BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8429

Length=888
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001065797.2|  Os11g0157000                                       230   5e-64   
gb|AAX92941.1|  retrotransposon protein, putative, Ty1-copia sub-...    229   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85194.1|  putative polyprotein                                    227   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|AAT44282.1|  putative polyprotein                                    226   4e-63   Oryza sativa Japonica Group [Japonica rice]
emb|CAN65222.1|  hypothetical protein VITISV_038665                     226   1e-62   Vitis vinifera
gb|AAM08562.1|AC092749_15  Putative retroelement                        222   2e-61   Oryza sativa Japonica Group [Japonica rice]
emb|CAH65740.1|  OSIGBa0127D24.3                                        219   4e-61   Oryza sativa [red rice]
gb|AAM91886.1|  putative polyprotein                                    219   3e-60   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66022.1|  OSIGBa0105O19.1                                        216   3e-60   Oryza sativa [red rice]
gb|ABD32732.1|  hypothetical protein MtrDRAFT_AC150777g7v1              213   3e-60   Medicago truncatula
emb|CAD40363.2|  OSJNBa0093P23.9                                        216   3e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54315.2|  retrotransposon protein, putative, Ty1-copia subc...    218   3e-60   Oryza sativa Japonica Group [Japonica rice]
gb|ABO36622.1|  copia LTR rider                                         216   2e-59   Solanum lycopersicum
ref|XP_006651032.1|  PREDICTED: uncharacterized protein LOC102707106    213   3e-58   
gb|AAX96781.1|  retrotransposon protein, putative, Ty1-copia sub-...    212   4e-58   Oryza sativa Japonica Group [Japonica rice]
emb|CAN61272.1|  hypothetical protein VITISV_039063                     204   3e-55   Vitis vinifera
gb|AAT01387.1|  putative polyprotein                                    202   8e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AAR87163.1|  putative polyprotein                                    202   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97637.1|  retrotransposon protein, putative, Ty1-copia subc...    200   9e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66122.1|  OSIGBa0146N20.7                                        199   1e-53   Oryza sativa [red rice]
gb|ABA98804.1|  retrotransposon protein, putative, Ty1-copia subc...    199   2e-53   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98656.1|  retrotransposon protein, putative, Ty1-copia subc...    198   3e-53   Oryza sativa Japonica Group [Japonica rice]
gb|AAX92861.1|  retrotransposon protein, putative, Ty1-copia sub-...    198   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676254.1|  PREDICTED: uncharacterized protein LOC104892119    198   8e-53   
gb|ABA96191.1|  retrotransposon protein, putative, Ty1-copia subc...    196   1e-52   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99467.1|  retrotransposon protein, putative, Ty1-copia subc...    196   1e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41912.2|  OSJNBa0033G05.13                                       189   4e-50   Oryza sativa Japonica Group [Japonica rice]
emb|CAN61630.1|  hypothetical protein VITISV_003191                     188   9e-50   Vitis vinifera
emb|CAJ86192.1|  H0306F03.15                                            186   3e-49   Oryza sativa [red rice]
emb|CAJ86151.1|  H0413E07.4                                             186   5e-49   Oryza sativa [red rice]
gb|AAP53216.2|  retrotransposon protein, putative, Ty1-copia subc...    186   5e-49   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ09951.2|  putative gag-pol polyprotein                           185   2e-48   Citrus sinensis [apfelsine]
gb|ABA96718.1|  retrotransposon protein, putative, Ty1-copia subc...    181   2e-47   Oryza sativa Japonica Group [Japonica rice]
gb|AER13159.1|  putative Ty-1 copia retrotransposon                     180   2e-47   Phaseolus vulgaris [French bean]
gb|ACL97384.1|  Gag-Pol polyprotein                                     181   3e-47   Medicago truncatula
emb|CAI44659.1|  OSJNBa0061C06.9                                        180   5e-47   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB09923.1|  copia-like retrotransposable element                   180   7e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDN96898.1|  putative Ty-1 copia retrotransposon                    176   3e-46   Phaseolus vulgaris [French bean]
gb|ACL97383.1|  Gag-Pol polyprotein                                     178   5e-46   Medicago truncatula
gb|AAK52561.1|AC079853_14  Putative retroelement pol polyprotein        177   9e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ACL97386.1|  Gag-Pol polyprotein                                     176   2e-45   Medicago truncatula
gb|AAL91607.1|AC099400_13  Putative pol polyprotein                     175   2e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70013.1|  hypothetical protein VITISV_017116                     173   7e-45   Vitis vinifera
gb|ACL97385.1|  Gag-Pol polyprotein                                     174   8e-45   Medicago truncatula
gb|AAD32759.1|  putative retroelement pol polyprotein                   172   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ACS74199.1|  putative gag-pol polyprotein                            172   5e-44   Fragaria x ananassa
emb|CAN69199.1|  hypothetical protein VITISV_025494                     167   9e-44   Vitis vinifera
emb|CAE02229.2|  OSJNBb0015C06.7                                        169   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107606.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   4e-42   
gb|ACL97387.1|  Gag-Pol polyprotein                                     166   5e-42   Lotus japonicus
emb|CAN60570.1|  hypothetical protein VITISV_000227                     161   2e-41   Vitis vinifera
dbj|BAD34493.1|  Gag-Pol                                                164   4e-41   Ipomoea batatas [batate]
gb|AAD19773.1|  putative retroelement pol polyprotein                   162   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016583.1|  Uncharacterized protein TCM_041944                 158   3e-40   
ref|XP_008374274.1|  PREDICTED: lysosomal alpha-mannosidase-like        159   5e-40   
gb|ABA97036.1|  retrotransposon protein, putative, Ty1-copia subc...    159   5e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097937.1|  Retrovirus-related Pol polyprotein from tran...    160   8e-40   
emb|CDP17738.1|  unnamed protein product                                158   8e-40   Coffea canephora [robusta coffee]
gb|AFB73912.1|  polyprotein                                             160   9e-40   Citrus sinensis [apfelsine]
dbj|BAA96887.1|  copia-like retroelement pol polyprotein                157   7e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AFB73911.1|  polyprotein                                             155   3e-38   Citrus sinensis [apfelsine]
emb|CAN74624.1|  hypothetical protein VITISV_024822                     155   3e-38   Vitis vinifera
emb|CAN72400.1|  hypothetical protein VITISV_041204                     154   5e-38   Vitis vinifera
emb|CDP17739.1|  unnamed protein product                                149   9e-38   Coffea canephora [robusta coffee]
emb|CAN69340.1|  hypothetical protein VITISV_032634                     154   1e-37   Vitis vinifera
gb|AAD23690.1|  putative retroelement pol polyprotein                   154   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAT44257.1|  putative polyprotein                                    152   2e-37   Oryza sativa Japonica Group [Japonica rice]
gb|AAC62132.1|  copia-like retroelement pol polyprotein                 152   3e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74341.1|  hypothetical protein VITISV_043997                     152   4e-37   Vitis vinifera
emb|CAN65504.1|  hypothetical protein VITISV_028342                     152   5e-37   Vitis vinifera
emb|CAN71109.1|  hypothetical protein VITISV_001479                     152   5e-37   Vitis vinifera
emb|CAN74198.1|  hypothetical protein VITISV_005765                     151   5e-37   Vitis vinifera
emb|CAN76321.1|  hypothetical protein VITISV_044445                     151   9e-37   Vitis vinifera
emb|CAA37919.1|  unnamed protein product                                142   9e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74702.1|  hypothetical protein VITISV_023139                     150   1e-36   Vitis vinifera
gb|AAK38381.1|AC079028_5  polyprotein, putative                         149   2e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CAN60396.1|  hypothetical protein VITISV_018063                     149   3e-36   Vitis vinifera
emb|CAN69431.1|  hypothetical protein VITISV_024659                     149   3e-36   Vitis vinifera
emb|CAA20201.1|  putative transposable element                          149   5e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73240.1|  hypothetical protein VITISV_035336                     148   6e-36   Vitis vinifera
ref|NP_001172143.1|  Os01g0116166                                       147   7e-36   
ref|XP_004509781.1|  PREDICTED: uncharacterized protein LOC101498326    145   7e-36   
emb|CAN61548.1|  hypothetical protein VITISV_043524                     148   8e-36   Vitis vinifera
emb|CAN78199.1|  hypothetical protein VITISV_041785                     147   8e-36   Vitis vinifera
emb|CAN81130.1|  hypothetical protein VITISV_003944                     147   1e-35   Vitis vinifera
emb|CAN69096.1|  hypothetical protein VITISV_025437                     146   2e-35   Vitis vinifera
sp|P10978.1|POLX_TOBAC  RecName: Full=Retrovirus-related Pol poly...    147   2e-35   Nicotiana tabacum [American tobacco]
emb|CAN67882.1|  hypothetical protein VITISV_022356                     146   3e-35   Vitis vinifera
emb|CAB75481.1|  copia-like polyprotein                                 146   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007012410.1|  Uncharacterized protein TCM_037378                 139   8e-35   
emb|CAN68388.1|  hypothetical protein VITISV_038864                     145   9e-35   Vitis vinifera
emb|CAN76274.1|  hypothetical protein VITISV_008497                     144   1e-34   Vitis vinifera
gb|AAK29467.1|  polyprotein-like                                        144   2e-34   Solanum chilense
ref|WP_044909017.1|  hypothetical protein, partial [                    133   2e-34   
gb|AAD17414.1|  copia-like retroelement pol polyprotein                 144   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ADG59810.1|  gag-pol polyprotein                                     134   2e-34   Fraxinus excelsior
emb|CAN61435.1|  hypothetical protein VITISV_033767                     144   2e-34   Vitis vinifera
emb|CAN76388.1|  hypothetical protein VITISV_037906                     144   2e-34   Vitis vinifera
emb|CAN78195.1|  hypothetical protein VITISV_008799                     143   3e-34   Vitis vinifera
emb|CAN60331.1|  hypothetical protein VITISV_024553                     144   3e-34   Vitis vinifera
ref|XP_008778480.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    143   4e-34   
emb|CAN80650.1|  hypothetical protein VITISV_022906                     142   6e-34   Vitis vinifera
emb|CAN71029.1|  hypothetical protein VITISV_001707                     142   9e-34   Vitis vinifera
ref|XP_012075359.1|  PREDICTED: uncharacterized protein LOC105636646    142   1e-33   
emb|CAA31653.1|  polyprotein                                            140   4e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAN84102.1|  hypothetical protein VITISV_041248                     139   5e-33   Vitis vinifera
emb|CAN66743.1|  hypothetical protein VITISV_043469                     139   7e-33   Vitis vinifera
emb|CCI55401.1|  PH01B015M02.2                                          140   7e-33   Phyllostachys edulis [kikko-chiku]
gb|AAF19226.1|AC007505_2  Highly similar to Ta1-3 polyprotein           139   1e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74382.1|  hypothetical protein VITISV_007945                     135   2e-32   Vitis vinifera
gb|AAV88069.1|  hypothetical retrotransposon                            139   2e-32   Ipomoea batatas [batate]
emb|CAN69974.1|  hypothetical protein VITISV_014388                     138   2e-32   Vitis vinifera
emb|CAN69680.1|  hypothetical protein VITISV_003773                     137   4e-32   Vitis vinifera
emb|CAN66588.1|  hypothetical protein VITISV_017097                     136   6e-32   Vitis vinifera
emb|CAN71161.1|  hypothetical protein VITISV_009113                     136   9e-32   Vitis vinifera
emb|CAN65406.1|  hypothetical protein VITISV_030853                     135   2e-31   Vitis vinifera
emb|CAN62181.1|  hypothetical protein VITISV_044399                     135   2e-31   Vitis vinifera
gb|ABA93547.1|  retrotransposon protein, putative, Ty1-copia subc...    132   2e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CAN65867.1|  hypothetical protein VITISV_034935                     135   2e-31   Vitis vinifera
emb|CAN77602.1|  hypothetical protein VITISV_024474                     135   2e-31   Vitis vinifera
emb|CAN59811.1|  hypothetical protein VITISV_006540                     134   3e-31   Vitis vinifera
pir||S23319  hypothetical protein 2 - Arabidopsis thaliana retrot...    134   4e-31
dbj|BAA11674.1|  unnamed protein product                                134   4e-31   Nicotiana tabacum [American tobacco]
emb|CAB40039.1|  putative retrotransposon                               134   5e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CAN80993.1|  hypothetical protein VITISV_022128                     133   8e-31   Vitis vinifera
emb|CAN70932.1|  hypothetical protein VITISV_040966                     133   9e-31   Vitis vinifera
gb|AIC77183.1|  polyprotein                                             133   1e-30   Gossypium barbadense [Egyptian cotton]
emb|CAN66323.1|  hypothetical protein VITISV_007384                     133   1e-30   Vitis vinifera
emb|CAN67605.1|  hypothetical protein VITISV_030993                     132   1e-30   Vitis vinifera
gb|ABA99474.1|  retrotransposon protein, putative, Ty1-copia subc...    132   2e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CAN68837.1|  hypothetical protein VITISV_035956                     129   2e-30   Vitis vinifera
emb|CAN80490.1|  hypothetical protein VITISV_004703                     131   2e-30   Vitis vinifera
ref|XP_008388992.1|  PREDICTED: uncharacterized protein LOC103451356    131   3e-30   
emb|CAA69272.1|  lectin receptor kinase                                 129   4e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62595.1|  hypothetical protein VITISV_023519                     130   7e-30   Vitis vinifera
emb|CAN61670.1|  hypothetical protein VITISV_040427                     128   9e-30   Vitis vinifera
emb|CAN78192.1|  hypothetical protein VITISV_036909                     130   1e-29   Vitis vinifera
emb|CAN66898.1|  hypothetical protein VITISV_037436                     130   1e-29   Vitis vinifera
emb|CAB75469.1|  copia-type reverse transcriptase-like protein          130   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAG60117.1|AC073555_1  copia-type polyprotein, putative              129   2e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71313.1|  hypothetical protein VITISV_019316                     129   2e-29   Vitis vinifera
gb|AAF16534.1|AC013482_8  T26F17.17                                     129   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006590177.1|  PREDICTED: uncharacterized protein LOC102669657    128   2e-29   
gb|AAG50698.1|AC079604_5  copia-type polyprotein, putative              129   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008372204.1|  PREDICTED: uncharacterized protein LOC103435597    129   3e-29   
gb|ADN34143.1|  copia-type polyprotein                                  121   5e-29   Cucumis melo subsp. melo
gb|EZA50979.1|  Copia protein                                           120   6e-29   Ooceraea biroi
gb|ABR16307.1|  unknown                                                 124   6e-29   Picea sitchensis
emb|CAN77659.1|  hypothetical protein VITISV_030914                     126   6e-29   Vitis vinifera
emb|CAB71063.1|  copia-type polyprotein                                 128   7e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAD50001.1|AC007259_14  Hypothetical protein                         127   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009348351.1|  PREDICTED: uncharacterized protein LOC103939989    127   1e-28   
ref|XP_008387850.1|  PREDICTED: uncharacterized protein LOC103450292    126   1e-28   
emb|CAN80930.1|  hypothetical protein VITISV_005279                     127   1e-28   Vitis vinifera
emb|CAN77765.1|  hypothetical protein VITISV_021568                     124   2e-28   Vitis vinifera
emb|CAN82357.1|  hypothetical protein VITISV_005778                     125   3e-28   Vitis vinifera
gb|KDQ06095.1|  hypothetical protein BOTBODRAFT_82766                   117   3e-28   Botryobasidium botryosum FD-172 SS1
ref|XP_010274086.1|  PREDICTED: uncharacterized protein LOC104609460    123   3e-28   
emb|CAN75440.1|  hypothetical protein VITISV_007304                     125   4e-28   Vitis vinifera
emb|CAN75261.1|  hypothetical protein VITISV_041144                     124   4e-28   Vitis vinifera
emb|CAN63196.1|  hypothetical protein VITISV_035792                     125   5e-28   Vitis vinifera
ref|XP_008213150.1|  PREDICTED: retrovirus-related Pol polyprotei...    125   5e-28   Nasonia vitripennis
emb|CAN72238.1|  hypothetical protein VITISV_010775                     124   7e-28   Vitis vinifera
emb|CAN70871.1|  hypothetical protein VITISV_000567                     122   7e-28   Vitis vinifera
emb|CAN68235.1|  hypothetical protein VITISV_037104                     125   8e-28   Vitis vinifera
emb|CAN79540.1|  hypothetical protein VITISV_016973                     123   8e-28   Vitis vinifera
emb|CAN66809.1|  hypothetical protein VITISV_010919                     124   8e-28   Vitis vinifera
ref|XP_008338000.1|  PREDICTED: uncharacterized protein LOC103401070    124   1e-27   
emb|CAN70420.1|  hypothetical protein VITISV_033745                     115   2e-27   Vitis vinifera
gb|ABB47665.1|  retrotransposon protein, putative, unclassified, ...    124   2e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CAN77122.1|  hypothetical protein VITISV_013624                     124   2e-27   Vitis vinifera
ref|NP_001175213.1|  Os07g0500000                                       122   2e-27   
emb|CAN75724.1|  hypothetical protein VITISV_040386                     122   2e-27   Vitis vinifera
emb|CAN76896.1|  hypothetical protein VITISV_010605                     123   2e-27   Vitis vinifera
gb|KFK24421.1|  hypothetical protein AALP_AAs56100U000100               120   2e-27   Arabis alpina [alpine rockcress]
emb|CDO76211.1|  hypothetical protein BN946_scf184602.g1                122   3e-27   Trametes cinnabarina
ref|XP_011551371.1|  PREDICTED: uncharacterized protein LOC105383056    123   3e-27   Plutella xylostella [cabbage moth]
emb|CAN60145.1|  hypothetical protein VITISV_019412                     123   3e-27   Vitis vinifera
emb|CAN74767.1|  hypothetical protein VITISV_041860                     123   3e-27   Vitis vinifera
ref|XP_010534024.1|  PREDICTED: uncharacterized protein LOC104809678    123   4e-27   
ref|XP_008337163.1|  PREDICTED: uncharacterized protein LOC103400289    119   5e-27   
emb|CAN72453.1|  hypothetical protein VITISV_008931                     121   7e-27   Vitis vinifera
emb|CAN63536.1|  hypothetical protein VITISV_002860                     121   7e-27   Vitis vinifera
emb|CAN83869.1|  hypothetical protein VITISV_037705                     121   9e-27   Vitis vinifera
emb|CAN79061.1|  hypothetical protein VITISV_024577                     121   9e-27   Vitis vinifera
gb|ABA91380.1|  retrotransposon protein, putative, Ty1-copia subc...    121   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356174.1|  PREDICTED: uncharacterized protein LOC103419864    121   1e-26   
ref|XP_006590044.1|  PREDICTED: uncharacterized protein LOC102665857    120   1e-26   
emb|CAN69998.1|  hypothetical protein VITISV_006839                     121   1e-26   Vitis vinifera
emb|CAN79644.1|  hypothetical protein VITISV_033788                     121   1e-26   Vitis vinifera
emb|CAN71038.1|  hypothetical protein VITISV_011062                     119   2e-26   Vitis vinifera
emb|CAN66213.1|  hypothetical protein VITISV_005090                     117   2e-26   Vitis vinifera
emb|CAN73703.1|  hypothetical protein VITISV_000540                     119   2e-26   Vitis vinifera
emb|CDO68437.1|  hypothetical protein BN946_scf184707.g18               120   2e-26   Trametes cinnabarina
emb|CAN72676.1|  hypothetical protein VITISV_020406                     120   2e-26   Vitis vinifera
ref|XP_011459846.1|  PREDICTED: uncharacterized protein LOC105350128    119   2e-26   Fragaria vesca subsp. vesca
emb|CAN74160.1|  hypothetical protein VITISV_018405                     120   3e-26   Vitis vinifera
emb|CAN71037.1|  hypothetical protein VITISV_011061                     120   3e-26   Vitis vinifera
emb|CAN76611.1|  hypothetical protein VITISV_040103                     117   3e-26   Vitis vinifera
gb|AAL58228.1|AC084762_2  putative gag-pol polyprotein                  119   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAL56548.1|AF387862_2  pol polyprotein                               119   4e-26   Anopheles gambiae
emb|CAN60238.1|  hypothetical protein VITISV_032906                     119   4e-26   Vitis vinifera
emb|CAN71759.1|  hypothetical protein VITISV_020777                     119   4e-26   Vitis vinifera
emb|CAN70570.1|  hypothetical protein VITISV_043111                     119   4e-26   Vitis vinifera
gb|ABA99612.1|  retrotransposon protein, putative, unclassified         119   5e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CDO76881.1|  hypothetical protein BN946_scf184903.g2                115   5e-26   Trametes cinnabarina
gb|KFK32108.1|  hypothetical protein AALP_AA6G199700                    119   6e-26   Arabis alpina [alpine rockcress]
gb|AAT38758.1|  Putative gag-pol polyprotein, identical                 119   8e-26   Solanum demissum
emb|CAN83125.1|  hypothetical protein VITISV_015109                     119   9e-26   Vitis vinifera
emb|CAN74280.1|  hypothetical protein VITISV_010268                     117   1e-25   Vitis vinifera
gb|KIJ26272.1|  hypothetical protein M422DRAFT_89282                    109   1e-25   Sphaerobolus stellatus SS14
ref|XP_008480740.1|  PREDICTED: uncharacterized protein LOC103517484    118   1e-25   
emb|CAN83966.1|  hypothetical protein VITISV_016198                     117   1e-25   Vitis vinifera
gb|EFA07744.1|  hypothetical protein TcasGA2_TC002224                   119   1e-25   
emb|CDO76035.1|  hypothetical protein BN946_scf184818.g3                118   1e-25   Trametes cinnabarina
gb|ADK92880.1|  retrotransposon 4 protein                               118   1e-25   Hypericum perforatum
gb|ABW74566.1|  integrase                                               118   1e-25   Boechera divaricarpa
gb|ACN78973.1|  copia-type polyprotein                                  118   1e-25   Glycine max [soybeans]
gb|AAP46257.1|  putative polyprotein                                    118   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008369160.1|  PREDICTED: uncharacterized protein LOC103432739    117   2e-25   
gb|AAD36943.1|AF069441_3  putative polyprotein                          117   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFD72989.1|  hypothetical protein M514_12352                         117   2e-25   Trichuris suis
dbj|BAB01972.1|  copia-like retrotransposable element                   117   2e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81839.1|  hypothetical protein VITISV_033739                     117   2e-25   Vitis vinifera
gb|KFD61291.1|  hypothetical protein M514_26539                         117   3e-25   Trichuris suis
gb|KFD64618.1|  hypothetical protein M514_23220                         117   3e-25   Trichuris suis
gb|AAL75752.1|AC037197_10  Putative copia-type polyprotein              117   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95820.1|  retrotransposon protein, putative, unclassified         117   3e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04331.1|  OSJNBb0016D16.22                                       117   3e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAN80304.1|  hypothetical protein VITISV_017821                     116   3e-25   Vitis vinifera
ref|XP_008669041.1|  PREDICTED: uncharacterized protein LOC103646095    115   3e-25   
emb|CAN82574.1|  hypothetical protein VITISV_034720                     117   4e-25   Vitis vinifera
emb|CAH66391.1|  OSIGBa0134J07.9                                        117   4e-25   Oryza sativa [red rice]
emb|CAD41085.2|  OSJNBb0011N17.2                                        116   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93686.1|  retrotransposon protein, putative, Ty1-copia subc...    115   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AAP46207.1|  putative retrotransposon protein                        116   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|AGW47867.1|  polyprotein                                             116   6e-25   Phaseolus vulgaris [French bean]
gb|AAL68641.1|AF458765_1  polyprotein                                   116   6e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EFA12979.1|  hypothetical protein TcasGA2_TC004282                   116   6e-25   
gb|EFA05312.1|  hypothetical protein TcasGA2_TC015470                   116   7e-25   
emb|CAN70446.1|  hypothetical protein VITISV_026192                     111   8e-25   Vitis vinifera
ref|XP_003376808.1|  retrovirus-related Pol polyprotein from tran...    115   8e-25   Trichinella spiralis
gb|KDQ18753.1|  hypothetical protein BOTBODRAFT_82843                   109   9e-25   Botryobasidium botryosum FD-172 SS1
emb|CAE03128.3|  OJ000114_01.9                                          115   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAT93883.1|  putative polyprotein                                    115   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAG60200.1|AC084763_20  putative gag-pol polyprotein                 115   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAN05503.1|  Putative gag-pol polyprotein                            115   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175469.1|  Os08g0248500                                       115   1e-24   
gb|EFA07743.1|  hypothetical protein TcasGA2_TC002223                   115   1e-24   
emb|CAN60366.1|  hypothetical protein VITISV_031870                     115   1e-24   Vitis vinifera
emb|CAN62421.1|  hypothetical protein VITISV_020606                     115   1e-24   Vitis vinifera
emb|CAN62116.1|  hypothetical protein VITISV_011012                     113   1e-24   Vitis vinifera
gb|AAK12626.1|  unknown protein                                         115   2e-24   Aedes aegypti
gb|EPS68442.1|  hypothetical protein M569_06327                         111   2e-24   Genlisea aurea
gb|AAO20078.1|  putative polyprotein                                    114   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAG51247.1|AC055769_6  copia-type polyprotein, putative; 28768...    114   3e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11200.1|  copia-type polyprotein                                 114   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAF25964.2|AC017118_1  F6N18.1                                       114   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55241.1|AF295693_1  polyprotein                                   113   3e-24   Anopheles gambiae
ref|XP_006606789.1|  PREDICTED: uncharacterized protein LOC102659515    112   3e-24   
ref|XP_008372142.1|  PREDICTED: uncharacterized protein LOC103435525    114   3e-24   
emb|CCM06583.1|  predicted protein                                      114   3e-24   Fibroporia radiculosa
emb|CAN62728.1|  hypothetical protein VITISV_003090                     112   4e-24   Vitis vinifera
emb|CAH66624.1|  OSIGBa0115A19.5                                        114   4e-24   Oryza sativa [red rice]
ref|NP_001064098.1|  Os10g0130700                                       114   4e-24   
gb|ADB85424.1|  putative retrotransposon protein                        114   4e-24   Phyllostachys edulis [kikko-chiku]
ref|XP_008462933.1|  PREDICTED: uncharacterized protein LOC103501196    112   4e-24   Cucumis melo [Oriental melon]
gb|ABA96719.2|  retrotransposon protein, putative, unclassified         114   5e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAO17005.1|  Putative gag-pol polyprotein                            114   5e-24   Oryza sativa Japonica Group [Japonica rice]
gb|AAU90089.1|  putative polyprotein                                    113   5e-24   Oryza sativa Japonica Group [Japonica rice]
emb|CAB75932.1|  putative protein                                       113   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|WP_036673399.1|  hypothetical protein                               109   5e-24   
emb|CAN70024.1|  hypothetical protein VITISV_030172                     113   6e-24   Vitis vinifera
emb|CAA36615.1|  unnamed protein product                                112   6e-24   Solanum tuberosum [potatoes]
ref|XP_006485859.1|  PREDICTED: uncharacterized protein LOC102626627    113   6e-24   
gb|AAL79695.1|AC087599_14  putative gag-pol polyprotein                 113   7e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003376336.1|  retrovirus-related Pol polyprotein from tran...    112   7e-24   Trichinella spiralis
emb|CCI55340.1|  PH01B019A14.9                                          113   8e-24   Phyllostachys edulis [kikko-chiku]
ref|XP_010034499.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    113   8e-24   
emb|CAN65377.1|  hypothetical protein VITISV_014188                     112   8e-24   
dbj|BAG94704.1|  unnamed protein product                                112   8e-24   
ref|XP_008807850.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    113   8e-24   
ref|NP_001059837.1|  Os07g0528100                                       112   9e-24   
ref|XP_002064813.1|  GK15001                                            112   1e-23   
gb|AAK92587.1|AC074354_21  Putative retroelement                        112   1e-23   
emb|CAN65321.1|  hypothetical protein VITISV_028038                     109   1e-23   
emb|CAA49283.1|  gag,protease,endonuclease, reverse transcriptase...    112   1e-23   
emb|CAN64779.1|  hypothetical protein VITISV_043230                     112   1e-23   
emb|CAN82637.1|  hypothetical protein VITISV_028818                     112   1e-23   
emb|CAE75905.1|  OSJNBa0088I22.18                                       110   1e-23   
emb|CAN62884.1|  hypothetical protein VITISV_039744                     112   2e-23   
emb|CAN66959.1|  hypothetical protein VITISV_013138                     112   2e-23   
gb|AAC26250.1|  contains similarity to reverse transcriptase (Pfa...    111   2e-23   
gb|ABA95799.2|  retrotransposon protein, putative, unclassified, ...    112   2e-23   
ref|XP_008237766.1|  PREDICTED: uncharacterized protein LOC103336496    112   2e-23   
ref|XP_010239539.1|  PREDICTED: uncharacterized protein LOC104585207    111   2e-23   
emb|CAD41731.1|  OSJNBb0034I13.10                                       111   2e-23   
ref|XP_009757763.1|  PREDICTED: uncharacterized protein LOC104210538    109   3e-23   
emb|CAN74050.1|  hypothetical protein VITISV_040588                     111   3e-23   
ref|XP_008337255.1|  PREDICTED: retrovirus-related Pol polyprotei...    111   3e-23   
ref|XP_008245036.1|  PREDICTED: uncharacterized protein LOC103343139    110   3e-23   
gb|AAP21414.1|  putative polyprotein                                    111   3e-23   
emb|CAN81916.1|  hypothetical protein VITISV_038548                     111   3e-23   
emb|CAN74286.1|  hypothetical protein VITISV_036410                     111   3e-23   
emb|CBI37296.3|  unnamed protein product                                111   3e-23   
emb|CAN66710.1|  hypothetical protein VITISV_006397                     110   3e-23   
emb|CAH66352.1|  OSIGBa0135C09.3                                        111   3e-23   
gb|EZA52811.1|  Copia protein                                           103   4e-23   
emb|CAN74964.1|  hypothetical protein VITISV_006810                     110   4e-23   
gb|EEE52905.1|  hypothetical protein OsJ_35506                          110   4e-23   
ref|XP_006606751.1|  PREDICTED: uncharacterized protein LOC102660221    109   4e-23   
gb|ABA94321.1|  retrotransposon protein, putative, unclassified         110   4e-23   
emb|CAE03644.2|  OSJNBa0060N03.9                                        110   4e-23   
emb|CAN74442.1|  hypothetical protein VITISV_031467                     109   4e-23   
ref|XP_009371068.1|  PREDICTED: uncharacterized protein LOC103960338    110   5e-23   
emb|CAN66566.1|  hypothetical protein VITISV_018543                     106   5e-23   
emb|CAN72663.1|  hypothetical protein VITISV_031849                     110   5e-23   
emb|CAN69184.1|  hypothetical protein VITISV_004341                     110   5e-23   
ref|XP_010451299.1|  PREDICTED: uncharacterized protein LOC104733420    109   5e-23   
ref|XP_001642260.1|  Tkp5 protein                                       110   6e-23   
emb|CAN76680.1|  hypothetical protein VITISV_034326                     109   6e-23   
gb|ABR67407.1|  integrase                                               110   6e-23   
emb|CAN79930.1|  hypothetical protein VITISV_007488                     110   7e-23   
gb|AAG52949.1|  gag/pol polyprotein                                     110   7e-23   
gb|ABA95230.1|  retrotransposon protein, putative, unclassified         109   7e-23   
ref|XP_001642228.1|  Tkp5 protein                                       110   7e-23   
ref|XP_010536291.1|  PREDICTED: uncharacterized protein LOC104811331    109   7e-23   
ref|XP_002464673.1|  hypothetical protein SORBIDRAFT_01g023130          109   8e-23   
ref|XP_772253.1|  hypothetical protein CNBM0210                         110   8e-23   
ref|XP_009796172.1|  PREDICTED: uncharacterized protein LOC104242792    107   8e-23   
gb|KIP03168.1|  hypothetical protein PHLGIDRAFT_78019                   109   8e-23   
ref|XP_009362284.1|  PREDICTED: reticuline oxidase-like protein         109   8e-23   
gb|AAL31093.1|AC091749_22  putative retrotransposon-related protein     109   8e-23   
gb|AFG24185.1|  gag-pol polyprotein                                     109   9e-23   
emb|CAN80547.1|  hypothetical protein VITISV_010898                     109   9e-23   
emb|CAN64827.1|  hypothetical protein VITISV_030308                     109   9e-23   
emb|CAN76032.1|  hypothetical protein VITISV_040150                     109   9e-23   
emb|CAN62074.1|  hypothetical protein VITISV_001619                     109   9e-23   
gb|EZA58507.1|  Eukaryotic translation initiation factor 3 subunit A    109   9e-23   
emb|CAN71748.1|  hypothetical protein VITISV_019194                     109   9e-23   
gb|ABI34329.1|  Integrase core domain containing protein                109   9e-23   
emb|CAN73101.1|  hypothetical protein VITISV_042890                     108   1e-22   
emb|CAN70260.1|  hypothetical protein VITISV_002223                     109   1e-22   
emb|CAN60609.1|  hypothetical protein VITISV_036599                     109   1e-22   
emb|CAE03692.2|  OSJNBb0026E15.10                                       109   1e-22   
ref|XP_008372614.1|  PREDICTED: uncharacterized protein LOC103435964    106   1e-22   
ref|XP_008662660.1|  PREDICTED: collagen alpha-1(I) chain-like is...    106   1e-22   
gb|ABY49842.1|  hypothetical protein                                    109   1e-22   
emb|CAN76133.1|  hypothetical protein VITISV_036298                     109   1e-22   
emb|CAN77568.1|  hypothetical protein VITISV_010611                     109   1e-22   
emb|CAN82064.1|  hypothetical protein VITISV_022772                     109   1e-22   
gb|EFA11976.1|  hypothetical protein TcasGA2_TC001424                   108   1e-22   
emb|CAN74029.1|  hypothetical protein VITISV_013540                     108   1e-22   
ref|XP_004531694.1|  PREDICTED: uncharacterized protein LOC101453534    109   1e-22   
emb|CAN71185.1|  hypothetical protein VITISV_014270                     108   1e-22   
emb|CAN73351.1|  hypothetical protein VITISV_027250                     108   1e-22   
ref|XP_011172516.1|  PREDICTED: retrovirus-related Pol polyprotei...    108   1e-22   
gb|EGU10936.1|  2-hydroxymuconic semialdehyde dehydrogenase             108   1e-22   
emb|CAN61179.1|  hypothetical protein VITISV_032292                     108   1e-22   
emb|CAN84135.1|  hypothetical protein VITISV_000113                     108   2e-22   
emb|CAN78616.1|  hypothetical protein VITISV_003658                     109   2e-22   
emb|CAN61646.1|  hypothetical protein VITISV_019792                     107   2e-22   
emb|CAN76196.1|  hypothetical protein VITISV_041073                     108   2e-22   
emb|CAX68207.1|  Copia-like retrotransposon                             108   2e-22   
emb|CAN71931.1|  hypothetical protein VITISV_013418                     107   2e-22   
emb|CAN76009.1|  hypothetical protein VITISV_025523                     107   2e-22   
ref|XP_007028892.1|  Uncharacterized protein TCM_024822                 105   2e-22   
emb|CAE04751.3|  OSJNBb0060E08.14                                       108   2e-22   
emb|CAN73074.1|  hypothetical protein VITISV_032386                     108   2e-22   
emb|CAN74101.1|  hypothetical protein VITISV_039542                     108   2e-22   
emb|CAN67119.1|  hypothetical protein VITISV_017483                     108   2e-22   
emb|CAN72340.1|  hypothetical protein VITISV_029049                     105   2e-22   
ref|XP_010496878.1|  PREDICTED: uncharacterized protein LOC104773906    107   2e-22   
ref|XP_008654353.1|  PREDICTED: uncharacterized protein LOC100193...    107   2e-22   
ref|NP_001059496.1|  Os07g0434200                                       108   2e-22   
ref|XP_008654354.1|  PREDICTED: uncharacterized protein LOC100193...    107   2e-22   
emb|CAN76439.1|  hypothetical protein VITISV_001759                     107   3e-22   
emb|CAN77110.1|  hypothetical protein VITISV_013963                     105   3e-22   
emb|CAN62535.1|  hypothetical protein VITISV_041880                     108   3e-22   
gb|ABA95797.1|  retrotransposon protein, putative, unclassified         108   3e-22   
emb|CAN66873.1|  hypothetical protein VITISV_021427                     108   3e-22   
emb|CAN77981.1|  hypothetical protein VITISV_043416                     107   3e-22   
ref|XP_010260889.1|  PREDICTED: uncharacterized protein LOC104599848    107   3e-22   
emb|CAN75744.1|  hypothetical protein VITISV_040125                     108   3e-22   
emb|CAN81715.1|  hypothetical protein VITISV_032902                     107   3e-22   
emb|CAN71445.1|  hypothetical protein VITISV_042489                     108   3e-22   
emb|CAN75815.1|  hypothetical protein VITISV_004636                     108   3e-22   
emb|CAN65410.1|  hypothetical protein VITISV_040416                     108   3e-22   
emb|CAN78818.1|  hypothetical protein VITISV_015505                     104   3e-22   
ref|XP_008654352.1|  PREDICTED: uncharacterized protein LOC100193...    107   3e-22   
emb|CAN60930.1|  hypothetical protein VITISV_012765                     108   3e-22   
emb|CAN73189.1|  hypothetical protein VITISV_042346                     107   3e-22   
emb|CAN84036.1|  hypothetical protein VITISV_024166                     108   3e-22   
emb|CAN60274.1|  hypothetical protein VITISV_024841                     108   3e-22   
gb|KDQ62768.1|  hypothetical protein JAAARDRAFT_190048                  105   3e-22   
ref|NP_001173583.1|  Os03g0680566                                       108   3e-22   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...    107   3e-22   
emb|CAN74303.1|  hypothetical protein VITISV_032980                     107   3e-22   
gb|AAK26118.1|AC084406_1  putative gag-pol polyprotein                  108   4e-22   
emb|CBI26492.3|  unnamed protein product                                107   4e-22   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1         107   4e-22   
gb|AAT38797.2|  Polyprotein, putative                                   108   4e-22   
ref|XP_008674201.1|  PREDICTED: uncharacterized protein LOC100279...    107   4e-22   
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...    107   4e-22   
emb|CAN80881.1|  hypothetical protein VITISV_018650                     107   4e-22   
ref|XP_011622181.1|  PREDICTED: LRR receptor-like serine/threonin...    104   4e-22   
emb|CAN74241.1|  hypothetical protein VITISV_006638                     107   4e-22   
gb|ABF98209.1|  retrotransposon protein, putative, Ty1-copia subc...    108   4e-22   
emb|CAE04295.2|  OSJNBa0083I11.5                                        107   4e-22   
emb|CAN67925.1|  hypothetical protein VITISV_021168                     107   4e-22   
ref|XP_007037202.1|  Uncharacterized protein TCM_013805                 107   4e-22   
gb|ABI34342.1|  Polyprotein, putative                                   107   5e-22   
emb|CAN69307.1|  hypothetical protein VITISV_001120                     107   5e-22   
gb|AAG10812.1|AC018460_6  Putative retroelement polyprotein             107   6e-22   
emb|CAN78715.1|  hypothetical protein VITISV_030863                     107   6e-22   
ref|XP_008374275.1|  PREDICTED: retrovirus-related Pol polyprotei...    106   6e-22   
ref|XP_002445205.1|  hypothetical protein SORBIDRAFT_07g005900          106   6e-22   
emb|CAN76326.1|  hypothetical protein VITISV_014220                     107   7e-22   
ref|XP_009759282.1|  PREDICTED: uncharacterized protein LOC104211846    105   7e-22   
ref|XP_002444793.1|  hypothetical protein SORBIDRAFT_07g028153          107   7e-22   
emb|CAN62328.1|  hypothetical protein VITISV_029806                     106   7e-22   
ref|XP_002440449.1|  hypothetical protein SORBIDRAFT_09g001135          104   8e-22   
emb|CAN82928.1|  hypothetical protein VITISV_025045                     107   8e-22   
emb|CAN80285.1|  hypothetical protein VITISV_026753                     107   8e-22   
emb|CAN63881.1|  hypothetical protein VITISV_039357                     107   8e-22   
emb|CAN78598.1|  hypothetical protein VITISV_001332                     107   8e-22   
gb|KIM51512.1|  hypothetical protein SCLCIDRAFT_33370                   105   9e-22   
ref|NP_001064658.2|  Os10g0429700                                       106   9e-22   
emb|CAN62019.1|  hypothetical protein VITISV_019561                     105   9e-22   
gb|AFN88207.1|  integrase core domain containing protein                106   9e-22   
emb|CAN62538.1|  hypothetical protein VITISV_031159                     106   9e-22   
emb|CAH67713.1|  H0512B01.8                                             106   1e-21   
ref|XP_007021177.1|  Uncharacterized protein TCM_031224                 107   1e-21   
emb|CAN63081.1|  hypothetical protein VITISV_016842                     106   1e-21   
emb|CAN75900.1|  hypothetical protein VITISV_033582                     106   1e-21   
ref|XP_003672078.1|  hypothetical protein NDAI_0I02670                  106   1e-21   
emb|CAN80340.1|  hypothetical protein VITISV_015365                     105   1e-21   
emb|CAN67902.1|  hypothetical protein VITISV_037907                     105   1e-21   
pir||S00954  pol polyprotein - fruit fly (Drosophila melanogaster...    105   1e-21
gb|AAZ28936.1|  polyprotein                                             106   1e-21   
emb|CAH66177.1|  OSIGBa0130O15.1                                        106   1e-21   
emb|CAI72292.1|  putative polyprotein                                   106   1e-21   
emb|CDY24759.1|  BnaC04g13640D                                          106   1e-21   
emb|CAN74064.1|  hypothetical protein VITISV_028146                     106   1e-21   
emb|CAE03978.3|  OSJNBa0033H08.2                                        106   1e-21   
ref|NP_001068391.2|  Os11g0656500                                       106   1e-21   
ref|XP_005710287.1|  unnamed protein product                            105   1e-21   
emb|CAN79305.1|  hypothetical protein VITISV_036286                     104   1e-21   
gb|EEC67008.1|  hypothetical protein OsI_33720                          105   1e-21   
gb|AAP53887.2|  retrotransposon protein, putative, Ty1-copia subc...    106   1e-21   
emb|CAN79977.1|  hypothetical protein VITISV_029183                     106   2e-21   
ref|NP_001067439.2|  Os11g0199800                                       105   2e-21   
ref|XP_008677438.1|  PREDICTED: uncharacterized protein LOC100304...    105   2e-21   
gb|AAP44677.1|  putative gag-pol polyprotein                            105   2e-21   
emb|CDO74894.1|  hypothetical protein BN946_scf184988.g1                105   2e-21   
ref|XP_010480845.1|  PREDICTED: uncharacterized protein LOC104759633    105   2e-21   
gb|ABF99351.1|  retrotransposon protein, putative, unclassified         105   2e-21   
ref|XP_002442065.1|  hypothetical protein SORBIDRAFT_08g008672          105   2e-21   
emb|CAN66669.1|  hypothetical protein VITISV_032496                     103   2e-21   
emb|CAN81557.1|  hypothetical protein VITISV_010784                     104   2e-21   
emb|CAE04657.2|  OSJNBa0061G20.13                                       105   2e-21   
emb|CAH66692.1|  OSIGBa0097A15.7                                        105   2e-21   
ref|XP_007015419.1|  Uncharacterized protein TCM_041046                 104   2e-21   
emb|CAN76332.1|  hypothetical protein VITISV_006269                     105   2e-21   
ref|XP_009617429.1|  PREDICTED: uncharacterized protein LOC104109770    102   2e-21   
ref|XP_009356290.1|  PREDICTED: retrovirus-related Pol polyprotei...    105   2e-21   
ref|XP_011553673.1|  PREDICTED: uncharacterized protein LOC105385054    104   2e-21   
ref|XP_010274494.1|  PREDICTED: uncharacterized protein LOC104609809    105   2e-21   
gb|AAR96231.1|  putative integrase                                      105   2e-21   
gb|AAF69172.1|AC007915_24  F27F5.11                                     105   2e-21   
emb|CAN68340.1|  hypothetical protein VITISV_025981                     105   2e-21   
ref|NP_001172816.1|  Os02g0163901                                       104   2e-21   
ref|XP_004989595.1|  hypothetical protein PTSG_12873                    105   2e-21   
ref|XP_003597218.1|  Beta-galactosidase                                 105   2e-21   
emb|CAN79782.1|  hypothetical protein VITISV_002631                     105   2e-21   
gb|AFP55546.1|  gag-pol polyprotein                                     105   2e-21   
emb|CAN79845.1|  hypothetical protein VITISV_027568                     105   2e-21   
ref|NP_001061718.1|  Os08g0389500                                       105   2e-21   
gb|ABA95283.1|  retrotransposon protein, putative, unclassified, ...    105   2e-21   
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    105   2e-21   
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...    105   2e-21   
emb|CAN72018.1|  hypothetical protein VITISV_001841                     105   2e-21   
ref|XP_010520710.1|  PREDICTED: uncharacterized protein LOC104799765    105   2e-21   
ref|XP_004514121.1|  PREDICTED: uncharacterized protein LOC101493292    105   2e-21   
emb|CAN62623.1|  hypothetical protein VITISV_001656                     105   3e-21   
ref|XP_005717319.1|  RNA-dependent DNA polymerase                       105   3e-21   
emb|CAN70689.1|  hypothetical protein VITISV_012155                     105   3e-21   
ref|XP_007359341.1|  rve-domain-containing protein                      100   3e-21   
emb|CAN81139.1|  hypothetical protein VITISV_018760                     105   3e-21   
gb|AAU10819.1|  putative polyprotein                                    105   3e-21   
ref|NP_001068460.1|  Os11g0682500                                       105   3e-21   
emb|CAN66416.1|  hypothetical protein VITISV_044133                     105   3e-21   
emb|CAN60152.1|  hypothetical protein VITISV_021503                     104   3e-21   
ref|XP_007389635.1|  hypothetical protein PHACADRAFT_58680              102   3e-21   
emb|CAN82937.1|  hypothetical protein VITISV_039222                     105   3e-21   
emb|CAN59964.1|  hypothetical protein VITISV_022757                     105   3e-21   
emb|CAN73484.1|  hypothetical protein VITISV_029448                     104   3e-21   
emb|CAN82505.1|  hypothetical protein VITISV_039312                     102   3e-21   
dbj|BAK64102.1|  gag-pol polyprotein                                    105   3e-21   
ref|XP_002453623.1|  hypothetical protein SORBIDRAFT_04g009135          104   3e-21   



