDWARPIMVRALEEGNFNELADVRLEGNYNPQEMARMVTCAAASIRHSGRKRPKM  543

Query  636  SQVVRALEGDMSLSDLNEGIRPGHSAAYGSSYESSDYDAMQYNEDMKKFRKMALGSQEYG  457
            SQ+VRALEG++SL  L EG++PGHS  YG+S  SSDY    YN DMKKFR++AL SQ++ 
Sbjct  544  SQIVRALEGEVSLDVLYEGVKPGHSNIYGTSGTSSDYSQTSYNADMKKFRQIALSSQDFQ  603

Query  456  ST  451
            S+
Sbjct  604  SS  605



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104