>ref|NP_001065797.2| Os11g0157000 [Oryza sativa Japonica Group]
 dbj|BAF27642.2| Os11g0157000 [Oryza sativa Japonica Group]
Length=1601

 Score =   230 bits (586),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 163/243 (67%), Gaps = 19/243 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARC+LSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  591  QQNGVAERMNRTIISKARCLLSNAGLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIEV  648

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  649  WSGSPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  708

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAST---------  376
            ++ F E+ +L     PST     + EK   +      +++     K+D +          
Sbjct  709  NVVFHESVMLHDK--PSTNVPVESQEKASVQV--EHLISSGHAPEKEDVAINQDEPVIED  764

Query  375  STAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEA  202
            S + +V+   + SIA DRP+R IK P RY   +E N+VAYALSVA E++G++  S YSEA
Sbjct  765  SNSSIVQQSPKRSIAKDRPKRNIKPPQRYI--EEANIVAYALSVAEEIEGNAEPSTYSEA  822

Query  201  FPI  193
              I
Sbjct  823  IVI  825



>gb|AAX92941.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA91548.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2340

 Score =   229 bits (584),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 162/241 (67%), Gaps = 19/241 (8%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NGVAER+NRT++ +ARC+LSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  798   QQNGVAERMNRTIISKARCLLSNAGLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIEV  855

Query  708   WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
             WSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  856   WSGSPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  915

Query  528   DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAST---------  376
             ++ F E+ +L     PST     + EK   +      +++     K+D +          
Sbjct  916   NVVFHESVMLHDK--PSTNVPVESQEKASVQV--EHLISSGHAPEKEDVAINQDEPVIED  971

Query  375   STAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEA  202
             S + +V+   + SIA DRP+R IK P RY   +E N+VAYALSVA E++G++  S YSEA
Sbjct  972   SNSSIVQQSPKRSIAKDRPKRNIKPPQRYI--EEANIVAYALSVAEEIEGNAEPSTYSEA  1029

Query  201   F  199
              
Sbjct  1030  I  1030



>gb|AAT85194.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1241

 Score =   227 bits (578),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 163/243 (67%), Gaps = 23/243 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA L K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  500  QQNGVAERMNRTIISKARCMLSNASLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIEV  557

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH   GKL PR +KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  558  WSGSPANYSDLRVFGCTAYAHVDNGKLEPRVIKCIFLGYLSGVKGYKLWCPETKKVVISR  617

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST-APLVE-  355
            ++ F E+ +L     PST     + EKV  +      +++     K+D + +  AP++E 
Sbjct  618  NVVFHESIMLHDK--PSTNVPVESQEKVSVQVE--HLISSGHAPEKEDVAINQDAPVIED  673

Query  354  ---------PQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYS  208
                     P+R  SIA DRP+R  K P RY   +E N+VAYALSVA E++G++  S YS
Sbjct  674  SDSSIVQQSPKR--SIAKDRPKRNTKPPRRYI--EEANIVAYALSVAEEIEGNAEPSTYS  729

Query  207  EAF  199
            +A 
Sbjct  730  DAI  732



>gb|AAT44282.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1243

 Score =   226 bits (577),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 164/243 (67%), Gaps = 23/243 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q N VAER+NRT++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  563  QQNDVAERMNRTIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSPGYAIDKKTPIEV  620

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGYAS  KGY+LW P+++K+++SR
Sbjct  621  WSGSPTNYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYASGVKGYKLWCPETKKVVISR  680

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST-APLVE-  355
            ++ F E+ +L     PST     + EK   +      +++     K+D + +  AP++E 
Sbjct  681  NVVFHESVILHDK--PSTNVPVESQEKASVQV--EHLISSGHAPEKEDVAINQDAPVIED  736

Query  354  ---------PQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYS  208
                     P+R  SIA D+P+R IK P RY   +E  +VAYALSVA +++G++  S YS
Sbjct  737  SDSSIVHQSPKR--SIAKDKPKRNIKPPRRYI--EEAKIVAYALSVAEKIEGNAEPSTYS  792

Query  207  EAF  199
            EA 
Sbjct  793  EAI  795



>emb|CAN65222.1| hypothetical protein VITISV_038665 [Vitis vinifera]
Length=1562

 Score =   226 bits (576),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 163/251 (65%), Gaps = 20/251 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N+TL++RARCM  +AGL K+  FWAEAV+TA YLVNRSP +++DFK P+EV
Sbjct  690  QQNGVAERMNQTLVQRARCMRIDAGLSKK--FWAEAVNTAAYLVNRSPSTAIDFKTPQEV  747

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSR--KIIL  535
            WSG P +YS L++FGCPAYAH S GKL PRA+KCIFLGYA+  KGYRLW  + R  K I+
Sbjct  748  WSGKPSNYSGLKIFGCPAYAHVSDGKLEPRAMKCIFLGYATGVKGYRLWCTEDRTPKFII  807

Query  534  SRDITFDENALLSS----GKVPSTGETQ-STGEKVEFEFRPSDSVTTADGNTKDDASTST  370
            SRD+TFDE+A+       G +  T +T     +KVEFE      V     N  DD S   
Sbjct  808  SRDVTFDESAMFGQRKEFGDLAGTSKTDLGANQKVEFE------VDAPMENGVDDTSEEQ  861

Query  369  APLVEPQREYSIAMDRPRRTIKKPARY---ASDDETNMVAYALSVA*EVDGDS-SCYSEA  202
             P+++     SIA  RPRR I++P RY    S + TN VA+AL+VA E+  +    Y EA
Sbjct  862  -PVIDQNDSQSIAAHRPRREIRRPMRYVDCVSANITNPVAFALAVAEEIGREEPRSYKEA  920

Query  201  FPIAKFKPYLS  169
                  K +LS
Sbjct  921  MESKDSKKWLS  931



>gb|AAM08562.1|AC092749_15 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAM10749.1|AC112514_2 Putative retroelement [Oryza sativa Japonica Group]
Length=1225

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 162/242 (67%), Gaps = 21/242 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P +V
Sbjct  552  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIKV  609

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH    KL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  610  WSGSPANYSDLRVFGCIAYAHVDNSKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  669

Query  528  DITFDENALLSSGKVPSTGETQSTGEK--VEFEFRPS--------DSVTTADGNTKDDAS  379
            ++ F E+ +L     PST     + EK  V+ E   S        +     D    +D+ 
Sbjct  670  NVVFHESVMLHDK--PSTNVPVESQEKASVQVEHLISSGHAPEKENVAINLDAPVIEDSD  727

Query  378  TSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSE  205
            +S   +V+   ++SIA D+P+R IK P RY   +E N+VAYALSVA E++G+   S YS+
Sbjct  728  SS---IVQQSPKHSIAKDKPKRNIKPPRRYI--EEANIVAYALSVAEEIEGNVEPSTYSD  782

Query  204  AF  199
            A 
Sbjct  783  AI  784



>emb|CAH65740.1| OSIGBa0127D24.3 [Oryza sativa Indica Group]
Length=1009

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/243 (49%), Positives = 160/243 (66%), Gaps = 23/243 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  412  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIEV  469

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WS +P  YS LRVF C AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K++++R
Sbjct  470  WSSSPAKYSDLRVFSCTAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVINR  529

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST-APLVE-  355
            ++ F E+ +L     PST     + EK   +      +++     K+D + +  AP++E 
Sbjct  530  NVVFHESVMLHDK--PSTNVPVESQEKASVQVE--HLISSGHAPEKEDVAINQDAPVIED  585

Query  354  ---------PQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYS  208
                     P+R  SIA DRP+R  K P +Y   +E N+V YALSVA E++G++  S YS
Sbjct  586  SDSSIVQQSPKR--SIAKDRPKRNTKPPRKYI--EEANIVTYALSVAEEIEGNTEPSTYS  641

Query  207  EAF  199
            +A 
Sbjct  642  DAI  644



>gb|AAM91886.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1280

 Score =   219 bits (557),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N  ++ +ARCMLSNA L K+  FWAEAVST CYL+NRSP  + D K P EV
Sbjct  626  QQNGVAERMNMAIISKARCMLSNADLPKQ--FWAEAVSTTCYLINRSPSYATDKKTPIEV  683

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  684  WSGSPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  743

Query  528  DITFDENALLSSGKVPSTGETQSTGEK--VEFEFRPSDSVTTADGNT--KDDAST---ST  370
            ++ F E+ +L     PST     + EK  V+ E   S        N     DA     S 
Sbjct  744  NVVFHESVILHDK--PSTNVPVESQEKASVQVEHLISSGHAPEKENVAINQDAPVIEDSD  801

Query  369  APLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
            + +V+   + SIA D+P+R IK P RY   +E N+VAYALSVA E++G++  S YSEA 
Sbjct  802  SSIVQQSSKRSIAKDKPKRNIKPPRRYI--EEANIVAYALSVAEEIEGNAEPSTYSEAI  858



>emb|CAH66022.1| OSIGBa0105O19.1 [Oryza sativa Indica Group]
Length=944

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 149/232 (64%), Gaps = 36/232 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWA AVST CYL+NRSP  ++D K P +V
Sbjct  419  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAAAVSTTCYLINRSPSYAIDKKTPIKV  476

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P +YS LRVFGC AYAH   GKL PRA+KCIFLGY+S  KGY+LW P+++K+++SR
Sbjct  477  WSGFPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYSSGVKGYKLWCPETKKVVISR  536

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
            ++ F E+ +L     PST     + EK   +F                          P+
Sbjct  537  NVVFHESVMLHDK--PSTNVPVESQEKASVQF--------------------------PK  568

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
            R  SIA D+P+R  K P RY   +E N+VAYALSV  E++G++  S YSEA 
Sbjct  569  R--SIAKDKPKRNTKPPQRYI--EEANIVAYALSVTEEIEGNAEPSIYSEAI  616



>gb|ABD32732.1| hypothetical protein MtrDRAFT_AC150777g7v1 [Medicago truncatula]
Length=624

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 140/210 (67%), Gaps = 32/210 (15%)
 Frame = -1

Query  864  LNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDY  685
            +NRTLLER RCMLSNAGLW RRD WAEA STACYLVNRSPHS+LDFK+PEE+WSGNP   
Sbjct  1    MNRTLLERTRCMLSNAGLWHRRDLWAEAASTACYLVNRSPHSALDFKVPEEIWSGNPHS-  59

Query  684  SILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLW--SPDSRKIILSRDITFDE  511
                       AH + GKL PRAV+CIFL YASESKGYRLW   P S+K+ILSRD+TF+E
Sbjct  60   -----------AHVNDGKLAPRAVECIFLDYASESKGYRLWCSDPKSQKLILSRDVTFNE  108

Query  510  NALLSSGKVP------STGETQSTGEKVEFEFRPSD------SVTTADGNTKDD-----A  382
            +ALLSS K        STG  QST EKVEF  +P+       S +T + N  +       
Sbjct  109  DALLSSRKQSFVSSSTSTGNLQSTSEKVEFVLKPAAPYVDVPSSSTNEFNIDNHPDDDDR  168

Query  381  STSTAPLVEPQRE-YSIAMDRPRRTIKKPA  295
              ST P ++ Q + YSIA DR RR I+K A
Sbjct  169  DDSTTPPIQQQGDYYSIARDRVRRQIRKLA  198



>emb|CAD40363.2| OSJNBa0093P23.9 [Oryza sativa Japonica Group]
Length=944

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 149/232 (64%), Gaps = 36/232 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWA AVST CYL+NRSP  ++D K P +V
Sbjct  419  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAAAVSTTCYLINRSPSYAIDKKTPIKV  476

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P +YS LRVFGC AYAH   GKL PRA+KCIFLGY+S  KGY+LW P+++K+++SR
Sbjct  477  WSGFPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYSSGVKGYKLWCPETKKVVISR  536

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
            ++ F E+ +L     PST     + EK   +F                          P+
Sbjct  537  NVVFHESVMLHDK--PSTNVPVESQEKASVQF--------------------------PK  568

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
            R  SIA D+P+R  K P RY   +E N+VAYALSV  E++G++  S YSEA 
Sbjct  569  R--SIAKDKPKRNTKPPQRYI--EEANIVAYALSVTEEIEGNAEPSTYSEAI  616



>gb|AAP54315.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1312

 Score =   218 bits (556),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N  ++ +ARCMLSNA L K+  FWAEAVST CYL+NRSP  + D K P EV
Sbjct  626  QQNGVAERMNMAIISKARCMLSNADLPKQ--FWAEAVSTTCYLINRSPSYATDKKTPIEV  683

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  684  WSGSPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  743

Query  528  DITFDENALLSSGKVPSTGETQSTGEK--VEFEFRPSDSVTTADGNT--KDDAST---ST  370
            ++ F E+ +L     PST     + EK  V+ E   S        N     DA     S 
Sbjct  744  NVVFHESVILHDK--PSTNVPVESQEKASVQVEHLISSGHAPEKENVAINQDAPVIEDSD  801

Query  369  APLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
            + +V+   + SIA D+P+R IK P RY   +E N+VAYALSVA E++G++  S YSEA 
Sbjct  802  SSIVQQSSKRSIAKDKPKRNIKPPRRYI--EEANIVAYALSVAEEIEGNAEPSTYSEAI  858



>gb|ABO36622.1| copia LTR rider [Solanum lycopersicum]
 gb|ABO36636.1| copia LTR rider [Solanum lycopersicum]
Length=1307

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 158/248 (64%), Gaps = 10/248 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N+TLLERARCMLSNAGL +R  FWAEAVSTACYL+NR PH+ +  K P E+
Sbjct  569  QQNGVAERMNQTLLERARCMLSNAGLDRR--FWAEAVSTACYLINRGPHTGIQCKTPMEM  626

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG   DYS L+ FGC AY H S GKL PRA K +F+GY    KG+R+WSP  +++I+SR
Sbjct  627  WSGKAADYSNLKAFGCTAYYHVSEGKLEPRAKKGVFVGYGDGVKGFRIWSPAEKRVIMSR  686

Query  528  DITFDENALLSSGKVP-STGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST-APLVE  355
            ++ FDE+ LL +   P +T ET S  ++VEF+   ++S          +  T T  P   
Sbjct  687  NVVFDESPLLRTIVKPTTTSETGSLDKQVEFQVIQNESDLKEPEEEDQEPQTETDIPESM  746

Query  354  PQREY-SIAMDRPRRT-IKKPARYASDDETNMVAYALSVA*EVD-GDSSCYSEAFPIAKF  184
            P   + SIA DRPRR  ++ P RY  +D   MV YAL VA EVD  + S Y EA   +  
Sbjct  747  PSDIHQSIAQDRPRRVGVRPPTRYGFED---MVGYALQVAEEVDTSEPSTYKEAILSSDS  803

Query  183  KPYLSLVG  160
            + + + +G
Sbjct  804  EKWFAAMG  811



>ref|XP_006651032.1| PREDICTED: uncharacterized protein LOC102707106 [Oryza brachyantha]
Length=1773

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 148/226 (65%), Gaps = 11/226 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER+NRT++ +ARCMLSNAGL +R  FWAEA STACYL+NRSP  ++D K P E+
Sbjct  530  QQNGVVERMNRTIISKARCMLSNAGLPRR--FWAEAASTACYLINRSPSYAIDKKTPIEM  587

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS L+VFGC AYAH   GKL PRA+KCIFLGY S  K Y+LW P+++K+++SR
Sbjct  588  WSGSPANYSDLKVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKAYKLWCPETQKVVISR  647

Query  528  DITFDENALL---SSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAST---STA  367
            ++ F+E  +L   SS  VP   + Q    +VE            +  +  DA     S +
Sbjct  648  NVIFNETVMLNDKSSTNVPVKSQ-QKASVQVEHLISSVHVPEKENIASNQDAPVIEESDS  706

Query  366  PLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVD  229
             +VE   +YSIA  R RR IK P R    +E N+VAYA+SVA E++
Sbjct  707  SVVEQSPKYSIAQGRARRNIKAPQRLI--EEANIVAYAMSVAQEIE  750



>gb|AAX96781.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92543.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=1170

 Score =   212 bits (539),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 147/227 (65%), Gaps = 13/227 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+ RT++ ++RCML   GL K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  626  QQNGVAERMKRTIISKSRCMLPYVGLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIEV  683

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  684  WSGSPANYSDLRVFGCIAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  743

Query  528  DITFDENALLSSGKVPSTGETQSTGEK----VEFEFRPSDSVTTADGNTKDDASTST---  370
            ++ F E+ +L     PST     + EK    VE       ++   D     DA  S    
Sbjct  744  NVVFHESVMLYDN--PSTNVPVESQEKASVQVEHLISSGHALEKEDVAINQDAPVSEDSD  801

Query  369  APLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVD  229
            + +++   + SIA D+P+R  K P RY   +E N+VAYALSV  E+D
Sbjct  802  SSIIQQSPKRSIAKDKPKRNTKPPQRYI--EEANIVAYALSVVEEID  846



>emb|CAN61272.1| hypothetical protein VITISV_039063 [Vitis vinifera]
Length=1643

 Score =   204 bits (520),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/251 (51%), Positives = 163/251 (65%), Gaps = 20/251 (8%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NGVAER+N+TL++RARCM  +AGL K+  FWAEAV+TA YLVNRSP +++DFK P+EV
Sbjct  903   QQNGVAERMNQTLVQRARCMRIDAGLSKK--FWAEAVNTAAYLVNRSPSTAIDFKTPQEV  960

Query  708   WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSR--KIIL  535
             WSG P +YS L++FGCPAYAH S GKL PRA+KCIFLGYA+  KGYRLW  + R  K I+
Sbjct  961   WSGKPSNYSGLKIFGCPAYAHVSDGKLEPRAMKCIFLGYATGVKGYRLWCTEDRTPKFII  1020

Query  534   SRDITFDENALLSS----GKVPSTGETQ-STGEKVEFEFRPSDSVTTADGNTKDDASTST  370
             SRD+TFDE+A+       G +  T +T     +KVEFE      V     N  DD S   
Sbjct  1021  SRDVTFDESAMFGQRKEFGDLAGTSKTDLGANQKVEFE------VDAPMENGVDDTSEEQ  1074

Query  369   APLVEPQREYSIAMDRPRRTIKKPARY---ASDDETNMVAYALSVA*EVDGDS-SCYSEA  202
              P+++     SIA  RPRR I++P RY    S + TN VA+AL+VA E+  +    Y EA
Sbjct  1075  -PVIDQNDSQSIAAXRPRREIRRPMRYVDCVSANITNPVAFALAVAEEIGREEPRSYKEA  1133

Query  201   FPIAKFKPYLS  169
                   K +LS
Sbjct  1134  MESKDSKKWLS  1144



>gb|AAT01387.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT44170.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1175

 Score =   202 bits (515),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 142/224 (63%), Gaps = 10/224 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA  TACYL+NRSP  SL+ K P EV
Sbjct  479  QQNGVAERMNRTIISKARCMLSNARMNKR--FWAEAAKTACYLINRSPSISLNKKTPIEV  536

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P +YS LRVFGC AYAH + GKL PRA+KC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  537  WSGMPANYSQLRVFGCTAYAHVNNGKLEPRAIKCLFLGYGSGVKGYKLWNPETNKTFMSR  596

Query  528  DITFDENAL----LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
             + F+E+ +    L +  +P   + +     V+ E    D  T   GN  +D    + P+
Sbjct  597  SVVFNESVMFNDSLPTDVIPGGFDEEQQYVSVQVE-HVDDQKTEIVGNDVNDTVQHSPPV  655

Query  360  VEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVD  229
            ++PQ E  IA  R +R+   P R    +E +MV YA   A +V+
Sbjct  656  LQPQDE-PIAHRRTKRSCGAPVRLI--EECDMVYYAFICAEQVE  696



>gb|AAR87163.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU89150.1| integrase core domain containing protein [Oryza sativa Japonica 
Group]
 gb|ABF98081.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1322

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 147/235 (63%), Gaps = 12/235 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA +TACYL+NRSP   L+ K P E+
Sbjct  584  QQNGVAERMNRTIISKARCMLSNARMNKR--FWAEAANTACYLINRSPSIPLNKKTPIEI  641

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS LRVFGC AYAH   GKL PRA+KC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  642  WSGMPADYSQLRVFGCTAYAHVDNGKLEPRAIKCLFLGYGSGVKGYKLWNPETNKTFMSR  701

Query  528  DITFDE----NALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
            ++ F+E    N  L +  +P   + +     V+ E    D  T   GN  +D    +  +
Sbjct  702  NVIFNEFVMFNDSLPTDVIPGGSDEEQQYVSVQVE-HVDDQETEIVGNDVNDTVQHSPSV  760

Query  360  VEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
            ++PQ E  IA  R +R+   P R    +E +MV YA S A +V+   + + Y+EA
Sbjct  761  LQPQDE-PIAHRRTKRSCGAPVRLI--EECDMVYYAFSYAEQVENTLEPATYTEA  812



>gb|ABA97637.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1278

 Score =   200 bits (508),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 146/235 (62%), Gaps = 12/235 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA +TACYL+NRSP   L+ K P E+
Sbjct  584  QQNGVAERMNRTIISKARCMLSNARMNKR--FWAEAANTACYLINRSPSIPLNKKTPIEI  641

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS LRVFGC AYAH    KL PRA+KC+FLGY    KGY+LW+P++ K  +SR
Sbjct  642  WSGMPADYSQLRVFGCTAYAHVDNEKLEPRAIKCLFLGYGLGVKGYKLWNPETNKTFMSR  701

Query  528  DITFDENAL----LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
             + F+E+ +    L +  +P   + +     V+ E    D  T   GN  +D    + P+
Sbjct  702  SVVFNESVMFNDSLPTDVIPGGSDEEQQYVSVQVE-HVDDQETEIVGNDVNDTVQHSPPV  760

Query  360  VEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
            ++PQ E  IA  R +R+   P R    +E +MV YA S A +V+   + + Y+EA
Sbjct  761  LQPQDE-PIAHRRTKRSCGAPVRLI--EECDMVYYAFSCAEQVENTLEPATYTEA  812



>emb|CAH66122.1| OSIGBa0146N20.7 [Oryza sativa Indica Group]
Length=1335

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 150/246 (61%), Gaps = 22/246 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ RARCMLS+A + KR  FWAEA STACYL+NRSP   L+ K P EV
Sbjct  585  QQNGVAERMNRTIISRARCMLSHARMNKR--FWAEAASTACYLINRSPSIPLNKKTPIEV  642

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS L+VFGC AYAH   GKL PRAVKC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  643  WSGTPADYSQLKVFGCTAYAHVDNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSR  702

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSD---SVTTADGNTKDDAST------  376
             + F+E+ + ++  +PS    +   +++  +    D    V     + +DD +       
Sbjct  703  SVVFNESVMFTNS-LPSEHVPEKELQRMHMQVEHVDDDTGVQVEPVDEQDDHNNDVADDD  761

Query  375  ------STAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DS  220
                   T P+++ + + SIA  + +RT K P R    +E N+  YALS A +V+   + 
Sbjct  762  AHDDVQQTPPILQLEEDLSIAQRKSKRTTKPPKRLI--EECNLSYYALSCAEQVENVHEP  819

Query  219  SCYSEA  202
            + Y EA
Sbjct  820  ATYKEA  825



>gb|ABA98804.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1333

 Score =   199 bits (506),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 149/246 (61%), Gaps = 22/246 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ RARCMLS+A + KR  FWAEA STACYL+NRSP   L+ K P EV
Sbjct  583  QQNGVAERMNRTIISRARCMLSHARMNKR--FWAEAASTACYLINRSPSIPLNKKTPIEV  640

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS L+VFGC AYAH   GKL PRAVKC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  641  WSGTPADYSQLKVFGCTAYAHVDNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSR  700

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTAD---GNTKDDAST------  376
             + F+E+ + ++  +PS    +   +++  +    D  T       + +DD +       
Sbjct  701  SVVFNESVMFTNS-LPSEHVPEKELQRMHMQVEHVDDYTGVQVEPVHEQDDHNNDVADDD  759

Query  375  ------STAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DS  220
                   T P+++ + E  IA  + +RT K P R    +E N+  YALS A +V+   + 
Sbjct  760  AHDDVQQTPPILQLEEELPIAQRKSKRTTKPPKRLI--EECNLSYYALSCAEQVENVHEP  817

Query  219  SCYSEA  202
            + Y EA
Sbjct  818  ATYKEA  823



>gb|ABA98656.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1333

 Score =   198 bits (504),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 146/246 (59%), Gaps = 22/246 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ RARCMLS+A + KR  FWAEA STACYL+NRSP   L+ K P EV
Sbjct  583  QQNGVAERMNRTIISRARCMLSHARMNKR--FWAEAASTACYLINRSPSIPLNKKTPIEV  640

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS L+VFGC AYAH   GKL PRAVKC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  641  WSGMPADYSQLKVFGCTAYAHVDNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSR  700

Query  528  DITFDENAL----LSSGKVPSTGETQ-----------STGEKVEFEFRPSDSVTTADGNT  394
             + F+E+ +    L S  VP   E Q            TG +VE      D       + 
Sbjct  701  SVVFNESVMFTNSLPSEHVPEK-ELQRMHMQVEHVDDDTGVQVEPVHEQDDHNNDVADDD  759

Query  393  KDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DS  220
              D    T P+++ + E  IA  + +RT K P R    +E N+  YALS A +V+   + 
Sbjct  760  AHDDVQQTPPILQLEEELPIAQRKSKRTTKPPKRLI--EECNLSYYALSCAEQVENVHEP  817

Query  219  SCYSEA  202
            + Y EA
Sbjct  818  ATYKEA  823



>gb|AAX92861.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
 gb|ABA92739.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1373

 Score =   198 bits (504),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 146/246 (59%), Gaps = 22/246 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ RARCMLS+A + KR  FWAEA STACYL+NRSP   L+ K P EV
Sbjct  583  QQNGVAERMNRTIISRARCMLSHARMNKR--FWAEAASTACYLINRSPSIPLNKKTPIEV  640

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS L+VFGC AYAH   GKL PRAVKC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  641  WSGTPADYSQLKVFGCTAYAHVDNGKLEPRAVKCLFLGYGSGVKGYKLWNPETGKTFMSR  700

Query  528  DITFDENAL----LSSGKVPSTGETQ-----------STGEKVEFEFRPSDSVTTADGNT  394
             + F+E+ +    L S  VP   E Q            TG +VE      D       + 
Sbjct  701  SVVFNESVMFTNSLPSEHVPEK-ELQRMHMQVEHVDDDTGVQVEPVHEQDDHNNDVADDD  759

Query  393  KDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DS  220
              D    T P+++ + E  IA  + +RT K P R    +E N+  YALS A +V+   + 
Sbjct  760  AHDDVQQTPPILQLEEELPIAQRKSKRTTKPPKRLI--EECNLSYYALSCAEQVENVHEP  817

Query  219  SCYSEA  202
            + Y EA
Sbjct  818  ATYKEA  823



>ref|XP_010676254.1| PREDICTED: uncharacterized protein LOC104892119 [Beta vulgaris 
subsp. vulgaris]
Length=1947

 Score =   198 bits (503),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/248 (44%), Positives = 142/248 (57%), Gaps = 33/248 (13%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N+TLLER RCMLSNAGL   R +W+EAV TACYL+NR PH+ +D K+P EV
Sbjct  658  QQNGVAERMNQTLLERVRCMLSNAGL--TRKYWSEAVKTACYLINRGPHTGIDCKVPYEV  715

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG   +YS LRVFGC  Y H + GKL PRA K  FLGY    KGYR+WSP   ++ILSR
Sbjct  716  WSGRSAEYSGLRVFGCMVYYHVNEGKLEPRAKKGCFLGYGDGVKGYRIWSPSEGRVILSR  775

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEP-  352
            D+TFDEN +  S   P+    +ST E  E    P D         KD+ +  ++P+VE  
Sbjct  776  DVTFDENTMFVSANKPAGDTDESTDEGSEQVVAP-DPTPQVRTQGKDNEAPVSSPIVETS  834

Query  351  QREYSI-----------------AMDRPRRTIKK----------PARYASDDETNMVAYA  253
            QR+ ++                    RPR+  ++          P R    +E  M+ YA
Sbjct  835  QRDVAVVDETADVESDHEETVVEGQKRPRKKTQRLIEQIEGRNVPGRNCCVEE--MIGYA  892

Query  252  LSVA*EVD  229
            L VA +++
Sbjct  893  LHVAEDIE  900



>gb|ABA96191.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1156

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 144/238 (61%), Gaps = 18/238 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++   RCMLSNA + KR  FWAE  +TACYL+NRSP   L+ K P EV
Sbjct  524  QQNGVAERMNRTIISNTRCMLSNARMNKR--FWAEVANTACYLINRSPSIPLNKKTPIEV  581

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS LRVFGC AYAH   GKL PRA+KC+FLGY S  KGY+LW+P + K  +SR
Sbjct  582  WSGMPADYSQLRVFGCTAYAHVDNGKLEPRAIKCLFLGYGSGVKGYKLWNPKTNKTFMSR  641

Query  528  DITFDENALLSSGKVP-------STGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST  370
             + F+E+ + +   +P       S  E Q    +VE      D  T   GN  +     +
Sbjct  642  SVVFNESVMFNDS-LPTDVILGGSDEEQQYVSVQVE---HVDDQETEIVGNDVNVTVQHS  697

Query  369  APLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
             P+++PQ E  IA  R +R+   P R+   +E +MV YA S A +V+   + + Y+EA
Sbjct  698  PPVLQPQDE-PIAHRRTKRSCGAPIRFI--EECDMVYYAFSCAEQVENTLEPATYTEA  752



>gb|ABA99467.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1136

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 145/236 (61%), Gaps = 12/236 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRT++  ARC+LSNA + KR  FWAEA +TACYL+NRSP   L+ K P EV
Sbjct  376  QQNGVAKRMNRTIISEARCLLSNARMNKR--FWAEAANTACYLINRSPSIPLNKKTPIEV  433

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS LRVFGC AYAH   GKL PRA+KC+FL Y S  KGY+LW+P + K  +SR
Sbjct  434  WSGMPADYSQLRVFGCTAYAHVDNGKLEPRAIKCLFLSYGSGVKGYKLWNPQTNKTFMSR  493

Query  528  DITFDENAL----LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
             + F+E+ +    L +  +P   + +     V+ E    D  T   GN  +D    + P+
Sbjct  494  SVVFNESIMFNDSLPTDVIPGGSDEEQQYVSVQVE-HVDDQETEIVGNDINDIVQHSPPV  552

Query  360  VEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEAF  199
            ++PQ E  IA  R +R+   P R    ++ +MV YA S A +V+   + + Y+EA 
Sbjct  553  LQPQDE-PIAHRRTKRSCGAPVRLI--EKCDMVYYAFSCAEQVENTLEPATYTEAI  605



>emb|CAD41912.2| OSJNBa0033G05.13 [Oryza sativa Japonica Group]
Length=1181

 Score =   189 bits (481),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 134/203 (66%), Gaps = 20/203 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NR ++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP S  + K P EV
Sbjct  591  QQNGVAERMNRIIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSP-SYANKKTPIEV  647

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS L+VFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  648  WSGSPANYSDLKVFGCTAYAHVDNGKLEPRAIKCIFLGYPSSVKGYKLWCPETKKVVISR  707

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST-APLVE-  355
            ++ F E+ +L     PST     + EK   +      + +     K+D + +  AP++E 
Sbjct  708  NVVFHESIMLHDK--PSTNVPVESQEKASVQVE--HLINSGHAPEKEDVAINQDAPVIED  763

Query  354  ---------PQREYSIAMDRPRR  313
                     P+R  SIA D+P+R
Sbjct  764  SDSSTVQQSPKR--SIAKDKPKR  784



>emb|CAN61630.1| hypothetical protein VITISV_003191 [Vitis vinifera]
Length=1208

 Score =   188 bits (478),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 106/236 (45%), Positives = 138/236 (58%), Gaps = 14/236 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRT+LER RCMLS++GL K   FWAEA  TA +L+NRSP S+L FK P+E 
Sbjct  549  QQNGLAERMNRTILERVRCMLSSSGLSKV--FWAEAAETAVHLINRSPSSALQFKTPQEK  606

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLW--SPDSRKIIL  535
            W+G   DY  L+VFGC AY H+ T KL PRAVKCIFLGY    KGY+LW  +    K I+
Sbjct  607  WTGKAADYQHLKVFGCTAYVHTKTDKLEPRAVKCIFLGYPKGVKGYKLWIETQGKGKCII  666

Query  534  SRDITFDENALLSSGKVPSTGETQSTGEKVEFE-FRPSDSVTTADGNTKDDASTSTAPLV  358
            SRD+TF+E  +                 +VE E  +P  S  T+    +++         
Sbjct  667  SRDVTFNEQDMSKQTPAKDVEGLDQLQFEVEHETLQPEKSKETSSKTAQEEIVHERQN--  724

Query  357  EPQR---EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*E-VDGDSSCYSEA  202
            EP +    Y++  DR +R +K P RY    +  M A+ALSVA E VD +   Y EA
Sbjct  725  EPTQGLESYNLVRDRQKRQVKPPKRYG---QAEMTAFALSVAEEIVDMEPKTYQEA  777



>emb|CAJ86192.1| H0306F03.15 [Oryza sativa Indica Group]
Length=1037

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 140/226 (62%), Gaps = 30/226 (13%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P +V
Sbjct  408  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSPGYAIDKKTPIKV  465

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS L+VFGC AYAH   GKL PR +KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  466  WSGSPANYSDLKVFGCTAYAHVDNGKLEPRTIKCIFLGYPSGVKGYKLWCPETKKVVISR  525

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
             + F E+ +L                      +PS ++      +++ AS     L+   
Sbjct  526  YVVFHESVMLHD--------------------KPSTNIPV---ESQEKASVQIQILLLFS  562

Query  348  REYSIAMDR--PRRTIKKPARYASDDETNMVAYALSVA*EVDGDSS  217
               ++ + +  P+  +         +E N+VAYALSVA E++ + +
Sbjct  563  SLQNVLLQKISPKEILN---LLKDIEEANIVAYALSVAEELEKNHT  605



>emb|CAJ86151.1| H0413E07.4 [Oryza sativa Indica Group]
Length=1205

 Score =   186 bits (473),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 137/224 (61%), Gaps = 26/224 (12%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P +V
Sbjct  576  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSPGYAIDKKTPIKV  633

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS L+VFGC AYAH   GKL PR +KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  634  WSGSPANYSDLKVFGCTAYAHVDNGKLEPRTIKCIFLGYPSGVKGYKLWCPETKKVVISR  693

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
             + F E+ +L     PST     + EK   + +     ++                + P+
Sbjct  694  YVVFHESVMLHDK--PSTNIPVESQEKASVQIQILLLFSS--------LQNVLLQKISPK  743

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSS  217
               ++  D               +E N+VAYALSVA E++ + +
Sbjct  744  EILNLLKDI--------------EEANIVAYALSVAEELEKNHT  773



>gb|AAP53216.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1262

 Score =   186 bits (473),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 144/241 (60%), Gaps = 36/241 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAERL +                    FWAEAVSTACYL+NRSP  ++D K P +V
Sbjct  606  QQNGVAERLPK-------------------QFWAEAVSTACYLINRSPSYAIDKKTPIKV  646

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+P +YS LRVFGC AYAH    KL PRA+KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  647  WSGSPANYSDLRVFGCIAYAHVDNSKLEPRAIKCIFLGYPSGVKGYKLWCPETKKVVISR  706

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAST---------  376
            ++ F E+ +L     PST     + EK   +      +++     K++ +          
Sbjct  707  NVVFHESVMLHDK--PSTNVPVESQEKASVQVE--HLISSGHAPEKENVAINLDAPVIED  762

Query  375  STAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEA  202
            S + +V+   ++SIA D+P+R IK P RY   +E N+VAYALSVA E++G+   S YS+A
Sbjct  763  SDSSIVQQSPKHSIAKDKPKRNIKPPRRYI--EEANIVAYALSVAEEIEGNVEPSTYSDA  820

Query  201  F  199
             
Sbjct  821  I  821



>emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis]
Length=1334

 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 139/235 (59%), Gaps = 22/235 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTL+++ RCML N+ L   R FWAEAV+TA YLVNRSP S++ FK PEE+
Sbjct  581  QQNGLAERMNRTLVDKTRCMLINSKL--PRSFWAEAVNTASYLVNRSPSSAIGFKTPEEL  638

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+G P +Y  LRVFGCPAY H + GKL  RA+K +F+GY    KGY++W  D  K I+SR
Sbjct  639  WNGKPANYQNLRVFGCPAYLHINQGKLEARALKGVFVGYPDGVKGYKIWCKDQGKCIVSR  698

Query  528  DITFDENALLSSGKVPSTG---------ETQSTGEKVEFEFRPSDSVTTADGNTKDDAST  376
            D+ F E+ LL        G          + S   KV  E   +D  +  +  + D+ +T
Sbjct  699  DVVFHESVLLKESAEHDAGLQDNPAANKRSGSETSKVNVEL-LTDKSSEKEAASDDERAT  757

Query  375  STAPLVE----PQ---REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EV  232
            + +   E    PQ   + Y +A DR RR ++ P RY   D   ++AYAL  A EV
Sbjct  758  AESEEHEVSELPQADLQNYQLARDRVRREVRAPVRYGYAD---LIAYALLCADEV  809



>gb|ABA96718.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1131

 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 136/231 (59%), Gaps = 41/231 (18%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA +TACYL+N+SP   L+ K P EV
Sbjct  512  QQNGVAERMNRTIISKARCMLSNARMNKR--FWAEAANTACYLINKSPSIPLNKKTPIEV  569

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS LRVFGC AYAH   GKL PRA+KC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  570  WSGMPADYSQLRVFGCTAYAHVDNGKLEPRAIKCLFLGYGSGVKGYKLWNPETNKTFMSR  629

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
             + F+E+ + +                      P+D                + P+++PQ
Sbjct  630  SVVFNESVMFNDS-------------------LPTD---------------HSPPVLQPQ  655

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
             E  IA  R +R+     R    +E ++V YA S A +V+   + + Y+EA
Sbjct  656  DE-PIAHRRTKRSCGALVRLI--EECDIVYYAFSCAEQVENTLELATYTEA  703



>gb|AER13159.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris]
Length=867

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 148/239 (62%), Gaps = 19/239 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER+N+ L+E+ RCMLSNA L   R FWAEAV+ A +LVNR P S++D K P EV
Sbjct  569  QQNGVSERMNKILVEKVRCMLSNAEL--GRKFWAEAVTYAQHLVNRLPSSAIDGKTPLEV  626

Query  708  WSGNP-VDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            WSG P  DY  L VFG  AY H    KL+PRA K +F+G++   KGYRLW  +++K I+S
Sbjct  627  WSGKPATDYDSLHVFGSIAYYHVIESKLDPRAKKALFMGFSPGVKGYRLWCLEAKKTIIS  686

Query  531  RDITFDENALLSS----GKVPSTGETQSTGEKVEFEFR---PSDSVTTADGNTKDDASTS  373
            RD+TFDE+A+L      G   +  + +   ++VEFE +   P+ + T+     ++++   
Sbjct  687  RDVTFDESAMLKKVNPEGADSTPQQVECARKQVEFEPKVVIPTRNTTSDSAMAEEESDEE  746

Query  372  TAPLVEPQREYS-IAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              P  E Q++ + IA+ R RR I+KP+R+      +MVAYAL V   VD   S Y EA 
Sbjct  747  EVPTQESQQQSAPIAVRRQRRDIQKPSRF-----MDMVAYALPV---VDDIPSTYPEAI  797



>gb|ACL97384.1| Gag-Pol polyprotein [Medicago truncatula]
Length=1305

 Score =   181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 136/235 (58%), Gaps = 24/235 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML  AG+ K   FWAEAV TACY++NRSP +++D K P E+
Sbjct  580  QQNGVAERMNRTLLERTRAMLKTAGMAK--SFWAEAVKTACYVINRSPSTAIDLKTPMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G PVDYS L VFGCP Y   ++    KL+P++ KCIFLGYA   KGYRLW P +RK++
Sbjct  638  WKGKPVDYSSLHVFGCPVYVMYNSQERTKLDPKSRKCIFLGYADNVKGYRLWDPTARKVV  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ F EN L S  K  ST +                ++   +  +K+  S+   P+ 
Sbjct  698  VSRDVVFAENELQSKQKNDSTSK--------------ETAIVQMEEKSKESDSSEAEPVH  743

Query  357  EPQR--EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            E Q   + +  + R  R  +KP+  +    T+  AY L      +G+ S + EA 
Sbjct  744  EEQEPDDVNNGVRRSTRQTQKPSWQSDYVMTSHDAYCLITE---EGEPSTFHEAL  795



>emb|CAI44659.1| OSJNBa0061C06.9 [Oryza sativa Japonica Group]
Length=1007

 Score =   180 bits (456),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 134/214 (63%), Gaps = 21/214 (10%)
 Frame = -1

Query  801  RDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNP  622
            + FW E VSTACYL+NRSP  ++D K P EVWS +PV+YS LRVFGC AYAH   GKL P
Sbjct  400  KQFWVETVSTACYLINRSPSYAIDKKTPIEVWSDSPVNYSDLRVFGCTAYAHVDNGKLEP  459

Query  621  RAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALLSSGKVPSTGETQSTGEKVE  442
            RA+KCIFLGY S  KGY+LW P ++K+++SR++ F E+ +L     PST     + EK  
Sbjct  460  RAIKCIFLGYPSGMKGYKLWCPKTKKVVISRNVVFHESVMLHDK--PSTNVPVESQEKAS  517

Query  441  FEFRPSDSVTTADGNTKDDASTST-APLVE----------PQREYSIAMDRPRRTIKKPA  295
             +      +++     K++ + +   P++E          P+R   IA D+P+R  K P 
Sbjct  518  VQVE--HLISSGHAPEKENVAINQDVPVIEDSDSSTVQQSPKR--FIAKDKPKRNTKPPQ  573

Query  294  RYASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
            RY   +E N+VAYALSVA +++G++  S YSEA 
Sbjct  574  RYI--EEANIVAYALSVAEDIEGNAEPSTYSEAI  605



>dbj|BAB09923.1| copia-like retrotransposable element [Arabidopsis thaliana]
Length=1342

 Score =   180 bits (457),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 138/234 (59%), Gaps = 22/234 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ + RCMLS +GL K+  FWAEA STA +L+N+SP SS++F IPEE 
Sbjct  584  QQNGVAERMNRTIMNKVRCMLSESGLGKQ--FWAEAASTAVFLINKSPSSSIEFDIPEEK  641

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+G+P DY IL+ FG  AY HS  GKLNPRA K IFLGY    K +++W  + RK ++SR
Sbjct  642  WTGHPPDYKILKKFGSVAYIHSDQGKLNPRAKKGIFLGYPDGVKRFKVWLLEDRKCVVSR  701

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGN--------TKDDASTS  373
            DI F EN +    +     E      +VE       +++  D N         ++ AST+
Sbjct  702  DIVFQENQMYKELQKNDMSEEDKQLTEVERTLIELKNLSADDENQSEGGDNSNQEQASTT  761

Query  372  TAPLVEPQRE-----------YSIAMDRPRRTIKKPARYASDDETNMVAYALSV  244
             +   + Q E           Y +A DR RR I+ P R+  +D++ +V +AL++
Sbjct  762  RSASKDKQVEETDSDDDCLENYLLARDRIRRQIRAPQRFVEEDDS-LVGFALTM  814



>emb|CDN96898.1| putative Ty-1 copia retrotransposon [Phaseolus vulgaris]
Length=813

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 142/230 (62%), Gaps = 26/230 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER+N+TL+E+  CMLSNA L   R+FWAEAV+ A +LVNR P S++D K P EV
Sbjct  515  QQNGVSERMNKTLVEKVCCMLSNAEL--GREFWAEAVTYAQHLVNRLPSSAIDGKTPLEV  572

Query  708  WSGNP-VDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            WSG P  DY  L VFG  AY H    KL+PRA K +F+G++   KGYRLW  + +K I+S
Sbjct  573  WSGKPATDYDSLHVFGSIAYYHVIESKLDPRAKKALFMGFSPGVKGYRLWCLEKKKTIIS  632

Query  531  RDITFDENALLSSGKVPSTGETQSTGEKVE-----FEFRPSDSVTTADGNTKDDASTS--  373
            RD+TFDE+ +L   KV   G T ST ++VE      EF P+  + T   NT  D+  +  
Sbjct  633  RDVTFDESVMLK--KVNPEG-TDSTPQQVECVRKQVEFEPTVVIPTR--NTTSDSPMAEE  687

Query  372  -----TAPLVEPQREYS-IAMDRPRRTIKKPARYASDDETNMVAYALSVA  241
                   P  E Q++ + IA+ R RR I+KPAR+      +MVAYAL V 
Sbjct  688  ESDEEEVPTQESQQQSAPIAVRRQRRDIQKPARF-----MDMVAYALPVV  732



>gb|ACL97383.1| Gag-Pol polyprotein [Medicago truncatula]
Length=1305

 Score =   178 bits (451),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 135/235 (57%), Gaps = 24/235 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML  AG+ K   FWAEAV TACY++NRSP +++D K P E+
Sbjct  580  QQNGVAERMNRTLLERTRAMLKTAGMAK--SFWAEAVKTACYVINRSPSTAIDLKTPMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G PVDYS L VFGCP Y   ++    KL+P++ KCIFLGYA   KGYRLW P +RK++
Sbjct  638  WKGKPVDYSSLHVFGCPVYVMYNSQERTKLDPKSRKCIFLGYADNVKGYRLWDPTARKVV  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ F EN L S  K  ST +                ++   +  +K+  S+    + 
Sbjct  698  VSRDVVFAENELQSEQKNDSTSK--------------ETAIVQMEEKSKESDSSEAESVH  743

Query  357  EPQR--EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            E Q   + +  + R  R  +KP+  +    T+  AY L      +G+ S + EA 
Sbjct  744  EEQEPDDVNDGVRRSTRQTQKPSWQSDYVMTSHDAYCLITE---EGEPSTFHEAL  795



>gb|AAK52561.1|AC079853_14 Putative retroelement pol polyprotein [Oryza sativa Japonica 
Group]
 gb|ABF96427.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1326

 Score =   177 bits (449),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 135/231 (58%), Gaps = 36/231 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA +TACYL+NRSP   L+ K P EV
Sbjct  584  QQNGVAERMNRTIISKARCMLSNARMNKR--FWAEAANTACYLINRSPSIPLNKKTPIEV  641

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG P DYS LRVFGC AYAH   GKL PRA+KC+FLGY S  K Y+LW+P++ K  + R
Sbjct  642  WSGMPADYSQLRVFGCTAYAHVDNGKLEPRAIKCLFLGYGSGVKRYKLWNPETNKTFMRR  701

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
             + F+++ + +                      P+D +    G + ++      P  EP 
Sbjct  702  SVVFNKSVMFNDS-------------------LPTDVIP---GGSDEEQQY---PQDEP-  735

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
                IA  R +R+   P R    +E +MV YA S A +V+   + + Y+EA
Sbjct  736  ----IAHRRTKRSCGAPVRLI--EECDMVYYAFSCAEQVENTLEPATYTEA  780



>gb|ACL97386.1| Gag-Pol polyprotein [Medicago truncatula]
Length=1305

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 134/235 (57%), Gaps = 24/235 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML  AG+ K   FWAEA  TACY++NRSP +++D K P E+
Sbjct  580  QQNGVAERMNRTLLERTRAMLKTAGMAK--SFWAEAAKTACYVINRSPSTAIDLKTPMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G PVDYS L VFGCP Y   ++    KL+P++ KCIFLGYA   KGYRLW P +RK++
Sbjct  638  WKGKPVDYSSLHVFGCPVYVMYNSQEKTKLDPKSRKCIFLGYADNVKGYRLWDPTARKVV  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ F EN L S  K  ST +                ++   +  +K+  S+    + 
Sbjct  698  VSRDVVFAENELQSEQKNDSTSK--------------ETAIVQMEEKSKESDSSEAESVH  743

Query  357  EPQR--EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            E Q   + +  + R  R  +KP+  +    T+  AY L      +G+ S + EA 
Sbjct  744  EEQEPDDVNDGVRRSTRQTQKPSWQSDYVMTSHDAYCLITE---EGEPSTFHEAL  795



>gb|AAL91607.1|AC099400_13 Putative pol polyprotein [Oryza sativa Japonica Group]
 gb|AAL75759.1| Putative pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP51772.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1005

 Score =   175 bits (444),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 131/231 (57%), Gaps = 48/231 (21%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +A CMLSNA + KR  FWAEA +TACYL+NRSP   L+ K P EV
Sbjct  321  QQNGVAERMNRTIISKAHCMLSNARMNKR--FWAEAANTACYLINRSPSIPLNKKTPIEV  378

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG   DYS LRVFGC AYAH   GKL PRA+KC+FLGY S  KGY+LW+P++ K  +SR
Sbjct  379  WSGMSADYSQLRVFGCTAYAHVDNGKLEPRAIKCLFLGYGSGVKGYKLWNPETNKTFMSR  438

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
             + F+E+ +                         +DS+ T                 +PQ
Sbjct  439  SVIFNESVMF------------------------NDSLPT-----------------DPQ  457

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
             E  IA  R +R+   P R    +E +MV YA S A +V    + + Y+EA
Sbjct  458  DE-PIAHRRTKRSCGAPVRLI--EECDMVYYAFSCAEQVKNTLEPATYTEA  505



>emb|CAN70013.1| hypothetical protein VITISV_017116 [Vitis vinifera]
Length=947

 Score =   173 bits (439),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 101/236 (43%), Positives = 132/236 (56%), Gaps = 38/236 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRT+LER RCMLS+ GL K   FW EAV T  +L++RSP S+L FK P+E 
Sbjct  583  QQNGLAERMNRTILERVRCMLSSLGLSKV--FWVEAVETVVHLISRSPSSALQFKTPQEK  640

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLW--SPDSRKIIL  535
            W+G  VDY  L+VFGC AY H+ T KL PRAVKCIFLGY    KGY+LW  +    K I+
Sbjct  641  WTGKVVDYQHLKVFGCTAYVHTKTDKLEPRAVKCIFLGYPKGVKGYKLWIKTQGKEKCII  700

Query  534  SRDITFDENALLSSGKVPSTGETQSTGEKVEFEF-RPSDSVTTADGNTKDDASTSTAPLV  358
            S+D                         ++E+E  +P  S  T+    +++         
Sbjct  701  SKD------------------------SEMEYETSQPEKSTETSSETVQEEIVQERQD--  734

Query  357  EPQR---EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*E-VDGDSSCYSEA  202
            EP R    YS+A DR +R +K P +Y    +  M  +ALSVA E VD +   Y EA
Sbjct  735  EPTRGLESYSLARDRQKRQVKPPKKYG---QAEMTTFALSVAEEIVDMEPKTYQEA  787



>gb|ACL97385.1| Gag-Pol polyprotein [Medicago truncatula]
Length=1305

 Score =   174 bits (442),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 135/235 (57%), Gaps = 24/235 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML  A + K   FWAEAV TACY++NRSP +++D K P E+
Sbjct  580  QQNGVAERMNRTLLERTRAMLKTAEMAK--SFWAEAVKTACYVINRSPSTTIDLKTPMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G PVDYS L VFGCP Y   ++    KL+P++ KCIFLGYA   KGYRLW P +RK++
Sbjct  638  WKGKPVDYSSLHVFGCPVYVMYNSQERTKLDPKSRKCIFLGYADNVKGYRLWDPTARKVV  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ F EN L S  K  ST             F+ + ++   +  +K+  S+    + 
Sbjct  698  VSRDVVFAENELQSEQKNDST-------------FKET-AILQIEEKSKESDSSEAESVH  743

Query  357  EPQR--EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            E Q   + +  + R  R  +KP+  +    T   AY L      +G+ S + EA 
Sbjct  744  EEQEPDDVNNGVRRSTRQTQKPSWQSDYVMTGHDAYCLIAE---EGEPSTFHEAL  795



>gb|AAD32759.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1356

 Score =   172 bits (436),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 130/231 (56%), Gaps = 34/231 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++E+ R MLS++GL KR  FWAEA  T   L+N++P S+L+F+IP++ 
Sbjct  597  QQNGVAERMNRTIMEKVRSMLSDSGLPKR--FWAEATHTTVLLINKTPSSALNFEIPDKK  654

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSGNP  YS LR +GC A+ H+  GKL PRA K + +GY    KGY++W  D RK ++SR
Sbjct  655  WSGNPPVYSYLRRYGCVAFVHTDDGKLEPRAKKGVLIGYPVGVKGYKVWILDERKCVVSR  714

Query  528  DITFDENA----LLSSGKVPSTGETQSTGEKVEFEFRPSDSV------------------  415
            +I F ENA    L+   +  ST E   TG  +EF+      V                  
Sbjct  715  NIIFQENAVYKDLMQRQENVSTEEDDQTGSYLEFDLEAERDVISGGDQEMVNTIPAPESP  774

Query  414  -----TTADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDD  277
                 TT D N  +D+  + +PL      Y +  DR +R I+ P R+  +D
Sbjct  775  VVSTPTTQDTNDDEDSDVNQSPL-----SYHLVRDRDKREIRAPRRFDDED  820



>gb|ACS74199.1| putative gag-pol polyprotein [Fragaria x ananassa]
Length=1297

 Score =   172 bits (435),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 144/247 (58%), Gaps = 26/247 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL+E+ R M  +AGL    +FWAEA + ACYL+NRSP  +++FK  EEV
Sbjct  552  QQNGVAERMNRTLMEKERSMRFHAGL--PEEFWAEAANHACYLINRSPSRAINFKCAEEV  609

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG PVDYS LRVFGC AYAH       KL P++++C+F+G+    KGY+LW   + K +
Sbjct  610  WSGKPVDYSNLRVFGCSAYAHIPKDERTKLEPKSLECLFIGFEKGVKGYKLWDIVNEKKV  669

Query  537  LSRDITFDENALLS-SGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
            +SRD+ FDE   +S S   PS  ++++  E+ E   + +D V   +   +   +      
Sbjct  670  ISRDVVFDEREAISISLAKPSVADSEAQVEQNE---QGNDEVAIEEPEHQQQPTVMAQVE  726

Query  360  VEPQR-------------EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS  220
              PQR             + SIA+D+P+R  K   R+  + E + V+ ALS++    GD 
Sbjct  727  QSPQRGQNSPIPQAPESFKRSIALDKPKRNRKPIQRFGFEPEED-VSRALSIS---QGDP  782

Query  219  SCYSEAF  199
            + Y +A 
Sbjct  783  TTYEDAI  789



>emb|CAN69199.1| hypothetical protein VITISV_025494 [Vitis vinifera]
Length=540

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 134/234 (57%), Gaps = 33/234 (14%)
 Frame = -1

Query  873  AERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNP  694
            A+R+NRTLL+  RCML ++GL K   FW EAV T CYLVNR+P S++D K  EE+WSG P
Sbjct  283  AKRMNRTLLDGVRCMLYSSGLSKH--FWGEAVMTTCYLVNRTPSSAIDLKTLEELWSGKP  340

Query  693  VDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSR--KIILSRDIT  520
             +Y  LR+FGC  Y H S GKL  R++KCIFLGY    KGY+LW+ +S   KII+SRD+ 
Sbjct  341  SNYDHLRIFGCTTYVHQSEGKLVTRSIKCIFLGYPEGVKGYKLWNKESSGVKIIISRDVV  400

Query  519  FDENALL-----SSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDD------ASTS  373
            F+EN +L     ++G    +     T +K  F+F     +++ DG+ + +        T 
Sbjct  401  FNENEMLFMRTNTAGIKKDSKNKSLTLDKDHFKFEV--ELSSQDGHDQQNDLAHGGLETK  458

Query  372  TAPLV-------------EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYAL  250
               ++             E   +Y ++ DR +R IK P ++   D   ++AYAL
Sbjct  459  GTKVIGSNVEGGVGTNSQEAGLDYLLSRDRAKRNIKPPDKFGFAD---LIAYAL  509



>emb|CAE02229.2| OSJNBb0015C06.7 [Oryza sativa Japonica Group]
Length=977

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 123/219 (56%), Gaps = 36/219 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA +T CYL+NRSP   +  K P +V
Sbjct  405  QQNGVAERMNRTIISKARCMLSNAHMNKR--FWAEAANTICYLINRSPTIPISKKTPIDV  462

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W G P DYS +RVFGC AYAH   GKL PR +K +FLGY S  KGY+LW+P++ K  +SR
Sbjct  463  WFGMPADYSQMRVFGCTAYAHVDNGKLEPRVIKFLFLGYGSGVKGYKLWNPETNKAFMSR  522

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTT---ADGNTKDDASTSTAPLV  358
             + F+E+ +                         +DS++T     G+ ++    S  P  
Sbjct  523  SVVFNESVIF------------------------NDSLSTDVIPGGSDEEQQYVSMQPQD  558

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA  241
            EP     IA  R +R+   P R    +E +MV Y  S  
Sbjct  559  EP-----IAHRRTKRSYGAPIRLI--EECDMVYYTFSCG  590



>ref|XP_009107606.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103833265 
[Brassica rapa]
Length=3353

 Score =   167 bits (423),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/263 (39%), Positives = 138/263 (52%), Gaps = 48/263 (18%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER+NRT++++ R ML+  GL   ++FWAEA STA YL+NR+P+S++DFK+PEEV
Sbjct  510  QQNGVSERMNRTIMDKVRSMLAETGL--GQEFWAEATSTAVYLINRTPNSTIDFKLPEEV  567

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSGN  D S LR FGC AY H S  K  PRA+K +F+GY    KGYR+W P+  K   SR
Sbjct  568  WSGNRPDLSHLRRFGCTAYVHVSQEKTKPRAIKGVFVGYPFGVKGYRVWIPEDLKCTTSR  627

Query  528  DITFDENALLSSGKVPSTGE--------TQSTGE-KVEFEFRPS-----DSVTTADGNTK  391
            ++ F E+ L    +V  T E         Q  G  K    F PS            G T 
Sbjct  628  NVVFREDELYKDTQVNKTTENGSDSVDTNQKAGNPKKIVSFSPSLIRGPSGPNYEHGETS  687

Query  390  DDASTSTAP----------------------------LVEPQREYSIAMDRPRR-TIKKP  298
            D  +TS +                                    Y +A DR RR  +K P
Sbjct  688  DPGNTSVSQQDSEDQGSSSESESDDESEGLTFVEENESESSIEHYMLARDRVRRQNVKPP  747

Query  297  ARYASDDETNMVAYALSVA*EVD  229
            +RY   ++ N+VAYALSVA +++
Sbjct  748  SRY---EDANLVAYALSVADDIE  767


 Score =   167 bits (423),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/263 (39%), Positives = 138/263 (52%), Gaps = 48/263 (18%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NGV+ER+NRT++++ R ML+  GL   ++FWAEA STA YL+NR+P+S++DFK+PEEV
Sbjct  2585  QQNGVSERMNRTIMDKVRSMLAETGL--GQEFWAEATSTAVYLINRTPNSTIDFKLPEEV  2642

Query  708   WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
             WSGN  D S LR FGC AY H S  K  PRA+K +F+GY    KGYR+W P+  K   SR
Sbjct  2643  WSGNRPDLSHLRRFGCTAYVHVSQEKTKPRAIKGVFVGYPFGVKGYRVWIPEDLKCTTSR  2702

Query  528   DITFDENALLSSGKVPSTGE--------TQSTGE-KVEFEFRPS-----DSVTTADGNTK  391
             ++ F E+ L    +V  T E         Q  G  K    F PS            G T 
Sbjct  2703  NVVFREDELYKDTQVNKTTENGSDSVDTNQKAGNPKKIVSFSPSLIRGPSGPNYEHGETS  2762

Query  390   DDASTSTAP----------------------------LVEPQREYSIAMDRPRR-TIKKP  298
             D  +TS +                                    Y +A DR RR  +K P
Sbjct  2763  DPGNTSVSQQDSEDQGSSSESESDDESEGLTFVEENESESSIEHYMLARDRVRRQNVKPP  2822

Query  297   ARYASDDETNMVAYALSVA*EVD  229
             +RY   ++ N+VAYALSVA +++
Sbjct  2823  SRY---EDANLVAYALSVADDIE  2842


 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 124/253 (49%), Gaps = 54/253 (21%)
 Frame = -1

Query  858   RTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSI  679
             R ++ +  C+L        ++FWAEA STA YL+NR+P+S++DFK+PEEVWSGN  D S 
Sbjct  1225  RDIVAQETCLL--------QEFWAEATSTAVYLINRTPNSTIDFKLPEEVWSGNRPDLSH  1276

Query  678   LRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALL  499
             LR FGC AY H S  K  PRA+K +F+GY    KGYR+W P+  K   SR++ F E+ L 
Sbjct  1277  LRRFGCTAYVHVSQEKTKPRAIKGVFVGYPFGVKGYRVWIPEDLKCTTSRNVVFREDELY  1336

Query  498   SSGKVPSTGE--------TQSTGE-KVEFEFRPS-----DSVTTADGNTKDDASTSTAP-  364
                +V  T E         Q  G  K    F PS            G T D  +TS +  
Sbjct  1337  KDTQVNKTTENGSDSVDTNQKAGNPKKIVSFSPSLIRGPSGPNYEHGETSDPGNTSVSQQ  1396

Query  363   ---------------------------LVEPQREYSIAMDRPRR-TIKKPARYASDDETN  268
                                               Y +A DR RR  +K P+RY   ++ N
Sbjct  1397  DSEDQGSSSESESDDESEGLTFVEENESESSIEHYMLARDRVRRQNVKPPSRY---EDAN  1453

Query  267   MVAYALSVA*EVD  229
             +VAYALSVA +++
Sbjct  1454  LVAYALSVADDIE  1466



>gb|ACL97387.1| Gag-Pol polyprotein [Lotus japonicus]
Length=1305

 Score =   166 bits (421),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 99/149 (66%), Gaps = 5/149 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML  AGL K   FWAEA  TACY++NRSP +++  K P E+
Sbjct  580  QQNGVAERMNRTLLERTRAMLKTAGLAK--SFWAEAAKTACYVINRSPSTAIGLKTPMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G P DYS LRVFGCP Y   ++    KL+P++ +C FLGYA   KGYRLW P +RKI 
Sbjct  638  WKGKPGDYSSLRVFGCPVYVMYNSQERTKLDPKSRRCTFLGYADNVKGYRLWDPTARKIF  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGE  451
            +SRD+ F EN L    K   T +  +T E
Sbjct  698  VSRDVIFVENELQKEQKNDGTTKETATVE  726



>emb|CAN60570.1| hypothetical protein VITISV_000227 [Vitis vinifera]
Length=605

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 125/233 (54%), Gaps = 52/233 (22%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q N VAE +N T+ ER +C+  N GL     FW EAV+ ACYL+NRSP ++L  K+ +EV
Sbjct  89   QQNNVAEMMNITIAERTQCLKLNVGL--ENKFWVEAVNMACYLINRSPRATLHGKVVDEV  146

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G+PVDYS LR+FGCP Y H       KL+ ++ +CIFLGY    KG+++W P + K++
Sbjct  147  WIGSPVDYSSLRLFGCPTYVHIPNEDRSKLDEKSRQCIFLGYQKGVKGFKIWDPKANKVV  206

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ FDE  +L                    +++ S                      
Sbjct  207  ISRDVVFDEKTML--------------------QWKSSS---------------------  225

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            E Q+ +SI MDRPR TIK    Y  +D   +V+YAL  +   +GD + + EA 
Sbjct  226  EDQQHHSITMDRPRCTIKPSIMYGFED---LVSYALITS---NGDPTTFQEAI  272



>dbj|BAD34493.1| Gag-Pol [Ipomoea batatas]
Length=1298

 Score =   164 bits (414),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 135/236 (57%), Gaps = 23/236 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML  AGL   + FWAEAV+TACYLVNR+P ++++ K P E+
Sbjct  570  QQNGVAERMNRTLLERTRAMLRAAGL--EKSFWAEAVNTACYLVNRAPSTAIELKTPMEM  627

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G PVDYS L +FG   YA        KL+P++ KC FLGYA   KGYRLW P + K++
Sbjct  628  WTGKPVDYSNLHIFGSIVYAMYNAQEITKLDPKSRKCRFLGYADGVKGYRLWDPTAHKVV  687

Query  537  LSRDITFDENALLSSGKVPSTGET---QSTGEKVEFEFRPSDSVTTADGNTKDDASTSTA  367
            +SRD+ F E+  L  G+V  + E    ++T  +VE EF   DS      + + +  +S A
Sbjct  688  ISRDVIFVEDR-LQRGEVDDSTEKEKPETTQIQVEEEFE-QDSSEAEPAHEEPEPESSGA  745

Query  366  PLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            P            DR +R   +P  ++       VAY L      DG+ S + EA 
Sbjct  746  PTTRQS-------DREKR---RPTWHSDYVMEGNVAYCLLTE---DGEPSTFQEAI  788



>gb|AAD19773.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1335

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 135/242 (56%), Gaps = 39/242 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AERLNRT++++ R MLS +G+ K+  FWAEA STA YL+NRSP ++++F +PEE 
Sbjct  573  QQNGIAERLNRTIMDKVRSMLSRSGMEKK--FWAEAASTAVYLINRSPSTAINFDLPEEK  630

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+G   D S LR FGC AY H+  GKLNPR+ K IF  Y    KGY++W  + +K ++SR
Sbjct  631  WTGALPDLSSLRKFGCLAYIHADQGKLNPRSKKGIFTSYPEGVKGYKVWVLEDKKCVISR  690

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFE---FRP---SDSVTTADGNTKD-----DA  382
            ++ F E  +    K    G++Q+T  + + E     P       T   G T+D     +A
Sbjct  691  NVIFREQVMFKDLK----GDSQNTISESDLEDLRVNPDMNDQEFTDQGGATQDNSNPSEA  746

Query  381  STSTAPL-------------------VEPQREYSIAMDRPRRTIKKPARYASDDETNMVA  259
            +TS  P+                   VE    Y +  DR RRTIK   +Y   +E+NMV 
Sbjct  747  TTSHNPVLNSPTHSQDEESEEEDSDAVEDLSTYQLVRDRVRRTIKANPKY---NESNMVG  803

Query  258  YA  253
            +A
Sbjct  804  FA  805



>ref|XP_007016583.1| Uncharacterized protein TCM_041944 [Theobroma cacao]
 gb|EOY34202.1| Uncharacterized protein TCM_041944 [Theobroma cacao]
Length=698

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 101/153 (66%), Gaps = 4/153 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
              NG+ E + +TLLERA+ M SN GL K   FW +A++ ACYLVNR   ++++FK  ++V
Sbjct  375  HQNGIVEWMKKTLLERAKYMFSNVGLTKV--FWTKAINKACYLVNRFSSTTIEFKTLKKV  432

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSR--KIIL  535
            WSG P DYSILRVFGC  +A  S GKL  RA +CIFLGYA E K YRLW  D +  K ++
Sbjct  433  WSGKPADYSILRVFGCLVHARVSDGKLELRATECIFLGYAYEVKDYRLWCTDCKFPKFMV  492

Query  534  SRDITFDENALLSSGKVPSTGETQSTGEKVEFE  436
            SRD+TF++ ALL   K       Q  G+++E E
Sbjct  493  SRDVTFNKFALLCGIKSRIANTDQEVGKQMELE  525



>ref|XP_008374274.1| PREDICTED: lysosomal alpha-mannosidase-like [Malus domestica]
Length=863

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 125/226 (55%), Gaps = 18/226 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+RLN TLLE+ RCMLS + L K   FW EAV+ AC+++NR P ++   K P EV
Sbjct  46   QQNGVAZRLNXTLLEKVRCMLSQSXLSK--SFWXEAVNYACHIINRLPSAAXQGKTPMEV  103

Query  708  WSGNPV-DYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            W G P  DY  + +FG PAY H +   L+PR  K IFLG++S  KGYRLW P+ +K+++S
Sbjct  104  WXGKPSSDYDYIXIFGSPAYFHVTENXLDPRXKKAIFLGFSSGVKGYRLWCPEMKKLVIS  163

Query  531  RDITFDENALLSSGKVPSTGETQSTGEKV----------EFEFRPSDSVTTADGNTKDDA  382
            RD+TFDE  +    +       Q   EKV          + E   S+ V   +   + + 
Sbjct  164  RDVTFDEEXMXKXSEKNVXDVQQVELEKVXSGTSNPISADVEXTTSEEVGDHEDVEEVEL  223

Query  381  STSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSV  244
              S     +   + SIA +R +R I  PARY+     + V +AL +
Sbjct  224  EDSIZVEXZVSPQESIAKNRGKRQITXPARYS-----DYVXFALPI  264



>gb|ABA97036.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=966

 Score =   159 bits (403),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 137/234 (59%), Gaps = 24/234 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNA + KR  FWAEA +TA  L+N+SP + L+ K P E 
Sbjct  436  QQNGVAERMNRTIISKARCMLSNARMNKR--FWAEATNTA--LINKSPSTPLNKKTPIE-  490

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
                      LRVFGC AYAH   GKL  RA+KC+FLGY    KGY+LW+P++++I++ +
Sbjct  491  ----------LRVFGCTAYAHVDNGKLEHRAIKCLFLGYGLGVKGYKLWNPETKRIVMCK  540

Query  528  DITFDENAL----LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
             + F+E+ +    LS+  +P   + +     V+ E      +   D +  D    S +P+
Sbjct  541  SVVFNESVMFNESLSTDVIPGGSDEEQQYVSVQVEHVDDQEIEIVDNDVHDTVKHS-SPV  599

Query  360  VEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVD-GDSSCYSEA  202
            ++PQ +  IA  R +R+          +E +MV YA S A +V+  + + Y+EA
Sbjct  600  LQPQDQ-PIAHRRTKRSCGALVHLI--EECDMVYYAFSCAEQVNTHEPAAYTEA  650



>ref|XP_010097937.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXB73293.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=1822

 Score =   160 bits (405),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 128/249 (51%), Gaps = 47/249 (19%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTLLER RCML  A L KR  FW E V+TA YLVNR P +++DFK PEEV
Sbjct  46   QQNGLAERMNRTLLERVRCMLIEASLPKR--FWGEVVNTAAYLVNRCPLAAIDFKTPEEV  103

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSP--DSRKIIL  535
            W+  P+++  L+VFGC AYAH   GKL+PRA KC+F+GY    KGY+LW    ++ K  +
Sbjct  104  WTDYPLNFENLKVFGCTAYAHQKEGKLDPRAKKCMFVGYPEGVKGYKLWCKYGNTSKSFI  163

Query  534  SRDITFDEN----ALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTA  367
            SRD+ F E     A ++ G    +G      E+ E E     S      NT+ D    T 
Sbjct  164  SRDVVFRETEYYMATMTQGGSDESGMDNYAKERAEIELEQLGS-----SNTERDDEVVT-  217

Query  366  PLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG-------------  226
                                 +      ++E ++V YAL  A ++D              
Sbjct  218  --------------------NEEDHLQVEEEGDLVYYALVTADDIDDSEPKSYREAVASK  257

Query  225  DSSCYSEAF  199
            DS C+ +A 
Sbjct  258  DSECWKQAM  266



>emb|CDP17738.1| unnamed protein product [Coffea canephora]
Length=798

 Score =   158 bits (400),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 128/200 (64%), Gaps = 11/200 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+E +N+TL+E+ RCMLSNAGL   R FWAEAV+ A +LVNR P S++  K P EV
Sbjct  601  QQNGVSEHMNKTLVEKVRCMLSNAGL--GRKFWAEAVTYAQHLVNRLPSSAIGGKTPLEV  658

Query  708  WSGN-PVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            WSG    DY  LR+F   AY H +  KL+PRA K +F+G+++  KGYRLW  +++K I+S
Sbjct  659  WSGKLATDYDSLRIFDSTAYYHVNESKLDPRAKKALFMGFSAGVKGYRLWYLEAKKTIIS  718

Query  531  RDITFDENALLSS----GKVPSTGETQSTGEKVEFE---FRPSDSVTTADGNTKDDASTS  373
            RD+TFDE+ +L+     G   +  + + T ++VEFE     P++S  +     ++++   
Sbjct  719  RDVTFDESVMLNKITQDGTSGTPQQVECTPKQVEFEQIVVSPANSTISDSPMAEEESDEE  778

Query  372  TAPLVEPQREY-SIAMDRPR  316
                 EPQ++  SIA++R R
Sbjct  779  EVSTQEPQQQQKSIAVNRAR  798



>gb|AFB73912.1| polyprotein [Citrus sinensis]
Length=1309

 Score =   160 bits (404),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 126/236 (53%), Gaps = 22/236 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ER R ML  AGL     FWAEA  TACY+VNRSP +++  K   E+
Sbjct  580  QQNGVAERMNRTLTERIRAMLRTAGL--PNSFWAEAAKTACYIVNRSPSTAIGLKTAMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G P DYS L  FGCP Y   +     KL+P++ KCIFLGYA   KGYRLW P + KI+
Sbjct  638  WTGKPADYSYLHAFGCPVYVMYNAQERTKLDPKSRKCIFLGYADGVKGYRLWDPTAHKIV  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ F E+ L        T + +S    V  E  P +S            S+  AP  
Sbjct  698  ISRDVIFVEDQLQRKDGDDGTVKEKSETVPVYVENNPENS-----------DSSEAAPEH  746

Query  357  EPQREYSIAMDRPRRTI--KKPARYASDDETNM-VAYALSVA*EVDGDSSCYSEAF  199
            E Q          RR+   ++P  + S+  T + VAY L      DG+ S + EA 
Sbjct  747  EEQEPVESEAPEVRRSTRERRPPTWHSEYVTEINVAYCLLTE---DGEPSTFHEAL  799



>dbj|BAA96887.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
Length=1140

 Score =   157 bits (396),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 117/213 (55%), Gaps = 32/213 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL+E+ RC+L+ +GL     FWAEA ST  YLVNRSP S +D  +PEE+
Sbjct  573  QQNGVAERMNRTLMEKVRCLLNESGL--DESFWAEAASTTAYLVNRSPASVVDHNVPEEL  630

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W G    Y  LR FG  AY H   GKL PRA+K +FLGY    KGY++W  D  K ++SR
Sbjct  631  WLGKKPGYKHLRRFGSIAYVHQDQGKLKPRALKGVFLGYPQGVKGYKVWLLDEEKCVISR  690

Query  528  DITFDENALLSS-----------GK------------VPSTGETQSTGEKVEFEFRPSDS  418
            ++ FDE+++  S           GK            V   GE+ ++G  +E     SDS
Sbjct  691  NVVFDEDSVYKSLLPESDKEQIDGKLSKETTVTVNDSVKEKGESSASGGAIE---EISDS  747

Query  417  VTTADGNTKDDASTSTAPLVEPQREYSIAMDRP  319
              +    T++D+   T  L      Y +A DRP
Sbjct  748  SDSEVAATEEDSPIQTVNL----ENYQLARDRP  776



>gb|AFB73911.1| polyprotein [Citrus sinensis]
Length=1309

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 125/236 (53%), Gaps = 22/236 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ER R ML  AGL     FWAEA  TACY+VNRSP +++  K   E+
Sbjct  580  QQNGVAERMNRTLTERIRAMLRTAGL--PNSFWAEAAKTACYIVNRSPSTAIGLKTAMEM  637

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G P DYS L  FGCP Y   +     KL+ ++ +CIFLGYA   KGYRLW P + KI+
Sbjct  638  WTGKPADYSYLHAFGCPMYVMYNAQERTKLDAKSRRCIFLGYADGVKGYRLWDPTAHKIV  697

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            +SRD+ F E+ L        T + +S    V  E  P +S            S+  AP  
Sbjct  698  ISRDVIFVEDQLQRKDGDDGTVKEKSETVPVYVENNPENS-----------DSSEAAPEH  746

Query  357  EPQREYSIAMDRPRRTI--KKPARYASDDETNM-VAYALSVA*EVDGDSSCYSEAF  199
            E Q          RR+   ++P  + S+  T + VAY L      DG+ S + EA 
Sbjct  747  EEQEPVESEAPEVRRSTRERRPPTWHSEYVTEINVAYCLLTE---DGEPSTFHEAL  799



>emb|CAN74624.1| hypothetical protein VITISV_024822 [Vitis vinifera]
Length=1250

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 126/235 (54%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  547  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  604

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  605  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  664

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  665  RSRNVIFNEQVMYKDRXTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSXVD  724

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P     + + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  725  LXTP----VVEVRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYBEAL  767



>emb|CAN72400.1| hypothetical protein VITISV_041204 [Vitis vinifera]
Length=1067

 Score =   154 bits (389),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 126/235 (54%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  432  QQNGVAERMNRTLNERARSMRLHAGLPKI--FWADAVSTAAYLINRGPSVPMEFRLPEEV  489

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  490  WSGKEVKFSHLKVFGCVSYVHIDYDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  549

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  550  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSXVD  609

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  610  LSTPVAE----VRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  652



>emb|CDP17739.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 11/158 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER+N+TL+E+  CMLSNA L   R FWAE V+ A +LVNR P S++  K P EV
Sbjct  209  QQNGVSERMNKTLVEKVHCMLSNARL--GRKFWAETVTYAQHLVNRLPSSAIGGKTPLEV  266

Query  708  WSGNPV-DYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            WSG P  DY  LR+F   AY H +  KL+PRA K IF+G  +  KGYRLW  +++K I+S
Sbjct  267  WSGKPTTDYDSLRIFYSTAYYHVNESKLDPRAKKAIFMGLNAGVKGYRLWCLEAKKTIIS  326

Query  531  RDITFDENALLSSGKVPSTG------ETQSTGEKVEFE  436
            RD+TF+E+A+L+  KV   G      + + T ++VEFE
Sbjct  327  RDVTFNESAMLN--KVTQNGTSGTPQQVECTPKQVEFE  362



>emb|CAN69340.1| hypothetical protein VITISV_032634 [Vitis vinifera]
Length=1298

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 128/233 (55%), Gaps = 15/233 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  571  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  628

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  629  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  688

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +       ++  T+   +K EF      + +T     ++D     + + 
Sbjct  689  RSRNVIFNEQVMYKDRLTVTSXVTEIDQKKSEFVNLDELTESTVQKRGEEDKENVNSKV-  747

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
               R   + + R  R I+ P RY+      ++ Y L       G+  CY+EA 
Sbjct  748  -DLRTPVVEVRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYNEAL  791



>gb|AAD23690.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1333

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 125/236 (53%), Gaps = 45/236 (19%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL+E+ R MLS++GL K+  FWAEA  T   L+N++P S+L++++P++ 
Sbjct  575  QQNGVAERMNRTLMEKVRSMLSDSGLPKK--FWAEATHTTAILINKTPSSALNYEVPDKR  632

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG    YS LR FGC A+ H+  GKLNPRA K I +GY    KGY++W  + +K ++SR
Sbjct  633  WSGKSPIYSYLRRFGCIAFVHTDDGKLNPRAKKGILVGYPIGVKGYKIWLLEEKKCVVSR  692

Query  528  DITFDENA--------------------------------LLSSGKVPSTGETQSTGEKV  445
            ++ F ENA                                +++SG      E QS     
Sbjct  693  NVIFQENASYKDMMQSKDAEKDENEAPPSSYLDLDLDHEEVITSGGDDPIVEAQSP----  748

Query  444  EFEFRPSDSVTTADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDD  277
               F PS + T     T  +   S   +++    Y +  DR RRTI+ P R+  +D
Sbjct  749  ---FNPSPATT----QTYSEGVNSETDIIQSPLSYQLVRDRDRRTIRAPVRFDDED  797



>gb|AAT44257.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1211

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 119/192 (62%), Gaps = 19/192 (10%)
 Frame = -1

Query  738  SLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWS  559
            ++D K P EVWSG+P +YS LRVFGC AYAH   GKL PRA+KCIFLGY S  K Y+LW 
Sbjct  518  TIDKKTPIEVWSGSPANYSDLRVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKDYKLWC  577

Query  558  PDSRKIILSRDITFDENALLSSGKVPSTGETQSTGEK--VEFEFRPS--------DSVTT  409
            P ++K+++SR++ F E+ +L     PST     + EK  V+ E   S        D    
Sbjct  578  PKTKKVVISRNVVFHESVMLHDK--PSTNVPVESQEKASVQVEHLISSGHAPEKEDVAIN  635

Query  408  ADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVD  229
             D +  +D S S+A    P+R  SIA D+P+R IK P RY   +E N+VAYALSVA E++
Sbjct  636  QDASVIED-SDSSAVQQSPKR--SIAKDKPKRNIKPPRRYI--EEANIVAYALSVAEEIE  690

Query  228  GDS--SCYSEAF  199
            G++  S YSEA 
Sbjct  691  GNAEPSTYSEAI  702



>gb|AAC62132.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
Length=1137

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 144/267 (54%), Gaps = 29/267 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAERLNRT++ + R MLS +GL K+  FWA+A STA YL+NRSP SS++ KIPEE+
Sbjct  391  QQNGVAERLNRTIMNKVRSMLSESGLDKK--FWAKAASTAVYLINRSPSSSIENKIPEEL  448

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+    ++S L+ FGC  Y +S  GKL+PRA K +F+GY +  KG+R+W  +  +  +SR
Sbjct  449  WTSAVPNFSGLKRFGCVVYVYSQEGKLDPRAKKGVFVGYPNGVKGFRVWMIEEERCSISR  508

Query  528  DITFDENALLSSGKVPSTGETQ-----STGEKVEFEF---RPSDSVTTADGNTKDDA---  382
            ++ F E+ +       ST         +T     FE    R  D ++   G + DD    
Sbjct  509  NVVFREDVMYKDILNQSTSGMSFDFPLATNRIPSFECAGNRKEDEISVQGGVSDDDTKQS  568

Query  381  ------STSTAPLVEPQREYSIAMDRPRRTIKKPAR---YASDDET--NMVAYALSVA*E  235
                  ST ++     QR Y IA D+P+R  K P +   Y  ++E    +  YA  +   
Sbjct  569  SEESPISTGSSGQNSGQRTYQIARDKPKRQTKIPDKLRDYELNEEVLDEIAGYAYMIT--  626

Query  234  VDG---DSSCYSEAFPIAKFKPYLSLV  163
             DG   + + Y +A   + +K +L  V
Sbjct  627  EDGGNPEPNDYQKALQDSDYKMWLKAV  653



>emb|CAN74341.1| hypothetical protein VITISV_043997 [Vitis vinifera]
Length=1269

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/237 (39%), Positives = 128/237 (54%), Gaps = 23/237 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERA  M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  560  QQNGVAERMNRTLNERAXSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  617

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  618  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  677

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTA----DGNTKDDASTST  370
             SR++ F+E  +    ++  T +     +K +FEF   D +T +     G    +   S 
Sbjct  678  RSRNVIFNEQVMYKD-RLTVTSDVIEIDQK-KFEFVNLDELTESTVQKGGEEDKENVNSX  735

Query  369  APLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              L  P  E   +     R I+ P RY+      ++ Y L       G+  CY+EA 
Sbjct  736  VDLXTPVXEVRXS----SRNIRXPQRYSP-----VLNYLLLTD---GGEPECYNEAL  780



>emb|CAN65504.1| hypothetical protein VITISV_028342 [Vitis vinifera]
Length=1252

 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 126/235 (54%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K  +FWA+A+STA YL+NR P   ++F++PEEV
Sbjct  342  QQNGVAERMNRTLNERARSMRLHAGLPK--NFWADAISTAAYLINRGPSIPMEFRLPEEV  399

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  + +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  400  WSGKEMKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  459

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAS--TSTAP  364
             SR++ F+E  +        +  T+   +K EF      + +T     K+D     S   
Sbjct  460  RSRNVIFNEQVMYKDRSTVVSDVTEIDQKKSEFVKLDELTESTVQKGGKEDKENVNSQVD  519

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+       + Y L       G+  CY EA 
Sbjct  520  LSTPIAE----VRRSSRNIRPPKRYSPG-----LNYLLLTD---GGEPECYDEAL  562



>emb|CAN71109.1| hypothetical protein VITISV_001479 [Vitis vinifera]
Length=1246

 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 125/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  543  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  600

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  601  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  660

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  661  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSQVD  720

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P     + + R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  721  LSTP----VVEVRRSSRNTRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  763



>emb|CAN74198.1| hypothetical protein VITISV_005765 [Vitis vinifera]
Length=1261

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 125/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  534  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  591

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  592  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  651

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  652  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSQVD  711

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P     + + R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  712  LSTP----IVEVRRSSRNTRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  754



>emb|CAN76321.1| hypothetical protein VITISV_044445 [Vitis vinifera]
Length=1279

 Score =   151 bits (381),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 124/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  552  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  609

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  610  WSGKEVKFSHLKVFGCVSYIHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  669

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  670  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEXKENVNSQVD  729

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R  + P RY+      ++ Y L       G+  CY E  
Sbjct  730  LSTPXXE----VRRSSRNXRPPQRYSP-----VLNYLLLTB---GGEPECYBEXL  772



>emb|CAA37919.1| unnamed protein product [Arabidopsis thaliana]
Length=238

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRT++E+ RCML+ +GL +  +FWAEA +T  YL+NRSP S++D  +PEE+
Sbjct  70   QQNGVADRMNRTIMEKVRCMLNESGLGE--EFWAEAAATTAYLINRSPASAIDHNVPEEL  127

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W      Y  LR FG  AY H   GKL PRA+K IF+GY S +KGY++W  + +K ++SR
Sbjct  128  WLNKKPGYKHLRRFGSIAYVHIDQGKLKPRALKGIFIGYPSGTKGYKIWLLEEQKCVISR  187

Query  528  DITFDENAL  502
            ++ F E ++
Sbjct  188  NVLFHEESV  196



>emb|CAN74702.1| hypothetical protein VITISV_023139 [Vitis vinifera]
Length=1222

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 123/233 (53%), Gaps = 41/233 (18%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  521  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  578

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  579  WSGKEVKFSHLKVFGCXSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  638

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +     V   GE     E V               N++ D ST   P+V
Sbjct  639  RSRNVIFNEQVMYKDSTVQKGGEEDK--ENV---------------NSQVDLST---PVV  678

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            E +        R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  679  EVR--------RSSRNTRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  715



>gb|AAK38381.1|AC079028_5 polyprotein, putative [Arabidopsis thaliana]
Length=855

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 123/236 (52%), Gaps = 25/236 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++E+ RC+L+ +GL    +FWAE  +TA Y++NRSP +++D  +PEE+
Sbjct  279  QQNGVAERMNRTVMEKVRCLLNESGL--EEEFWAEVATTAVYIINRSPSAAIDHNVPEEL  336

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W      Y  LR     AY H   GKL PRA+K IF+GY S +KGY++W  + +K ++SR
Sbjct  337  WLNRKPGYKHLRRLRAVAYVHVDQGKLKPRAIKGIFIGYPSGTKGYKVWLLEEQKCVISR  396

Query  528  DITFDENAL---LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTK----------D  388
            ++ F E  +   L+  +     E   T          +  V+   G T           D
Sbjct  397  NVIFQEEVVYKDLNDKETVVKKEDIRTQTDNHLVISKTKEVSDQGGVTHIEECEESDEND  456

Query  387  DASTSTAPLVEPQRE-------YSIAMDRPRRTIKKPARYASDDETNMVAYALSVA  241
            +    T    +P  E       Y +A DR RR I  PAR+    E + VA+AL V 
Sbjct  457  EQEPETVNETDPTVESEGSLANYQLAKDRVRRQINPPARFT---EESGVAFALVVV  509



>emb|CAN60396.1| hypothetical protein VITISV_018063 [Vitis vinifera]
Length=1294

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 128/240 (53%), Gaps = 28/240 (12%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  504  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  561

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESK-GYRLWSPDSRKI  541
            WSG  V +S L+VFGC +Y H    S  KL+ ++  C F+GY    K GYR W   +RKI
Sbjct  562  WSGKEVKFSHLKVFGCISYVHIDFDSRSKLDAKSKICFFIGYGGNEKFGYRFWDEQNRKI  621

Query  540  ILSRDITFDENALLS--SGKVPSTGET-QSTGEKVEFEFRPSDSVTTADGNTKDDASTS-  373
            I SR++ F+E  +    S  V    E  Q   E V  +     +V       K++ ++  
Sbjct  622  IRSRNVIFNEQVMYKYRSSIVSDVTEIDQKKSEFVNLDELIESTVQKGGEEDKENVNSQV  681

Query  372  --TAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              + P+VE        + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  682  NLSTPVVE--------VHRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  725



>emb|CAN69431.1| hypothetical protein VITISV_024659 [Vitis vinifera]
Length=1287

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 125/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  554  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  611

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  612  WSGKEVKFSHLKVFGCISYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  671

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAS--TSTAP  364
             SR++ F+E  +        +  T+   +K EF      + +T     ++D     S   
Sbjct  672  RSRNVIFNEQVMYKDRSSVVSDVTEIDQKKSEFVNLDELTKSTVQKGGEEDKENVNSQVD  731

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P     + + R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  732  LSTP----VVEVRRSSRNTRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  774



>emb|CAA20201.1| putative transposable element [Arabidopsis thaliana]
 emb|CAB79135.1| putative transposable element [Arabidopsis thaliana]
Length=1308

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 135/245 (55%), Gaps = 21/245 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRTL+E+ RC+L+ +GL     FWAEA +TA YLVNRSP S++D  +PEE+
Sbjct  587  QQNGVAKRMNRTLMEKVRCLLNESGL--EEVFWAEAAATAAYLVNRSPASAVDHNVPEEL  644

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W      Y  LR FGC AY H   GKL PRA+K +FLGY   +KGY++W  D  K ++SR
Sbjct  645  WLDKKPGYKHLRRFGCIAYVHLDQGKLKPRALKGVFLGYPQGTKGYKVWLLDEEKCVISR  704

Query  528  DITFDENALL------SSGKVPSTGETQSTGE-----KVEFEFRPSDSVTTADGNTKDDA  382
            +I F+EN +       S   V    + +   E     K   E   +  VT  + + + D+
Sbjct  705  NIVFNENQVYKDIRESSEQSVKDISDLEGYNEFQVSVKEHGECSKTGGVTIEEIDQESDS  764

Query  381  --STSTAPLVEP--QREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS-S  217
              S +  PL+       Y  A DR RR    P + A  D T+  A AL +A E++ +   
Sbjct  765  ENSVTQEPLIASIDLSNYQSARDRERRAPNPPQKLA--DYTHF-ALALVMAEEIESEEPQ  821

Query  216  CYSEA  202
            CY +A
Sbjct  822  CYHDA  826



>emb|CAN73240.1| hypothetical protein VITISV_035336 [Vitis vinifera]
Length=1244

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 124/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL E AR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  517  QQNGVAERMNRTLNECARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  574

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  575  WSGKEVKFSHLKVFGCXSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  634

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  635  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSQVD  694

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P     + + R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  695  LSTP----VVEVRRSSRNTRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  737



>ref|NP_001172143.1| Os01g0116166 [Oryza sativa Japonica Group]
 dbj|BAH90873.1| Os01g0116166 [Oryza sativa Japonica Group]
Length=778

 Score =   147 bits (370),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 123/223 (55%), Gaps = 44/223 (20%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +ARCMLSNAGL K+  FWAEAVSTACYL+NRSP  ++D K P EV
Sbjct  557  QQNGVAERMNRTIISKARCMLSNAGLPKQ--FWAEAVSTACYLINRSPSYAIDKKTPIEV  614

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG+PV+YS LRVFGC AYA      L+ +                    P +   + S+
Sbjct  615  WSGSPVNYSDLRVFGCTAYAPVDNVMLHDK--------------------PSTNVPVESQ  654

Query  528  D-ITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEP  352
            +  +     L+S G  P   +     +    E+  SDS T                 V+ 
Sbjct  655  EKASVQVEHLISLGHAPEKEDVAINQDAPVIEY--SDSST-----------------VQQ  695

Query  351  QREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGD  223
              + SIA D+P+R IK P RY   +E N+VAYALSV  E++GD
Sbjct  696  SPKCSIAKDKPKRNIKPPRRYI--EEANIVAYALSVTEEIEGD  736



>ref|XP_004509781.1| PREDICTED: uncharacterized protein LOC101498326 [Cicer arietinum]
Length=598

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 127/258 (49%), Gaps = 34/258 (13%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTLLER RC+LSNAG+     F  E V T CY +N S  ++++ K P+E+
Sbjct  336  QQNGLAERMNRTLLERMRCILSNAGMHAL--FQGEVVHTTCYFINLSHFTTIELKTPQEM  393

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W GN  +Y+ L+VFGC +Y H +   L PR  K  F+GY S  KGYR+W P+SRK I+  
Sbjct  394  WIGNATNYNHLKVFGCVSYYHVNERNLAPRVKKGHFVGYPSGIKGYRIWCPESRKCIIIS  453

Query  528  DITFDENALLSS-GKVPSTGETQSTGEKVEFEF-----RPSDSVTTADGNTKDDASTSTA  367
            D+ F E  L  S   V +    +   EK + E      +    +T+A    KD   + T 
Sbjct  454  DVKFHEVELYKSVNNVANKDLHKIEDEKFDLEVEKVAEKRRTFLTSAIEKYKDQQKSGTL  513

Query  366  PLVEPQR----------------------EYSIAMDRPRRTIKKPARYASDDETNMVAYA  253
               E  +                      +Y++  DR R T K   RY     T M++Y 
Sbjct  514  LTSEQHQSQQDNINANPIDHAMFQEQESDDYNLIRDRGRITPKPTQRYGY---TYMISYV  570

Query  252  LSVA*E-VDGDSSCYSEA  202
            L    E +  D   Y+E 
Sbjct  571  LHATEEIIQEDRMNYNEV  588



>emb|CAN61548.1| hypothetical protein VITISV_043524 [Vitis vinifera]
Length=1535

 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 126/233 (54%), Gaps = 15/233 (6%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F +PEEV
Sbjct  838   QQNGVAERMNRTLNERARSMRLHAGLPK--IFWADAVSTAAYLINRGPSVPMEFXLPEEV  895

Query  708   WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  896   WSGKEVKFSHLKVFXCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  955

Query  537   LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
              SR++ F+E  +       ++  T+   +K EF      + +T     ++D     + + 
Sbjct  956   RSRNVIFNEQVMYKDRLTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSKV-  1014

Query  357   EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
                R   + + R  R I+ P RY+      ++ Y L       G+  CY+EA 
Sbjct  1015  -DLRTPVVEVRRSSRNIRLPQRYSP-----VLNYLLLTD---GGEPECYNEAL  1058



>emb|CAN78199.1| hypothetical protein VITISV_041785 [Vitis vinifera]
Length=892

 Score =   147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 125/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  + GL K   FWA+AVST  YL+NR P   ++F++PEEV
Sbjct  394  QQNGVAERMNRTLNERARSMRLHVGLPK--TFWADAVSTTAYLINRGPSVPMEFRLPEEV  451

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS   V +S L+VFGC +Y H   ++  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  452  WSDKNVKFSHLKVFGCVSYVHIDSNARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  511

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAS--TSTAP  364
             SR++ F+E  +        +  T+   +K EF      + +T    +++D     S   
Sbjct  512  RSRNVIFNEQVMYKDRSTIVSDITEMDKKKYEFVNLDELTKSTVQKWSEEDKENVNSQVD  571

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  572  LSTPVAE----VRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  614



>emb|CAN81130.1| hypothetical protein VITISV_003944 [Vitis vinifera]
Length=1236

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 123/235 (52%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVST  YL+NR P   ++F++ EEV
Sbjct  547  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTXAYLINRGPSVPMEFRLXEEV  604

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  605  WSGKEVKFSXLKVFCCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  664

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEF-EFRPSDSVTTADGNTKDDAST-STAP  364
             SR++ F+E  +       ++  T+   +K EF         T   G  KD  +  S   
Sbjct  665  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEKDKENVNSQVD  724

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  725  LSTPVXE----VRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYBEAL  767



>emb|CAN69096.1| hypothetical protein VITISV_025437 [Vitis vinifera]
Length=992

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 121/220 (55%), Gaps = 35/220 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q N +AER+NRT+LER RCMLS++GL K   FWAE V T  +L+N+S  S+L  K P+E 
Sbjct  749  QQNALAERMNRTILERVRCMLSSSGLSKV--FWAETVETTVHLINKSLSSALQLKTPQEK  806

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+G   DY  L+VFGC AY H+ T KL  R VKCIFLGY   SKG +     ++ +  S 
Sbjct  807  WTGKYADYQYLKVFGCTAYVHTKTNKLESRVVKCIFLGY---SKGVK-----AKDVEESD  858

Query  528  DITFD-ENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEP  352
             + FD E+  L   K   T  +++  EK+ +E              + D  T      + 
Sbjct  859  QLQFDVEHETLQPKKSTETS-SKTVQEKIVYE--------------RQDEPT------QG  897

Query  351  QREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EV  232
               YS+A DR +R +K P RY    +  M  +ALSVA E+
Sbjct  898  LESYSLARDRQKRQVKPPKRYG---QAEMTTFALSVAEEI  934



>sp|P10978.1|POLX_TOBAC RecName: Full=Retrovirus-related Pol polyprotein from transposon 
TNT 1-94; Includes: RecName: Full=Protease; Includes: RecName: 
Full=Reverse transcriptase; Includes: RecName: Full=Endonuclease 
[Nicotiana tabacum]
 emb|CAA32025.1| unnamed protein product [Nicotiana tabacum]
Length=1328

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 5/132 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++E+ R ML  A L K   FW EAV TACYL+NRSP   L F+IPE V
Sbjct  580  QHNGVAERMNRTIVEKVRSMLRMAKLPK--SFWGEAVQTACYLINRSPSVPLAFEIPERV  637

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+   V YS L+VFGC A+AH       KL+ +++ CIF+GY  E  GYRLW P  +K+I
Sbjct  638  WTNKEVSYSHLKVFGCRAFAHVPKEQRTKLDDKSIPCIFIGYGDEEFGYRLWDPVKKKVI  697

Query  537  LSRDITFDENAL  502
             SRD+ F E+ +
Sbjct  698  RSRDVVFRESEV  709



>emb|CAN67882.1| hypothetical protein VITISV_022356 [Vitis vinifera]
Length=1299

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 125/233 (54%), Gaps = 15/233 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+ VST  YL+NR P   ++F++PEEV
Sbjct  571  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADVVSTTTYLINRGPSVPMEFRLPEEV  628

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  629  WSGKEVKFSHLKVFCCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  688

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +       ++  T+   +K EF      + +T     ++D     + + 
Sbjct  689  RSRNVIFNEQVMYKDRLTVTSDVTEIDQKKSEFVNLDELTESTVQKRGEEDKENVNSKV-  747

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
               R   + + R  R I+ P RY+      ++ Y L       G+  CY+EA 
Sbjct  748  -DLRTPIVEVRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYNEAL  791



>emb|CAB75481.1| copia-like polyprotein [Arabidopsis thaliana]
Length=1363

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 130/245 (53%), Gaps = 29/245 (12%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER+NRT++E+ R ML ++GL KR  FWAEA  TA  L+N++P S+++F+ P++ 
Sbjct  604  QQNGVVERMNRTIMEKVRSMLCDSGLPKR--FWAEATHTAVLLINKTPCSAINFEFPDKR  661

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG    YS LR +GC  + H+  GKLN RA K + +GY S  KGY++W  + +K ++SR
Sbjct  662  WSGKAPIYSYLRRYGCVTFVHTDGGKLNLRAKKGVLIGYPSGVKGYKVWLIEEKKCVVSR  721

Query  528  DITFDENA----LLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDD-------A  382
            +++F ENA    L+   +  S  E    G  ++ +       ++    ++         A
Sbjct  722  NVSFQENAVYKDLMQRKEQVSCEEDDHAGSYIDLDLEADKDNSSGGEQSQAQVTPATRGA  781

Query  381  STSTAPLVEPQ-----------REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*E  235
             TST P  E               Y +  DR RR I+ P R+  +D      YA ++   
Sbjct  782  VTSTPPRYETDDIEETDVHQSPLSYHLVRDRERREIRAPRRFDDED-----YYAEALYTT  836

Query  234  VDGDS  220
             DGD+
Sbjct  837  EDGDA  841



>ref|XP_007012410.1| Uncharacterized protein TCM_037378 [Theobroma cacao]
 gb|EOY30029.1| Uncharacterized protein TCM_037378 [Theobroma cacao]
Length=346

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = -1

Query  786  EAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKC  607
            E ++TACYLVNRSP ++++FK P+EVWS  P DYSILRVFGC  +AH S GKL  R  +C
Sbjct  209  EIINTACYLVNRSPSTAIEFKTPKEVWSDKPADYSILRVFGCLVHAHVSDGKLELRETEC  268

Query  606  IFLGYASESKGYRLWSPDSR--KIILSRDITFDENALLSSGK--VPSTGETQSTGEKVEF  439
            IFLGYA E KGY+LW  D +  K ++SRD+TFD++ALL   K  + +T + Q  G++VE 
Sbjct  269  IFLGYAYEVKGYQLWCTDCKFPKFMVSRDVTFDKSALLYGIKSRIANTSD-QEVGKQVEL  327

Query  438  EF  433
            E 
Sbjct  328  EI  329



>emb|CAN68388.1| hypothetical protein VITISV_038864 [Vitis vinifera]
Length=1172

 Score =   145 bits (365),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 122/235 (52%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEE+
Sbjct  486  QQNGVAKRMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPIEFRLPEEI  543

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H  +    KL  ++  C F+GY  E  G++ W   +RKII
Sbjct  544  WSGKEVKFSHLKVFGCVSYVHIDSYARSKLYAKSKICFFIGYGDEKFGHKFWDEQNRKII  603

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +        +  T+   +K EF      ++S     G    +   S   
Sbjct  604  RSRNVIFNEQVMYKDRSTIVSDVTEINQKKSEFVNLDELTESTVQKGGEEDKENVNSQVD  663

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E      R  R I+ P  Y+      ++ Y L       G+  CY EA 
Sbjct  664  LSTPVAEVC----RSSRNIRPPQHYSP-----VLNYLLLTD---GGEPECYDEAL  706



>emb|CAN76274.1| hypothetical protein VITISV_008497 [Vitis vinifera]
Length=1149

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 122/234 (52%), Gaps = 35/234 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  480  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  537

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  538  WSGKEVKFSHLKVFCCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  597

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +       ++  T+   +K EF             N  +     + P+ 
Sbjct  598  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKXEFV------------NLDELTENLSTPVA  645

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG-DSSCYSEAF  199
            E +        R  R I+ P RY+       + Y L      DG +  CY EA 
Sbjct  646  EVR--------RSSRNIRPPQRYSP-----XLNYLLL----TDGXEPECYDEAL  682



>gb|AAK29467.1| polyprotein-like [Solanum chilense]
Length=1328

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 121/230 (53%), Gaps = 34/230 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++E+ R ML  A L K   FW EAV TACYL+NRSP   L+F IPE V
Sbjct  581  QHNGVAERMNRTIVEKVRSMLRMAKLPK--TFWGEAVRTACYLINRSPSVPLEFDIPERV  638

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+   + YS L+VFGC A+AH       KL+ ++V CIF+GY  E  GYRLW    +K+I
Sbjct  639  WTNKEMSYSHLKVFGCKAFAHVPKEQRTKLDDKSVPCIFIGYGDEEFGYRLWDLVKKKVI  698

Query  537  LSRDITFDE----------------NALL-------SSGKVPSTGETQSTGEKVEFEFRP  427
             SRD+ F E                N ++       SS   P++ E+ +  E VE E +P
Sbjct  699  RSRDVIFRESEVGTAADLSEKAKKKNGIIPNLVTIPSSSNHPTSAES-TIDEVVEQEEQP  757

Query  426  SDSVTTADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDD  277
             + V        +    +T  +  P+ E S  + R  R   +  +Y S +
Sbjct  758  DEIVEQG-----EQLGDNTEQMEYPEEEQSQPLRRSERQRVESTKYPSSE  802



>ref|WP_044909017.1| hypothetical protein, partial [[Clostridium] innocuum]
Length=141

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 87/130 (67%), Gaps = 5/130 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER+NRT++E AR M  +A L K  + WAEAV+TA YL+NR P + LD  IPEE WS
Sbjct  1    NGVAERMNRTIMEHARSMRLHARLPK--NMWAEAVNTAIYLINRGPSTPLDCGIPEEAWS  58

Query  702  GNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G  V YS L+ FGC A+A     +  KL  ++ KC+F+GY  +  GYRLW  ++ KI+ S
Sbjct  59   GKKVSYSFLKTFGCEAFALIDSENRTKLEAKSKKCVFVGYGIDEFGYRLWDFENHKIVRS  118

Query  531  RDITFDENAL  502
            RD+ F+E  L
Sbjct  119  RDVIFNEKVL  128



>gb|AAD17414.1| copia-like retroelement pol polyprotein [Arabidopsis thaliana]
Length=1166

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER+N+T+++  R ML+  G+   ++FWAEA STA YL+NR+P+S + FK+PEEV
Sbjct  480  QQNGVSERMNKTIMDIVRSMLAETGM--SQEFWAEATSTAVYLINRTPNSFIGFKLPEEV  537

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+G   D S LR FGC AY H +  K +PRAVK +F+GY    KGYR+W P   K   SR
Sbjct  538  WTGTKPDLSHLRRFGCSAYVHVTQDKTSPRAVKGVFMGYPCGIKGYRVWLPKEGKCTTSR  597

Query  528  DITFDENAL  502
            ++ F+E  L
Sbjct  598  NVVFNETEL  606



>gb|ADG59810.1| gag-pol polyprotein [Fraxinus excelsior]
Length=188

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 5/114 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTLLER R ML   G+   + FWAEAV TACY++N+SP +++D K P E+
Sbjct  75   QQNGVAERMNRTLLERTRAMLRTTGM--TKSFWAEAVKTACYVINQSPSTAIDLKTPIEM  132

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSP  556
            W+G P +YS L  FG P Y       T KL+P++ KCIFLG A   KGYRLW P
Sbjct  133  WTGKPTNYSHLHTFGSPVYVMYNAQETSKLDPKSRKCIFLGCADGVKGYRLWDP  186



>emb|CAN61435.1| hypothetical protein VITISV_033767 [Vitis vinifera]
Length=1298

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 121/235 (51%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N TL ERAR M  +AGL K   F A+AVSTA YL+NR P   ++F++PEEV
Sbjct  571  QQNGVXERXNXTLNERARSMRLHAGLPK--TFXADAVSTAAYLINRGPSVPMEFRLPEEV  628

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  629  WSGKEVKFSHLKVFGCVSYVHIDSDAXSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  688

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       +   T+   +K EF      ++S     G    +   S   
Sbjct  689  RSRNVIFNEQVMYKDRSTVTXDVTEIDQKKSEFVNLDEXTESTVQKGGEKNKENVNSQVX  748

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  749  LSTPVAE----VRRSXRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  791



>emb|CAN76388.1| hypothetical protein VITISV_037906 [Vitis vinifera]
Length=1148

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 123/236 (52%), Gaps = 21/236 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL +RAR M  +AGL K   FW + VSTA YL+NR P   ++F++PEEV
Sbjct  511  QQNGVAERMNRTLNKRARSMRLHAGLPK--TFWPDVVSTATYLINRGPSVPMEFRLPEEV  568

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  569  WSGKEVKFSHLKVFGCVSYVHIDYDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  628

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +           T+    K EF      + +T     K+D        V
Sbjct  629  RSRNVIFNEQVMYKDRSTVVLDVTEIDQTKSEFVNLDELTESTVQKGGKEDKEN-----V  683

Query  357  EPQREYSIAMDRPRRT---IKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              Q + S  + + RR+   I+   RY+      ++ Y L       G+  CY EA 
Sbjct  684  NSQVDLSTPVAKVRRSSRNIRPSQRYSP-----VLNYLLLTN---GGEPECYDEAL  731



>emb|CAN78195.1| hypothetical protein VITISV_008799 [Vitis vinifera]
Length=1007

 Score =   143 bits (361),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 85/235 (36%), Positives = 123/235 (52%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGV ER+NRTL ERAR M  + GL K   FW +AVSTA YL+NR P   ++F++P+EV
Sbjct  376  RKNGVVERMNRTLNERARSMRLHVGLSK--TFWVDAVSTAAYLINRGPSVPMEFRLPKEV  433

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  434  WSGKEVKFSHLKVFGCVSYVHIDFDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  493

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDA--STSTAP  364
             SR++ F+E  +     +  +   +   +K EF      + +T     K+D     S   
Sbjct  494  RSRNVIFNEQVMYEDRSIVVSDVIEIDQKKSEFVNLDELTESTVQKGGKEDKENENSQVD  553

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + +  R I+   RY+      ++ Y L +     G+  CY EA 
Sbjct  554  LSTPVAE----VRKSSRNIRPSQRYSP-----VLNYLLLI---YGGEPKCYDEAL  596



>emb|CAN60331.1| hypothetical protein VITISV_024553 [Vitis vinifera]
Length=1134

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 125/235 (53%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL++R P   ++F++PEEV
Sbjct  465  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLIBRGPSVPMEFRLPEEV  522

Query  708  WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y    + +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  523  WSGKEVKFSHLKVFCCVSYVYIDYDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  582

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +       ++  T+   +K EF      ++S     G    +   S   
Sbjct  583  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSQVD  642

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  + I+   RY+      ++ Y L       G+  CY+EA 
Sbjct  643  LSTPVAE----VRRSSKNIRPTQRYSP-----VLNYLLLTD---GGEPKCYNEAL  685



>ref|XP_008778480.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103698265 
[Phoenix dactylifera]
Length=1581

 Score =   143 bits (361),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 126/237 (53%), Gaps = 30/237 (13%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NGVAER+N+T+ +RAR M  +AGL   + FWAEAV+TA YL+NR P   L+  IPEE 
Sbjct  1160  QQNGVAERMNKTINDRARSMRIHAGL--PQQFWAEAVNTAAYLINRGPSKKLELGIPEEA  1217

Query  708   WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             W+   +D + LRVFGC +Y H   S   KL+ ++ KCIF+GY  +  GYRLW P+ RKII
Sbjct  1218  WTAKKIDLAHLRVFGCTSYVHVDSSQRSKLDAKSKKCIFVGYGGQPFGYRLWDPEHRKII  1277

Query  537   LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
              S D+ F+E       K+  + E+++  + VE  F   +  +T  G          A   
Sbjct  1278  RSNDVVFNE-------KMQQSYESET--KPVEPCFVDPEEESTNSGQKTQSEQEPKALAP  1328

Query  357   EPQREYSIAMDRPRRTI--KKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAFPI  193
              PQ      + R  R+   K P RY        ++Y L      +G+  C+ EA  +
Sbjct  1329  HPQ------LKRSTRSTHGKPPQRY-----DGTLSYLLLTD---NGEPKCFMEALEV  1371



>emb|CAN80650.1| hypothetical protein VITISV_022906 [Vitis vinifera]
Length=1091

 Score =   142 bits (359),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 126/242 (52%), Gaps = 33/242 (14%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV +R+NRTL ERAR M+ +AGL K   FW +AVSTA YL+NR P   ++F++PEEV
Sbjct  413  QQNGVTKRMNRTLNERARSMMLHAGLPK--TFWVDAVSTAAYLINRGPSVPIEFRLPEEV  470

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY +E  GYR W   +RKII
Sbjct  471  WSGKEVKFSHLKVFCCVSYVHIDSDARSKLDAKSKICFFIGYGNEKFGYRFWDEQNRKII  530

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEF----EFRPSDSVTTADG-----NTKDD  385
             SR++ F+E  +        +   +   +K EF    E   S      +G     N + D
Sbjct  531  KSRNVIFNEQVMYKDRSTVVSDVIEIDQKKSEFVNLDELTESTVQKGGEGDKENVNLQVD  590

Query  384  ASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSE  205
             ST   P+ E +        R  + I+ P RY+      ++ Y L       G+  CY E
Sbjct  591  LST---PVAEVR--------RSSKNIRPPQRYSP-----VLNYLLLTD---GGEPECYDE  631

Query  204  AF  199
            A 
Sbjct  632  AL  633



>emb|CAN71029.1| hypothetical protein VITISV_001707 [Vitis vinifera]
Length=1286

 Score =   142 bits (358),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 124/236 (53%), Gaps = 21/236 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  559  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  616

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y +    +  KL+ ++  C F+ Y  E  GYR W   +RKII
Sbjct  617  WSGKEVKFSHLKVFGCISYVYIDSDARSKLDAKSKICFFIDYGDEKFGYRFWDKQNRKII  676

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +        +  T+   +K EF      + +T     ++D        V
Sbjct  677  RSRNVIFNEQVMYKDRSSVVSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKEN-----V  731

Query  357  EPQREYS---IAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              Q + S   + + R  R  + P RY+      ++ Y L       G   CY EA 
Sbjct  732  NSQVDLSTXVVEVRRSSRNXRPPQRYSP-----VLNYLLLTD---GGXPECYDEAL  779



>ref|XP_012075359.1| PREDICTED: uncharacterized protein LOC105636646 [Jatropha curcas]
Length=1180

 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 5/134 (4%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NG+AER+N T++ER R ML  A L K   FW EAV+TA YL+NR P + LDF IPE+V
Sbjct  1015  QHNGIAERMNHTIIERVRSMLKMANLPK--PFWGEAVNTAVYLINRLPSALLDFDIPEKV  1072

Query  708   WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             W+G  + YS LRVFGC A+ H       KL+ ++V   F+GY  E  GYRLW P  +K++
Sbjct  1073  WAGRNISYSHLRVFGCKAFMHVPKEQRSKLDNKSVPYTFVGYGDEEFGYRLWDPVKKKVV  1132

Query  537   LSRDITFDENALLS  496
              SRD+ F EN +++
Sbjct  1133  RSRDVVFHENEIVA  1146



>emb|CAA31653.1| polyprotein [Arabidopsis thaliana]
Length=1291

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 128/243 (53%), Gaps = 43/243 (18%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++E+ RCML+ +GL +  +FWAEA +TA YL+NRSP S++D  +PEE+
Sbjct  606  QQNGVAERMNRTIMEKVRCMLNESGLGE--EFWAEAAATAAYLINRSPASAIDHNVPEEL  663

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W      Y  LR FG  AY H   GKL PRA+K IF+GY + +KGY++W  +  K ++SR
Sbjct  664  WLNKKPGYKHLRRFGSIAYVHIDQGKLKPRALKGIFIGYPAGTKGYKIWLLEEHKCVISR  723

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVE--  355
            ++ F E ++          +T      VE E  P+    +     K   + ++  +++  
Sbjct  724  NVLFHEESVYK--------DTMKKERVVESEAEPASHSKSTLIKVKTPGNLNSGEVIQVS  775

Query  354  ---------------------PQRE-------YSIAMDRPRRTIKKPARYASDDETNMVA  259
                                 P+ +       Y +A DR RR I  PAR+    E + VA
Sbjct  776  DEEESDESVEEEQEPETQVELPETQTTSSLANYQLARDRERRQIHPPARFT---EESGVA  832

Query  258  YAL  250
            +AL
Sbjct  833  FAL  835



>emb|CAN84102.1| hypothetical protein VITISV_041248 [Vitis vinifera]
Length=894

 Score =   139 bits (351),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 90/247 (36%), Positives = 116/247 (47%), Gaps = 55/247 (22%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRT+LER RCMLS++                     RSP  +L FK P+E 
Sbjct  520  QQNGLAERMNRTILERVRCMLSSS---------------------RSPSLALQFKTPQEK  558

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLW--SPDSRKIIL  535
            W+    DY  L+VFG  AY H+ T KL PRAVKCIFLGY  E KGY+LW  +    K I+
Sbjct  559  WTRKAADYQHLKVFGRTAYVHTKTDKLEPRAVKCIFLGYPKEVKGYKLWIETQGKGKCII  618

Query  534  SRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVE  355
            SRD   +   L                       +P  S  T+    ++D         E
Sbjct  619  SRDFEVEHETL-----------------------QPEKSKETSSKTVQEDIVHEIQD--E  653

Query  354  PQ---REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*E-VDGDSSCYSEAFPIAK  187
            P      YS+A DR +R +K P RY    +     +ALSVA E VD +   Y EA    +
Sbjct  654  PTXGLESYSLARDRQKRQVKPPKRYX---QAEXXTFALSVAEEIVDMEPKTYQEAINXNE  710

Query  186  FKPYLSL  166
               +L L
Sbjct  711  VDQWLXL  717



>emb|CAN66743.1| hypothetical protein VITISV_043469 [Vitis vinifera]
Length=798

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 5/116 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGV E +NRT+ ERARC+  N  L K+  FW EAV+ ACYL+N SP + LD K+ +EVW+
Sbjct  385  NGVVETMNRTIAERARCLRLNVDLEKK--FWPEAVNMACYLINNSPKAVLDGKVAKEVWT  442

Query  702  GNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRK  544
            G+P+DYS LRVFGCPAY H       KL+ ++ +CIFLGY  E KG++LW P   K
Sbjct  443  GSPIDYSSLRVFGCPAYVHIPNEEISKLDAKSRQCIFLGYQKEVKGFKLWDPKENK  498



>emb|CCI55401.1| PH01B015M02.2 [Phyllostachys edulis]
Length=1655

 Score =   140 bits (352),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 95/143 (66%), Gaps = 9/143 (6%)
 Frame = -1

Query  816   GLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSST  637
             GL++R  FWAEA STACYL+NRSP  +++ K P E+WS +  +YS LRVF C AYAH   
Sbjct  1226  GLYRR--FWAEAASTACYLINRSPSIAIEKKTPIEIWSSSLANYSELRVFSCTAYAHVDN  1283

Query  636   GKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALLS---SGKVPSTGET  466
              KL P+AVKCIFLGY S  KGY+LW+P++ K+++SR I F+E+A+L    S  VP   E 
Sbjct  1284  EKLEPKAVKCIFLGYKSGVKGYKLWNPETNKVVISRSIIFNESAMLHDKLSTNVPVEKEI  1343

Query  465   QSTGEKVEFEFRPSDSVTTADGN  397
             +   E   +    S+++ + D N
Sbjct  1344  EGNTEPSSY----SEAINSTDCN  1362



>gb|AAF19226.1|AC007505_2 Highly similar to Ta1-3 polyprotein [Arabidopsis thaliana]
Length=1356

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/242 (36%), Positives = 127/242 (52%), Gaps = 32/242 (13%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++E+ RC+L+ +G+     FWAEA +TA YL+NRSP S+++  +PEE+
Sbjct  596  QQNGVAERMNRTIMEKVRCLLNKSGV--EEVFWAEAAATAAYLINRSPASAINHNVPEEM  653

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W      Y  LR FG  AY H   GKL PRA+K  FLGY + +KGY++W  +  K ++SR
Sbjct  654  WLNRKPGYKHLRKFGSIAYVHQDQGKLKPRALKGFFLGYPAGTKGYKVWLLEEEKCVISR  713

Query  528  DITFDENALLSSGKVP-----STGETQSTGEKVE-------------FEFRPSDSVTTAD  403
            ++ F E+ +    KV      +  + ++T  +VE              + + SDS    +
Sbjct  714  NVVFQESVVYRDLKVKEDDTDNLNQKETTSSEVEQNKFAEASGSGGVIQLQ-SDSEPITE  772

Query  402  GNTKDDA--------STSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALS  247
            G    D+         T   P       Y +A DR RR I  P R+    E + V +AL 
Sbjct  773  GEQSSDSEEEVEYSEKTQETPKRTGLTTYKLARDRVRRNINPPTRFT---EESSVTFALV  829

Query  246  VA  241
            V 
Sbjct  830  VV  831



>emb|CAN74382.1| hypothetical protein VITISV_007945 [Vitis vinifera]
Length=444

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 116/235 (49%), Gaps = 40/235 (17%)
 Frame = -1

Query  801  RDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNP  622
            ++FWAE V    YLVNR P S + FK P E+WS +  DYS LR FG  AYAH + GKL P
Sbjct  5    KEFWAEVVHKIAYLVNRCPSSVIGFKTPMEMWSSSLCDYSNLRTFGYIAYAHQNEGKLEP  64

Query  621  RAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALLSSGKVPSTG-ETQSTGEKV  445
            RA KCIF+GY    KG +LW P ++K  +S D+ F E   L   +  ST  E     +K+
Sbjct  65   RARKCIFVGYLDGVKGNKLWCPTTKKCFISMDVVFRECEFLKDDRETSTNKENGEVKDKL  124

Query  444  EFEFRPSDSVTTADGNTKDDASTSTAPLVEPQR------EYSIAMDRPRRTIKKPARYAS  283
            EF+    D +             +T   +EPQ+       Y +  DR R++I+   R+  
Sbjct  125  EFQMELKDKI------------DATEFEIEPQQYDIPLENYQLTRDRARKSIRPLQRFGY  172

Query  282  DDETNMVAYALSVA*EVDGDSSCYSEAFPIAKFKPYLSLVGCSSC*FHNGFDPRW  118
            +D   MVA +LS+  E+     C       A+ K YL  V C          P+W
Sbjct  173  ND---MVACSLSIGKEL----RC-------AEPKNYLETVSCKD-------SPKW  206



>gb|AAV88069.1| hypothetical retrotransposon [Ipomoea batatas]
Length=1415

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 116/213 (54%), Gaps = 22/213 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRT++ER RCML +A L     FWAEAVSTA +++N SP  +L  ++P++V
Sbjct  575  QLNGLAERMNRTIMERVRCMLDDAKL--PSSFWAEAVSTAVHVINLSPVIALKNEVPDKV  632

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G  V Y  LRVFGC A+ H       KL+ +  +CIF+GY  +  GYRL+ P  +K++
Sbjct  633  WCGKDVSYDHLRVFGCKAFVHVPRDERSKLDSKTRQCIFIGYGFDEFGYRLYDPVEKKLV  692

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFE---FRPSDSVTTADGNTKD-------  388
             SRD+ F EN  +         E++ +G  V+ E    R +D V     N ++       
Sbjct  693  RSRDVVFFENQTIEDIDKVKQPESRDSGSLVDIEPVSRRYTDDVDEVQENVQNGDPVPDY  752

Query  387  -----DASTSTAPLVEPQREY--SIAMDRPRRT  310
                 D       +V  ++E    + +D PRR+
Sbjct  753  QGDTVDVDGHADDVVHQEQEVPSQVPVDLPRRS  785



>emb|CAN69974.1| hypothetical protein VITISV_014388 [Vitis vinifera]
Length=1058

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 123/233 (53%), Gaps = 19/233 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+ +NRTL ERAR M  +A L   + FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  435  QQNGVAKSMNRTLNERARSMRLHARL--PKTFWADAVSTAAYLINRGPSIPMEFRLPEEV  492

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY  E  GYR W   + KII
Sbjct  493  WSGKEVKFSHLKVFCCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDKQNMKII  552

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEF-EFRPSDSVTTADGNTKDDAST-STAP  364
             SR++ F+E  +        +   +   +K EF       + T   G  +D  +  S   
Sbjct  553  RSRNVIFNEQVIYKDRSTIVSDAIEIDKKKSEFVNLDELIASTIQKGGEEDKENVNSQVD  612

Query  363  LVEPQREYSIAMDRPRRTIKKPARYA--------SDDETNMVAYALSVA*EVD  229
            L  P  E    + R  R I+ P RY+        +DD+ N   + L++  E+D
Sbjct  613  LSTPVAE----VRRSSRNIRPPQRYSPVLNYLLLTDDDENSSKWKLAMKDEMD  661



>emb|CAN69680.1| hypothetical protein VITISV_003773 [Vitis vinifera]
Length=1058

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 124/237 (52%), Gaps = 23/237 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA AVST  YL+N+ P   ++F++P+EV
Sbjct  390  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWANAVSTVAYLINQGPSVPMEFRLPKEV  447

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VF C +Y H    +  KL+ ++  C F+GY  E   YR W   ++KII
Sbjct  448  WSGKEVKFSHLKVFSCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFRYRFWDEQNKKII  507

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSV---TTADGNTKDDAST-ST  370
             SR++ F+E  +        +  T+   +K  F+F   D +   T   G  +D  +  S 
Sbjct  508  RSRNMIFNEQVMYKDRSTVVSDVTEIDQKK--FKFVNLDELIESTVQKGGEEDKENVNSQ  565

Query  369  APLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              L  P  E    + R  + I+ P RY+   ++ ++           G+  CY EA 
Sbjct  566  VDLSTPVTE----VRRSSKNIRPPQRYSPVLKSLLLTDG--------GEPKCYDEAL  610



>emb|CAN66588.1| hypothetical protein VITISV_017097 [Vitis vinifera]
Length=815

 Score =   136 bits (342),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 115/229 (50%), Gaps = 65/229 (28%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAE++NRT++ERARC+  NAGL K+  FWAE V+  CYL+NRSP ++LD K+ +EV
Sbjct  235  QQNGVAEKMNRTIIERARCLRLNAGLEKK--FWAEVVNMVCYLINRSPIAALDGKVVKEV  292

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W+G+PVDYS LRVFGCP Y H                             P+ ++     
Sbjct  293  WTGSPVDYSGLRVFGCPVYVH----------------------------IPNEKR-----  319

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
                            S  +  S  + ++ E    D         +D A  +     E +
Sbjct  320  ----------------SKLDANSNEQLIQVELETHD--------IEDHARNAGKFSSEDK  355

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEA  202
            + +SIAMDRPRR IK P RY  +D   +V+YAL  +     DS+ + EA
Sbjct  356  QHHSIAMDRPRRIIKPPIRYGFED---LVSYALITS---SRDSTTFQEA  398



>emb|CAN71161.1| hypothetical protein VITISV_009113 [Vitis vinifera]
Length=1141

 Score =   136 bits (342),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 119/235 (51%), Gaps = 19/235 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAE +NRTL E AR M  +AGL K   FWA+A STA YL+NR P   ++F++P EV
Sbjct  506  QQNGVAEXMNRTLNEXARSMRLHAGLPKX--FWADAXSTAXYLINRGPSVPMEFRLPXEV  563

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             SG  V +S L+VFGC +Y H    +  KL+ ++  C F+ Y  E  GYR W   ++KII
Sbjct  564  XSGKKVKFSHLKVFGCVSYVHIDSDARSKLBAKSKICFFIXYXDEKFGYRFWDEQNKKII  623

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAP  364
             SR++ F+E  +        +  T+   +K EF      ++S     G    +   S   
Sbjct  624  RSRNVIFNEQVMYKDRSTVVSDVTEXDQKKSEFVNLDELTESTVQKGGEEDKENVNSQVD  683

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  684  LSTPVAE----VRRSSRNIRXPQRYSP-----VLNYLLLTN---GGEPECYDEAL  726



>emb|CAN65406.1| hypothetical protein VITISV_030853 [Vitis vinifera]
Length=1017

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 116/230 (50%), Gaps = 35/230 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AE +NRTL+ER RC+LS + L   R FW EA++T  +L+N +P   L+F +P+ +
Sbjct  331  QLNGLAESMNRTLVERVRCLLSQSQL--PRSFWGEALNTVVHLLNLTPCVPLEFDVPDRI  388

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  LRVFGC A+ H       KL+ +   C+F+GY  +  GYR + P  +K++
Sbjct  389  WSNNEICYDHLRVFGCKAFVHIPKDEISKLDAKTRPCVFIGYGHDELGYRFYDPMQKKLV  448

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTT-----------------  409
             SRD+ F E+  +   +  +  E+Q +G+ ++ +  P  +  T                 
Sbjct  449  RSRDVVFMEDHTIQDIEKTNPMESQHSGDLIDLDLAPLTNFPTQVEDEAHDDQHDMGDVE  508

Query  408  ------ADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDD  277
                   D +  + + T+ APL  P R       R  R      RY+ DD
Sbjct  509  TPTQVEVDDDVHEQSPTAEAPLDIPLR-------RSTRDRHLSTRYSVDD  551



>emb|CAN62181.1| hypothetical protein VITISV_044399 [Vitis vinifera]
Length=1264

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 117/233 (50%), Gaps = 35/233 (15%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  571  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  628

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G  V +S L+VFGC +Y H    +  KL+  +  C F+GY  E  GYR W    RKII
Sbjct  629  WNGKEVKFSHLKVFGCVSYVHIDSDARSKLDAXSKICFFIGYGDEKFGYRFWDEQXRKII  688

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
              R++T  +               Q   E V  +   ++S     G    +   S   L 
Sbjct  689  --RNVTEID---------------QKKSEFVNLD-ELTESTVQKGGEXDKENVNSQVDLS  730

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
             P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  731  TPVXE----VRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYBEAL  771



>gb|ABA93547.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=546

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 118/241 (49%), Gaps = 70/241 (29%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT++ +AR                                          
Sbjct  249  QQNGVAERMNRTIISKAR------------------------------------------  266

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
                      LRVFGC AYAH   GKL PRA KCIFLGY S  KGY+LW P+++K+++SR
Sbjct  267  ---------YLRVFGCTAYAHVDNGKLEPRANKCIFLGYPSSVKGYKLWCPETKKVVISR  317

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVE--  355
            +I F E+ +L     PST     + EK   +     S+  A    +D A    AP++E  
Sbjct  318  NIVFHESVMLHDK--PSTNVPVESQEKASVQVEHLISLGHAP-EKEDVAINQDAPVIEDS  374

Query  354  --------PQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSE  205
                    P+R  SIA DRP+R  K P RY   +E N+V YALSVA E++G++  S YS+
Sbjct  375  DSSTVHQYPKR--SIAKDRPKRNTKPPQRYI--EEANIVVYALSVAEEIEGNAEPSTYSK  430

Query  204  A  202
            A
Sbjct  431  A  431



>emb|CAN65867.1| hypothetical protein VITISV_034935 [Vitis vinifera]
Length=1137

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  501  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  558

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  559  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  618

Query  537  LSRDIT  520
              R++T
Sbjct  619  --RNVT  622



>emb|CAN77602.1| hypothetical protein VITISV_024474 [Vitis vinifera]
Length=1207

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 115/212 (54%), Gaps = 7/212 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTL+ER RC+LS + L   R FW EA++T  +++N +P   L+F +P+ +
Sbjct  460  QLNGLAERMNRTLVERVRCLLSQSQL--PRSFWGEALNTVVHVLNLTPCVPLEFDVPDRI  517

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  LRVFGC A+ H       KL+ +   C+F+GY  +  GYR + P  +K++
Sbjct  518  WSKNEISYDHLRVFGCKAFVHIPKDERSKLDAKTRPCVFIGYGQDELGYRFYDPVQKKLV  577

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SRD+ F E+  +   +  +  E+Q +G+ ++ +  P  ++ T   +   D       + 
Sbjct  578  RSRDVVFMEDHTIQDIEKTNPMESQHSGDLIDLDPAPLTNLPTQVEDEAHDDQHDMGDVE  637

Query  357  EPQREYSIAMDRPRRT--IKKPARYASDDETN  268
             P +    A D       ++ P +   DD+ +
Sbjct  638  TPTQVEDEAHDDQHDMGDVETPTQVEVDDDVH  669



>emb|CAN59811.1| hypothetical protein VITISV_006540 [Vitis vinifera]
Length=1061

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 123/236 (52%), Gaps = 21/236 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRTL E AR M  +A L K   FWA  VSTA YL+NR P   ++F++P+EV
Sbjct  249  QKNGVAKRMNRTLNEHARSMRLHARLPK--TFWANVVSTAAYLINRGPSVPMEFRLPKEV  306

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H   ++  KL+ ++  C F+GY  E  GY  W   +RKII
Sbjct  307  WSGKEVKFSHLKVFGCVSYVHIDSNARSKLDAKSKICFFIGYGDEKFGYWFWDEQNRKII  366

Query  537  LSRDITFDENAL--LSSGKVPSTGET-QSTGEKVEFEFRPSDSVTTADGNTKDDASTSTA  367
              R++ F+E  +  + S  V    E  Q   E V  +     +V   D   K++ + S  
Sbjct  367  TCRNVIFNEQVMYKVKSTVVSDVTEIDQKKSEFVNLDELTESTVKKWDEEDKENVN-SQV  425

Query  366  PLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
             L  P  E    + R  + I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  426  NLSTPIAE----VRRFSKNIRXPQRYSP-----VLNYLLLTD---GGEPECYDEAL  469



>pir||S23319 hypothetical protein 2 - Arabidopsis thaliana retrotransposon 
Ta1-2 (strain Landsberg) (fragment)
 emb|CAA37924.1| unnamed protein product [Arabidopsis thaliana]
Length=1084

 Score =   134 bits (337),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 127/243 (52%), Gaps = 43/243 (18%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRT++E+ RCML+ +GL +  +FWAEA +TA YL++RSP S++D  +PEE+
Sbjct  506  QQNGVADRMNRTIMEKVRCMLNESGLGE--EFWAEAAATAAYLISRSPASAIDHNVPEEL  563

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            W      Y  LR FG  AY H   GKL PRA+K IF+GY S +KGY++W  + +K ++SR
Sbjct  564  WLNKKPGYKHLRRFGSIAYVHIDQGKLKPRALKGIFIGYPSGTKGYKIWLLEEQKCVISR  623

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVE--  355
            ++ F E  +          +T      VE E  P+    +     K   + ++  +++  
Sbjct  624  NVLFHEELVYK--------DTIEKERVVESEAEPASHSKSTLIKMKTPGNLNSGGVIQVS  675

Query  354  ---------------------PQRE-------YSIAMDRPRRTIKKPARYASDDETNMVA  259
                                 P+ +       Y +  DR RR I  PAR+    E + VA
Sbjct  676  DEEESDESVDEEQEPEPQVELPETQTTSSLANYQLVRDRERRQIHPPARFT---EESGVA  732

Query  258  YAL  250
            +AL
Sbjct  733  FAL  735



>dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum]
Length=1338

 Score =   134 bits (338),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 97/159 (61%), Gaps = 11/159 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTL+ER RC+LS++ L K   FW EA+ TA Y++N SP   L +K PE++
Sbjct  577  QLNGLAERMNRTLIERTRCLLSHSKLPKA--FWGEALVTAAYVLNHSPCVPLQYKAPEKI  634

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G  + Y  LRVFGC AY H       KL+ +  +C+F+GY  +  GY+ + P  +K++
Sbjct  635  WLGRDISYDQLRVFGCKAYVHVPKDERSKLDVKTRECVFIGYGQDMLGYKFYDPVEKKLV  694

Query  537  LSRDITFDENALLSS-GKVPSTGETQSTGEKVEFEFRPS  424
             SRD+ F E+  +    KV      +ST +  EFE  P+
Sbjct  695  RSRDVVFVEDQTIEDIDKVE-----KSTDDSAEFELPPT  728



>emb|CAB40039.1| putative retrotransposon [Arabidopsis thaliana]
 emb|CAB78169.1| putative retrotransposon [Arabidopsis thaliana]
Length=1230

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N T++E+ R MLS +GL K   FWAEA +T   L+N++P S+++F+I ++ 
Sbjct  581  QQNGVAERMNHTIMEKVRRMLSYSGLPK--TFWAEATNTVVTLINKTPSSAVNFEISDKR  638

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG    Y+ L+ FGC A+ ++  GKL PRA K +FLGY S  KGY++W  + RK  +SR
Sbjct  639  WSGKSPVYNYLKRFGCVAFTYADEGKLVPRAKKGVFLGYLSGEKGYKVWLLEERKCSVSR  698

Query  528  DITFDENAL  502
            ++TF ENA+
Sbjct  699  NVTFQENAV  707



>emb|CAN80993.1| hypothetical protein VITISV_022128 [Vitis vinifera]
Length=1017

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 10/149 (7%)
 Frame = -1

Query  807  KRRDFWA-EAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGK  631
            KR D +  +AV   CYLVNR P S+++FK PEE+W G P +Y  LR+FGC  Y H S GK
Sbjct  118  KRNDLYILKAVMATCYLVNRIPSSAINFKTPEELWFGKPSNYDHLRIFGCITYVHQSEGK  177

Query  630  LNPRAVKCIFLGYASESKGYRLWSPDS--RKIILSRDITFDENALLS-----SGKVPSTG  472
            L PR++KCIFLGY    KGYRLW  +S   KII+SRD+ F+EN +LS     +G    + 
Sbjct  178  LKPRSIKCIFLGYPEGVKGYRLWYKESPGVKIIISRDVMFNENEILSMRTNTAGTEEDSK  237

Query  471  ETQSTGEKVEFEFRPSDSVTTADGNTKDD  385
                T +K  FEF     +++ DG+ + +
Sbjct  238  NRSLTLDKDHFEFEV--ELSSQDGHDQQN  264



>emb|CAN70932.1| hypothetical protein VITISV_040966 [Vitis vinifera]
Length=1212

 Score =   133 bits (335),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 116/225 (52%), Gaps = 19/225 (8%)
 Frame = -1

Query  858  RTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSI  679
            +TL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEVWSG  V +S 
Sbjct  507  QTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEVWSGKEVKFSH  564

Query  678  LRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDEN  508
            L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII SR++ F+E 
Sbjct  565  LKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKIIRSRNVIFNEQ  624

Query  507  ALLSSGKVPSTGETQSTGEKVEFEF--RPSDSVTTADGNTKDDASTSTAPLVEPQREYSI  334
             +       ++  T+   +K EF      ++S     G    +   S   L  P  E   
Sbjct  625  VMYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEEDKENVNSQVDLSTPXVE---  681

Query  333  AMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
             + R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  682  -VRRSSRNTRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  717



>gb|AIC77183.1| polyprotein [Gossypium barbadense]
Length=1369

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+L+ AR M+    L   R FWAEAV  A YL+N+ P  S+  K PEE 
Sbjct  643  QQNGVAERKNRTILDMARSMIKGKHL--PRTFWAEAVECAVYLLNQCPTKSVRHKTPEEA  700

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG+      L++FGC AYAH       KL+ R  KCIF+GY   SK YRL++P ++K+I
Sbjct  701  WSGHKPRVGHLKIFGCIAYAHVPEQQRKKLDDRGEKCIFIGYDKRSKAYRLYNPLTKKLI  760

Query  537  LSRDITFDE  511
            +SRD+ FDE
Sbjct  761  ISRDVEFDE  769



>emb|CAN66323.1| hypothetical protein VITISV_007384 [Vitis vinifera]
Length=1317

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 102/172 (59%), Gaps = 6/172 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTL+ER RC+LS + L   R FW EA++T  +++N +P   L+F + + +
Sbjct  528  QLNGLAERMNRTLVERVRCLLSQSQL--PRSFWDEALNTVVHVLNLTPCVPLEFDVSDRI  585

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  LRVFGC A+ H       KL+ +   C+F+GY  +  GYR + P  +K++
Sbjct  586  WSNNEISYDHLRVFGCKAFVHIPKDERSKLDVKTRPCVFIGYGQDELGYRFYDPVQKKLV  645

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSV-TTADGNTKDD  385
             SRD+ F E+  +   +  +  E+Q +G+ ++ +  P  ++ T  +    DD
Sbjct  646  RSRDVVFMEDHTIQDIEKTNPMESQHSGDLIDLDLAPLKNLPTQVEDEAHDD  697



>emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera]
Length=1290

 Score =   132 bits (333),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 102/191 (53%), Gaps = 5/191 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER+NRTL ERAR M  + GL   + FWA+AVSTA YL+NR P   ++F++P+EV
Sbjct  325  QQNGVTERMNRTLNERARSMRLHVGL--PKTFWADAVSTAAYLINRGPSVPMEFRLPKEV  382

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +  L+VF C +Y H    +  KL  ++  C F+GY  E  GYR W   +RKII
Sbjct  383  WSGKEVKFLHLKVFCCISYVHIDSDARSKLVAKSKICFFIGYGDEKFGYRFWDEQNRKII  442

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR++ F+E  +        +  T+   +K EF      + +T     + D     +   
Sbjct  443  RSRNVIFNEQVMYKDRSTVVSDVTEIDQKKSEFVNLDELTESTVQKRGEKDKENVNSQRY  502

Query  357  EPQREYSIAMD  325
             P   Y +  D
Sbjct  503  SPVLNYLLLTD  513



>gb|ABA99474.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=983

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 117/212 (55%), Gaps = 50/212 (24%)
 Frame = -1

Query  795  FWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRA  616
            FWAEAVSTACYLVNRSP  ++D K P                             + PRA
Sbjct  391  FWAEAVSTACYLVNRSPSYAIDKKTP-----------------------------IEPRA  421

Query  615  VKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALLSSGKVPSTGETQSTGEKVEFE  436
            +KCIFLGY S  KGY+LW P+++K+++SR++ F E+ +L     PST     + EK   +
Sbjct  422  IKCIFLGYPSGVKGYKLWCPETKKVVISRNVVFHESVILHDK--PSTNVPVESQEKTSVQ  479

Query  435  FRPSDSVTTADGNTKDDASTST-APLVE----------PQREYSIAMDRPRRTIKKPARY  289
                  +++     K+D + +  AP+++          P+R  SIA D+P+R IK P RY
Sbjct  480  VE--HLISSGHAPEKEDVAINQDAPVIQDSDSSIVHQSPKR--SIAKDKPKRNIKPPRRY  535

Query  288  ASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
               +E N+VAYALSVA E++G++  S YSEA 
Sbjct  536  I--EEANIVAYALSVAEEIEGNAEPSIYSEAI  565



>emb|CAN68837.1| hypothetical protein VITISV_035956 [Vitis vinifera]
Length=445

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 95/159 (60%), Gaps = 15/159 (9%)
 Frame = -1

Query  747  PHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYR  568
            P +++D K P+EVWSG P  YS L++FGCP YAH + GKL PR++KC+FLG  S  K Y+
Sbjct  24   PPTAIDKKTPQEVWSGTPASYSNLKIFGCPTYAHVNNGKLEPRSIKCVFLGCMSGVKRYK  83

Query  567  LWSPDSRKIILSRDITFDENALLS--SGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNT  394
            LW P+++K+++S+++ F E  +L   S K     E Q +  +VEFE           G  
Sbjct  84   LWXPETKKVMVSKBVIFYETVMLHDLSSKDTCDNEQQKSSTQVEFEI--------GLGYI  135

Query  393  KDDASTSTAPL----VEPQR-EYSIAMDRPRRTIKKPAR  292
             +  S S++ +    V P R +YSI  +RPRR IK P R
Sbjct  136  PESTSHSSSKMKSGDVAPSRPQYSIVKERPRRDIKPPQR  174



>emb|CAN80490.1| hypothetical protein VITISV_004703 [Vitis vinifera]
Length=777

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/237 (36%), Positives = 122/237 (51%), Gaps = 34/237 (14%)
 Frame = -1

Query  816  GLWKRRDFWAEA-VSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSS  640
            GL    D W  A VST  +  NR+  S++DFK PEE+W G   +Y   R+FGC AY H S
Sbjct  284  GLHILEDLWGPARVST--HGGNRTTSSAIDFKTPEELWFGKSSNYEHHRIFGCTAYVHQS  341

Query  639  TGKLNPRAVKCIFLGYASESKGYRLWSPDSR--KIILSRDITFDENALLS--SGKVPSTG  472
             GKL PR++KCIFLGY    KGYRLW+ +S   KII+S D+ F+EN +LS  +  V + G
Sbjct  342  EGKLEPRSIKCIFLGYLEGVKGYRLWNKESMGVKIIISHDVVFNENEMLSMRTNTVGTEG  401

Query  471  ETQSTG---EKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQR---------------  346
            + +       K  FEF     +++ DG+ + +        +E  +               
Sbjct  402  DYEKRSLILYKDHFEFEV--ELSSQDGHDQQNDLAYGGLKIEDTKVTFSNVEGSAGTNSQ  459

Query  345  ----EYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAFPIAK  187
                +Y +  DR +R IK P R++  D   ++AYAL +A E + + S   E   I K
Sbjct  460  EVDLDYFLLRDRAKRNIKPPDRFSFAD---LIAYALLIAMEYEKNKSQIQEVKRILK  513



>ref|XP_008388992.1| PREDICTED: uncharacterized protein LOC103451356 [Malus domestica]
Length=836

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR LLE+ R ++ +  + K+  FW++ V TA YL+NR P   L+FK P EV
Sbjct  530  QQNGVAERKNRDLLEKTRALMFHMNVPKK--FWSQGVLTAAYLINRLPSKVLNFKSPYEV  587

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
                 +++S LRVFGC  + H  T    KL+PRA KC+FLGY+S  KGY+ ++  +RK++
Sbjct  588  LKNRKINFSHLRVFGCTCFVHIQTQNRDKLDPRAAKCVFLGYSSTQKGYKCYNSXTRKMV  647

Query  537  LSRDITFDENA  505
            +SRD+ F+E+ 
Sbjct  648  VSRDVKFEEHV  658



>emb|CAA69272.1| lectin receptor kinase [Arabidopsis thaliana]
Length=623

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  123  QQNGVAERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  180

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  181  WSGRKPGVSHLRVFGSIAHAHVPDEKRNKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  240

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  241  ISRNIVFDEEG  251



>emb|CAN62595.1| hypothetical protein VITISV_023519 [Vitis vinifera]
Length=858

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 5/153 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAE +NRTL ERA  M  + GL K   FW +AVSTA YL+NR P   ++FK+P+EV
Sbjct  288  QQNGVAEHMNRTLNERAGSMRLHVGLPK--TFWVDAVSTAAYLINRGPSVPMEFKLPKEV  345

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS   V +S L+VF C +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  346  WSDKEVKFSHLKVFCCVSYVHIDSDAHSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  405

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEF  439
             SR++ F+E  +        +   +   +K EF
Sbjct  406  RSRNVIFNEQFMYKDMSYVVSBAXEIDQKKXEF  438



>emb|CAN61670.1| hypothetical protein VITISV_040427 [Vitis vinifera]
Length=577

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 107/203 (53%), Gaps = 43/203 (21%)
 Frame = -1

Query  789  AEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVK  610
            + A ST C+L+NR P   +D + P+EVWS  P  YS L++FGC AYAH    KL PR +K
Sbjct  350  SRATSTTCFLINRFPSIDIDKRTPQEVWSSTPASYSDLKIFGCHAYAHVDNRKLEPRCIK  409

Query  609  CIFLGYASESKGYRLWSPDSRKIILSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFR  430
            C+FLGY S  KGY+LW P+ +K+I                              VEF+ R
Sbjct  410  CVFLGYKSGVKGYKLWCPEIKKVI------------------------------VEFKIR  439

Query  429  PSDSV--TTADGNTKDDASTSTA---PLVEPQREYSIAMDRPRRTIKKPARYASDDETNM  265
             S S+  +T+  ++K  +    A   PL  PQ  YSI  D  RR IK   RY    E ++
Sbjct  440  -SRSIPESTSQSSSKMQSGGGVAPSPPLAPPQ--YSIVKDNSRRDIKPLLRYV---EADL  493

Query  264  VAYALSVA*EVDG--DSSCYSEA  202
            VAYAL+VA  +D   + S YS+A
Sbjct  494  VAYALNVAKGIDSRVEPSNYSKA  516



>emb|CAN78192.1| hypothetical protein VITISV_036909 [Vitis vinifera]
Length=1032

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER+N+TL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++ +EVWS
Sbjct  428  NGVAERMNKTLNERARSMRLHAGLPKT--FWADAVSTAAYLINRGPSVPMEFRLSKEVWS  485

Query  702  GNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
               V++S L+VFGC +Y H    +  KL+ ++  C F+ Y  E  GYR W   +RKII S
Sbjct  486  DKEVEFSHLKVFGCISYVHIDSDALSKLDAKSKICYFIDYGDEKFGYRFWDEQNRKIIRS  545

Query  531  RDITFDEN  508
            R++ F+E 
Sbjct  546  RNVIFNEQ  553



>emb|CAN66898.1| hypothetical protein VITISV_037436 [Vitis vinifera]
Length=1183

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 117/239 (49%), Gaps = 40/239 (17%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR                +AVSTA YL+NR P   ++F++PEEV
Sbjct  534  QQNGVAERMNRTLNERAR---------------TDAVSTATYLINRGPSVPMEFRLPEEV  578

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  579  WSGKEVKFSHLKVFGCISYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  638

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEF-EFRPSDSVTTADGNTKDDASTS----  373
             SR++ F+E  +        +  T+   +K EF         T   G  +D  + +    
Sbjct  639  RSRNVIFNEQVMYKDRSSVVSDVTEIDQKKSEFVNLDELTKSTVQKGGEEDKENVNSQVD  698

Query  372  -TAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
             + P+VE +        R  R  + P RY+      ++ Y L       G+  CY EA 
Sbjct  699  LSTPVVEVR--------RSSRNXRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  741



>emb|CAB75469.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana]
Length=1272

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  626  QQNGVAERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  683

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  684  WSGRKPGVSHLRVFGSIAHAHVPDEKRNKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  743

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  744  ISRNIVFDEEG  754



>gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabidopsis thaliana]
Length=1352

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  626  QQNGVAERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  683

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  684  WSGRKSGVSHLRVFGSIAHAHVPDEKRSKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  743

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  744  ISRNIVFDEEG  754



>emb|CAN71313.1| hypothetical protein VITISV_019316 [Vitis vinifera]
Length=1072

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 88/135 (65%), Gaps = 5/135 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+ +NRTL ERAR M  +AGL K   F  +AVSTA YL+NR P   ++F++P+EV
Sbjct  622  QQNGVAKHMNRTLNERARSMRLHAGLPKT--FLVDAVSTAVYLINRGPSVPMEFRLPKEV  679

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   ++KII
Sbjct  680  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSRICFFIGYGDEKFGYRFWDEQNKKII  739

Query  537  LSRDITFDENALLSS  493
             S ++ F+E   LS+
Sbjct  740  RSINVIFNEQVDLST  754



>gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana]
Length=1291

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  565  QQNGVAERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  622

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  623  WSGRKPGVSHLRVFGSIAHAHVPDEKRSKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  682

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  683  ISRNIVFDEEG  693



>ref|XP_006590177.1| PREDICTED: uncharacterized protein LOC102669657 [Glycine max]
Length=711

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 86/129 (67%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+L   R ML +  + K  +FWAEAV+ A YL NRSP  S+  K P+E 
Sbjct  499  QQNGVAERKNRTILNMVRSMLKSKKMPK--EFWAEAVACAVYLTNRSPTRSVHEKTPQEA  556

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S L+VFG  AY H       KL+ ++ K +F+GY S SKGY+L++P+SRKI+
Sbjct  557  WSGRKPGISHLKVFGSIAYTHVPDEKRTKLDDKSEKYVFVGYDSRSKGYKLYNPNSRKIV  616

Query  537  LSRDITFDE  511
            +SRD+ FDE
Sbjct  617  ISRDVEFDE  625



>gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabidopsis thaliana]
 gb|AAG50765.1|AC079131_10 copia-type polyprotein, putative [Arabidopsis thaliana]
Length=1320

 Score =   129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  626  QQNGVAERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  683

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  684  WSGRKPGVSHLRVFGSIAHAHVPDEKRSKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  743

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  744  ISRNIVFDEEG  754



>ref|XP_008372204.1| PREDICTED: uncharacterized protein LOC103435597 [Malus domestica]
Length=1159

 Score =   129 bits (323),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 8/146 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR +LE+ R ++    + KR  FW++ V  A Y++NR P   L+FK P EV
Sbjct  670  QQNGVAERKNRBILEKTRALMLQMNVPKR--FWSQXVMAAVYIINRLPSRVLEFKSPLEV  727

Query  708  WSGNPVDYSILRVFGCPAYAHSST----GKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
              G  +D S LRVFGC  + H  +     KL+P A+KC+FLGY+S  KGY+ + P  RKI
Sbjct  728  MKGRKIDLSHLRVFGCVCFVHVXSHHRASKLDPXALKCVFLGYSSTQKGYKCYDPQLRKI  787

Query  540  ILSRDITFDE-NALLS-SGKVPSTGE  469
            I+S+D+ F E N   S S +  S GE
Sbjct  788  IVSKDVRFHEANPFFSKSHEATSQGE  813


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 12/119 (10%)
 Frame = -1

Query  681   ILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDE-NA  505
             + R F     +H    KL+PRA+KC+FLGY+S  KGY+ + P  RKII+S+D+ F E N 
Sbjct  1006  VARGFTQTFESHHRASKLDPRALKCVFLGYSSTQKGYKCYDPQLRKIIVSKDVRFHEANP  1065

Query  504   LLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTAD-----GNTKDDASTSTAPLVEPQRE  343
               S      + E  S GE +  +  P   ++  D         D+   S  PL E   E
Sbjct  1066  FFS-----KSHEATSQGECI-LDLLPLPRISIPDVLNNRVYNHDNTDASPTPLTEVNNE  1118



>gb|ADN34143.1| copia-type polyprotein [Cucumis melo subsp. melo]
Length=238

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            +GV ER NRT+L  AR ML +  + K  +FWA+AV  A YL NRSP  SL  K P++ W+
Sbjct  52   HGVVERKNRTILNMARSMLKSKKMPK--EFWAQAVKCAMYLSNRSPTRSLWNKTPQKAWT  109

Query  702  GNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G     + LRVFGC AYAH       KL+ ++ KC+F+GY + SK Y+L++P ++K I+S
Sbjct  110  GRKPSIAHLRVFGCMAYAHIPYQKRSKLDDKSEKCVFVGYDASSKDYKLYNPITKKTIVS  169

Query  531  RDITFDENA  505
            RD+ FDE A
Sbjct  170  RDVVFDEEA  178



>gb|EZA50979.1| Copia protein [Cerapachys biroi]
Length=193

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGVAER NRTL+E ARC+L+ +GL     FWAEA++TA Y+ NR    SL    P E+
Sbjct  20   EQNGVAERKNRTLVETARCLLAQSGLPAH--FWAEAINTANYIRNRCISKSLGDNTPYEL  77

Query  708  WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G   D   LR FG   +    + + GK  PR+++ IF+GYA  SKGYR+W P   KI+
Sbjct  78   WQGEKPDIGHLRTFGSKVFVLNKNPNKGKFEPRSIEGIFIGYADASKGYRVWIPKDSKIV  137

Query  537  LSRDITFDE  511
            ++RD+ F E
Sbjct  138  IARDVKFLE  146



>gb|ABR16307.1| unknown [Picea sitchensis]
Length=407

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRTL+E ARCML    +  +  FWAEA++TA Y+VNR+P  ++  K PEE 
Sbjct  233  QQNGVAERKNRTLMEMARCMLHARNMDPK--FWAEAINTATYIVNRTPTIAVKHKTPEEA  290

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS      S  +VFGC  Y H       KL+ ++ KCI +GY+  SK YR++ P+  +I+
Sbjct  291  WSRRKPTVSHFKVFGCDVYVHIPDEKRKKLDRKSHKCIMVGYSETSKAYRVYDPEKNEIL  350

Query  537  LSRDITFDENAL  502
            + RD+ FDE  +
Sbjct  351  IRRDVIFDERCI  362



>emb|CAN77659.1| hypothetical protein VITISV_030914 [Vitis vinifera]
Length=626

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 82/136 (60%), Gaps = 15/136 (11%)
 Frame = -1

Query  804  RRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLN  625
            RR  W +A+ TACYLVNR P +++ FK P E W  +P DY  L++FGC AYAH    KL 
Sbjct  208  RRQLWGKALKTACYLVNRCPSAAVXFKTPPEAWLRHPADYGNLKIFGCSAYAHIKQDKLK  267

Query  624  PRAVKCIFLGYASESKGYRLW--SPDSRKIILSRDITFDE-NALLSSGKVPSTGETQSTG  454
            PRA+KCIFLGY+   KGY+LW   P + K ++S D+ F+E N  LS  K P +  TQ T 
Sbjct  268  PRALKCIFLGYSDGIKGYKLWCIEPGNEKCVISXDVVFNEVNMPLS--KAPKSDHTQXTS  325

Query  453  ----------EKVEFE  436
                      E +EFE
Sbjct  326  IRTILSIVAKEDLEFE  341



>emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana]
Length=1352

 Score =   128 bits (321),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  626  QQNGVVERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  683

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  684  WSGRKPGVSHLRVFGSIAHAHVPDEKRSKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  743

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  744  ISRNIVFDEEG  754



>gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thaliana]
Length=1352

 Score =   127 bits (320),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER NRT+LE AR ML +  L K  + WAEAV+ A YL+NRSP  S+  K P+E 
Sbjct  626  QQNGVVERKNRTILEMARSMLKSKRLPK--ELWAEAVACAVYLLNRSPTKSVSGKTPQEA  683

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S LRVFG  A+AH       KL+ ++ K IF+GY + SKGY+L++PD++K I
Sbjct  684  WSGRKPGVSHLRVFGSIAHAHVPDEKRSKLDDKSEKYIFIGYDNNSKGYKLYNPDTKKTI  743

Query  537  LSRDITFDENA  505
            +SR+I FDE  
Sbjct  744  ISRNIVFDEEG  754



>ref|XP_009348351.1| PREDICTED: uncharacterized protein LOC103939989 [Pyrus x bretschneideri]
Length=911

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 112/212 (53%), Gaps = 15/212 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR LLE+ R ++    + KR  FW++A+ TA Y++NR P   L+ K P E+
Sbjct  646  QQNGVAERKNRDLLEKTRSLMFQMQVPKR--FWSQALLTAAYIINRLPTRVLNSKSPFEI  703

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
              G   D +  R+FGC  Y H       KL PRA+KC+F+GY+S  KGY+ ++P + K++
Sbjct  704  MKGRTADLTHFRIFGCTCYVHVQANHRDKLEPRAIKCVFMGYSSSQKGYKCYNPHTGKLV  763

Query  537  LSRDITFDENALLSSGKVPSTGETQS--------TGEKVEFEFRPSDSVTTA--DGNTKD  388
            +SRD+ FDE     +   P++ + +S        T  ++  +  P   ++ +  D    +
Sbjct  764  VSRDVRFDELVPFFNNHSPNSSQGESLMDIFPLPTLAEIHTDTPPYHPISDSPVDEMVSE  823

Query  387  DASTSTAPLVEPQREYSIAMDRPRRTIKKPAR  292
            D   + AP+V  Q   +     P R    P R
Sbjct  824  DIPRAPAPVVATQPIVAAPKRNPTRDRNPPLR  855



>ref|XP_008387850.1| PREDICTED: uncharacterized protein LOC103450292 [Malus domestica]
Length=778

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 82/129 (64%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR LLE+ R ++    + KR  FW++ V TA YL+NR P   L FK P E+
Sbjct  536  QQNGVAERKNRDLLEKTRALMLQMNVPKR--FWSQGVMTAAYLINRLPSRVLGFKSPMEI  593

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
                 VD S L+VFGC  + H       KL+PRA KCIFLGY+S  KGY+ ++P  +++I
Sbjct  594  IKNRKVDLSHLKVFGCICFVHVQPLHRDKLDPRATKCIFLGYSSTQKGYKCYNPQLKRLI  653

Query  537  LSRDITFDE  511
            +S+D+ F E
Sbjct  654  VSKDVQFHE  662



>emb|CAN80930.1| hypothetical protein VITISV_005279 [Vitis vinifera]
Length=1291

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER NRT++E ARCML    L K    WAEAV+T+ YL+NR P  S+  K P E 
Sbjct  599  QQNGVSERKNRTVMEMARCMLFEKKLPKL--LWAEAVNTSVYLLNRLPTKSVQSKTPIEA  656

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG       L+VFG   Y H  +   GKL+ RA K +F+GYA+ESKGYR++S    KI+
Sbjct  657  WSGVKPSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIV  716

Query  537  LSRDITFDENA  505
            +SRD+ FDEN+
Sbjct  717  ISRDVHFDENS  727



>emb|CAN77765.1| hypothetical protein VITISV_021568 [Vitis vinifera]
Length=611

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++FK+PEEV
Sbjct  492  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFKLPEEV  549

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLW  562
            WSG  V +S L+VF C  Y H    +  KL+ ++  C F+GY  E  GYR W
Sbjct  550  WSGKEVKFSHLKVFSCVFYVHIDSDARSKLDXKSKICFFIGYGDEKFGYRFW  601



>emb|CAN82357.1| hypothetical protein VITISV_005778 [Vitis vinifera]
Length=1024

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 5/120 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N+TL ERAR M  +AGL K   FWA+AVSTA YL+N+ P   ++F++P+EV
Sbjct  444  QQNGVAERMNKTLNERARSMRLHAGLPK--TFWADAVSTATYLINQGPSDPMEFRLPDEV  501

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFG  +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  502  WSGKEVKFSHLKVFGYVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  561



>gb|KDQ06095.1| hypothetical protein BOTBODRAFT_82766, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=162

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (67%), Gaps = 6/126 (5%)
 Frame = -1

Query  879  GVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSG  700
            GVAER+NRT +E A+C+L ++ L   ++ WAEAVST  YL+NR P +  + KIP E+W G
Sbjct  40   GVAERVNRTAMEHAQCLLFDSNL--PQNMWAEAVSTTVYLLNRMPTTRAEGKIPYELWHG  97

Query  699  NPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            +  + S LRVFGC A+A        KL P++VKCI LGY   S  YRL+ P++R I +S+
Sbjct  98   SKPNVSHLRVFGCTAFAKIPAEKRSKLGPQSVKCILLGYQGSSI-YRLYDPETRTIFVSQ  156

Query  528  DITFDE  511
            D+ F E
Sbjct  157  DVRFIE  162



>ref|XP_010274086.1| PREDICTED: uncharacterized protein LOC104609460 [Nelumbo nucifera]
Length=567

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 86/139 (62%), Gaps = 14/139 (10%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER+NRTL++RAR MLS AGL  ++ FW E ++T CYLVNRSP + LD KIP++V
Sbjct  7    QQNGVVERMNRTLMDRARSMLSAAGL--KQCFWLETINTTCYLVNRSPTTVLDCKIPKDV  64

Query  708  WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYA-------SESKGYRLWS  559
            W GN VDYS LR FGC AY         KL  ++ KC+FL YA       S SK      
Sbjct  65   WLGNLVDYSFLRTFGCDAYVWIPKEQRIKLYAKSKKCLFLSYAEDSMQKESSSKTIEKVE  124

Query  558  PDSRKIILSR--DITFDEN  508
             +S + I  +  D+T DEN
Sbjct  125  EESFQKIQEQQIDVTVDEN  143



>emb|CAN75440.1| hypothetical protein VITISV_007304 [Vitis vinifera]
Length=1362

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 100/172 (58%), Gaps = 7/172 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTL+ER RC+LS + L   R FW EA++T  +++N +P   L+F +P+ +
Sbjct  557  QLNGLAERMNRTLVERVRCLLSQSQL--PRSFWGEALNTIVHVLNLTPCVPLEFDVPDRI  614

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  LRVFGC A+ H       KL+ +   C+F+GY  +  GY+ +    +K+ 
Sbjct  615  WSNNEISYDHLRVFGCKAFVHIPKDERSKLDAKTRPCVFIGYGQDELGYKFYDLVQKKLX  674

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTA--DGNTKD  388
             S D+ F E+  +   +  +  E+Q +G+ ++ +  P  ++ T   DG   D
Sbjct  675  RSXDVVFMEDHTIQDIEKTNPMESQHSGDLIDLDPAPLTNLPTQVEDGAHDD  726



>emb|CAN75261.1| hypothetical protein VITISV_041144 [Vitis vinifera]
Length=654

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER NR ++E ARCML    L K    W EAV+T+ YL+NR P  S+  K P E 
Sbjct  520  QQNGVFERKNRIVMEMARCMLFEKKLPKL--LWVEAVNTSVYLLNRLPTKSVQSKTPIEA  577

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  +    L+VFG   Y H  +   GKL+ RA K +F+GYA+ESKGY+++S    KI+
Sbjct  578  WSGVKLSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYKIYSLSRMKIV  637

Query  537  LSRDITFDEN  508
            +SRD+ FDEN
Sbjct  638  ISRDVHFDEN  647



>emb|CAN63196.1| hypothetical protein VITISV_035792 [Vitis vinifera]
Length=1179

 Score =   125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 111/235 (47%), Gaps = 39/235 (17%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR                       YL+NR P   +DF++PEEV
Sbjct  571  QQNGVAERMNRTLNERART----------------------YLINRGPSVPMDFRLPEEV  608

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR W   +RKII
Sbjct  609  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRFWDEQNRKII  668

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEF-EFRPSDSVTTADGNTKDDAST-STAP  364
             SR++ F+E  +       ++  T+   +K EF      +  T   G  +D  +  S   
Sbjct  669  RSRNVIFNEQVMYKDRSTVTSDVTEIDQKKSEFVNLDELNESTVQKGGEEDKENVNSQVD  728

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
            L  P  E    + R  R I+ P RY+      ++ Y L       G   CY EA 
Sbjct  729  LSTPVAE----VRRSSRNIRPPQRYSP-----VLNYLLLTD---GGKPECYDEAL  771



>ref|XP_008213150.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 [Nasonia vitripennis]
Length=1015

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG AERLNRTLL++ARCM+ +AG+ K   FWAEAV+ A Y+ NR+P     +K P+E+
Sbjct  590  QQNGRAERLNRTLLDKARCMILDAGVAK--SFWAEAVAVAAYVHNRTPKRCTKYKTPQEL  647

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G   D S ++VFGC A  H   S  GK++ +  +CIF+GY    K YRLW P ++ ++
Sbjct  648  WTGKIPDLSHIKVFGCKAIVHVPESKRGKMDAKGTRCIFIGYCPTRKAYRLWDPSAKGVV  707

Query  537  LSRDITFDENALL  499
            +SRD+TF E+  L
Sbjct  708  ISRDVTFYEHGSL  720



>emb|CAN72238.1| hypothetical protein VITISV_010775 [Vitis vinifera]
Length=807

 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 105/234 (45%), Gaps = 44/234 (19%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG AE +NRT LER                    V    +L+NRSP S+L FK P+E 
Sbjct  345  QQNGFAESMNRTTLERGEMYAVKF-----------RVVKVVHLINRSPSSALQFKTPQEK  393

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLW--SPDSRKIIL  535
            W+G  VDY  L+VF   AY H+ T KL P  VKCIFLGY    KGY+LW  +    K I+
Sbjct  394  WTGKVVDYQYLKVFRSTAYVHTKTDKLEPWVVKCIFLGYPKGVKGYKLWIETQGKGKCII  453

Query  534  SRDITFDENALLSSGKVPSTGETQSTGEKVEFE-FRPSDSVTTADGNTKDDASTSTAPLV  358
            SRD+TF+E  +           +     +VE E  +P  S  T                 
Sbjct  454  SRDVTFNEQDMPKQTPAKDVEGSNQLQFEVEHETLQPEKSTET-----------------  496

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*E-VDGDSSCYSEAF  199
                     +   +R +K P RY    +  M  +ALSVA E VD +   Y EA 
Sbjct  497  ---------IQEEKRQVKPPKRYG---QAKMTTFALSVAEEIVDMEPKTYQEAI  538



>emb|CAN70871.1| hypothetical protein VITISV_000567 [Vitis vinifera]
Length=511

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 83/126 (66%), Gaps = 3/126 (2%)
 Frame = -1

Query  876  VAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGN  697
            + +++ +TL+E+  C+LSN  L K   FWAEA +  C+L+N S  +++D K P+EVW   
Sbjct  82   IEKQIEKTLMEKVCCILSNVSLPK--SFWAEATAIDCFLINCSSSTAIDKKTPQEVWFST  139

Query  696  PVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITF  517
            P  Y  L++FGCP YAH   GKL  R +K +FLGY    KGY+L  P ++K+I+++DI F
Sbjct  140  PASYFDLKIFGCPTYAHVDNGKLELRFIKSVFLGYKYGVKGYKLGCPKTKKVIVNKDI-F  198

Query  516  DENALL  499
             E A+L
Sbjct  199  YETAML  204



>emb|CAN68235.1| hypothetical protein VITISV_037104 [Vitis vinifera]
Length=2041

 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 87/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             QXNGV+ER NRT++E ARCML    L K    WAEAV+T+ YL+NR P  S+  K P E 
Sbjct  1337  QXNGVSERKNRTVMEMARCMLFEKKLPKL--LWAEAVNTSVYLLNRLPTKSVQSKTPIEA  1394

Query  708   WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             WSG       L+VFG   Y H  +   GKL+ RA K +F+GYA+ESKGYR++S    KI+
Sbjct  1395  WSGVKPSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIV  1454

Query  537   LSRDITFDENA  505
             +SRD+ FDEN+
Sbjct  1455  ISRDVHFDENS  1465



>emb|CAN79540.1| hypothetical protein VITISV_016973 [Vitis vinifera]
Length=699

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = -1

Query  717  EEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            ++VWSG P  YS L++FGCP +AH    KL PR++KC+ LGY S  KGY LW  +++K+I
Sbjct  220  KQVWSGTPTSYSBLKIFGCPXHAHVDNRKLEPRSIKCVILGYKSGVKGYELWCLETKKVI  279

Query  537  LSRDITFDENALL--SSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAP  364
            +SR++ F E  +L  SS +     E   +  +VEFEF       +   ++ +  S+  AP
Sbjct  280  VSRBVIFYETIMLHDSSFRDSCDKEQXKSSTQVEFEFGSRSIPBSTSQSSSEMKSSVVAP  339

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGD  223
               PQ  Y IA ++PRR IK P RYA   E ++V YAL+V  EV+ D
Sbjct  340  -SPPQ--YFIAKNKPRRYIKPPHRYA---EADLVVYALNVV-EVNCD  379



>emb|CAN66809.1| hypothetical protein VITISV_010919 [Vitis vinifera]
Length=1183

 Score =   124 bits (312),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 104/191 (54%), Gaps = 8/191 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+ ER+NRTL+ER RC+LS + L   R FW+EA++T  +++N +P   L+F +P+++
Sbjct  559  QLNGLVERMNRTLVERVRCLLSQSQL--PRSFWSEALNTIVHVLNLTPCVHLEFDVPDKM  616

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  L VFGC A+ H S     KL+ +   C+F+GY  +  GYR + P  +K++
Sbjct  617  WSDNEISYDHLXVFGCKAFVHISKDERSKLDAKTRPCVFIGYGQDELGYRFYDPVQKKLV  676

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SRD  F E   +   +     E Q +   ++ +  P   +T      +D+A      + 
Sbjct  677  RSRDAMFMEXHTIQDIEKTDVIEFQYSDNLIDLDPVP---LTHFPTQVEDEAHDDQHDIS  733

Query  357  EPQREYSIAMD  325
            + +    + MD
Sbjct  734  DVETPTQVEMD  744



>ref|XP_008338000.1| PREDICTED: uncharacterized protein LOC103401070 [Malus domestica]
Length=952

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER NR LLE+ R ++    + KR  FW++ V  A Y++NR P   L+FK P EV
Sbjct  670  QQNGVSERKNRDLLEKTRALMLQMNVPKR--FWSQGVMAAAYIINRLPSRVLEFKSPLEV  727

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
              G  +D S L+VFGC  + H  +    KL+PRA KCIFLGY+S  KGY+ ++   +++I
Sbjct  728  MKGRKIDLSHLKVFGCICFVHVQSLHRDKLDPRAAKCIFLGYSSTQKGYKCYNSQLKRLI  787

Query  537  LSRDITFDE-NALLS-SGKVPSTGE  469
            +S+D+ F E N   S S ++ + G+
Sbjct  788  MSKDVRFHETNHFFSKSSEITAQGD  812



>emb|CAN70420.1| hypothetical protein VITISV_033745 [Vitis vinifera]
Length=151

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT+ +R  CMLS A L     FW +A+ T   L+N  P  SL+  IPE V
Sbjct  7    QQNGVAERMNRTICDRISCMLSRAKL--PTSFWGKAMRTTVDLINLPPSYSLEGDIPERV  64

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+ N   +  LRVFGC A+ +       KL+ +  +CIFLGY++E  GY+LW   ++KII
Sbjct  65   WTRNFFSFEHLRVFGCRAFVYVPRDERSKLDSKTKQCIFLGYSNEEFGYKLWDLTTKKII  124

Query  537  LSRDITFDENALL  499
             SRD+ F E+  +
Sbjct  125  -SRDVVFFEDQTI  136



>gb|ABB47665.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47666.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1682

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER +R ++E AR +L  +  +    FWAEA+STA YL+N  P SSL  + P EV  
Sbjct  482  NGVAERKHRHIIETARTLLIAS--FVPAHFWAEAISTAVYLINMQPSSSLQGRSPGEVLF  539

Query  702  GNPVDYSILRVFGCPAY---AHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G+P  Y  LRVFGC  Y   A     KL  ++V+C+FLGY+ E KGYR + P +R+I +S
Sbjct  540  GSPPRYDHLRVFGCTCYVLLAPRERTKLTAQSVECVFLGYSLEHKGYRCYDPSARRIRIS  599

Query  531  RDITFDENA--LLSSGKVPSTGE  469
            RD+TFDEN     SS   PS+ E
Sbjct  600  RDVTFDENKPFFYSSTNQPSSPE  622



>emb|CAN77122.1| hypothetical protein VITISV_013624 [Vitis vinifera]
Length=1269

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV++R NRT++E ARCML    L K    WAEAV+T+ YL+NR P  S+  K P E 
Sbjct  604  QQNGVSKRKNRTVMEMARCMLFEKKLPKL--LWAEAVNTSVYLLNRLPTKSVQSKTPIEA  661

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG       L+VFG   Y H  +   GKL+ RA K +F+GY +ESKGYR++S    KI+
Sbjct  662  WSGVKPSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYVAESKGYRIYSLSRMKIV  721

Query  537  LSRDITFDENA  505
            +SRD+ FDEN+
Sbjct  722  ISRDVHFDENS  732



>ref|NP_001175213.1| Os07g0500000 [Oryza sativa Japonica Group]
 dbj|BAH93941.1| Os07g0500000 [Oryza sativa Japonica Group]
Length=662

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 84/128 (66%), Gaps = 5/128 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER +R ++E AR +L  +  +    FWAEA+STA YL+N  P SSL  K P E+  
Sbjct  260  NGVAERKHRHIIETARTLLIAS--FVPAHFWAEAISTAVYLINMQPSSSLHGKSPGEMLF  317

Query  702  GNPVDYSILRVFGCPAY---AHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G+P  Y  LRVFGC  Y   A     KL  ++V+C+FLGY+ E KGYR + P +R+I +S
Sbjct  318  GSPPRYDHLRVFGCTCYVLLAPRERTKLTAQSVECVFLGYSLEHKGYRCYDPSARRIRIS  377

Query  531  RDITFDEN  508
            RD+TFDEN
Sbjct  378  RDVTFDEN  385



>emb|CAN75724.1| hypothetical protein VITISV_040386 [Vitis vinifera]
Length=885

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 102/191 (53%), Gaps = 8/191 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+ ER+N TL+ER RC+LS + L   R FW EA++T  +++N +P   L+F +P+ +
Sbjct  367  QLNGLTERMNXTLVERVRCLLSQSQL--PRSFWGEALNTVVHVLNLTPCVPLEFDVPDRI  424

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  LRVFGC A+ H       KL+ +   C+F+GY  +  GYR +    +K++
Sbjct  425  WSNNEISYDYLRVFGCKAFVHIPKDKRSKLDAKTRPCVFIGYGQDELGYRFYDQVQKKLV  484

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SRD  F E+  +   +     + Q +   ++F+  P   +T      +D+A      + 
Sbjct  485  RSRDAMFMEDHTIQDIEKTDVTKFQYSDNLIDFDPVP---LTHLPTQVEDEAHDDQPNIG  541

Query  357  EPQREYSIAMD  325
            + +    + MD
Sbjct  542  DVETPTQVEMD  552



>emb|CAN76896.1| hypothetical protein VITISV_010605 [Vitis vinifera]
Length=1146

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 104/203 (51%), Gaps = 22/203 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  540  QQNGVAERMNRTLNERARSMRLHAGLPKT--FWADAVSTAAYLINRGPSVPMEFRLPEEV  597

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG  V +S L+VFGC +Y H  +               A      + W   +RKII SR
Sbjct  598  WSGKEVKFSHLKVFGCVSYVHIDSD--------------ARSKLDAKFWDEQNRKIIRSR  643

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEF-EFRPSDSVTTADGNTKDDAST-STAPLVE  355
            ++ F+E  +       ++  T+   +K EF         T   G  KD  +  S   L  
Sbjct  644  NVIFNEQVIYKDRSTVTSDVTEIDQKKSEFVNLDELTESTVQKGGEKDKENVNSHVDLST  703

Query  354  PQREYSIAMDRPRRTIKKPARYA  286
            P  E    + R  R I+ P RY+
Sbjct  704  PVAE----VRRSSRNIRPPQRYS  722



>gb|KFK24421.1| hypothetical protein AALP_AAs56100U000100, partial [Arabis alpina]
Length=489

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 91/147 (62%), Gaps = 5/147 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER N+T++   R  LS   + K   FWAE V    Y++NR P ++L  + PEEV
Sbjct  30   QQNGVAERRNQTIMNLVRSTLSEKKMPKV--FWAEGVKWITYVLNRCPTNALQDQTPEEV  87

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG   +    R+FGC  + H   +   KL+ ++ KC+FLG + ESK YR+++P+S+KI 
Sbjct  88   WSGIKPNVQHFRIFGCIGHVHIPEAKRTKLDDKSFKCVFLGVSEESKAYRMYNPNSKKIT  147

Query  537  LSRDITFDENALLSSGKVPSTGETQST  457
            +SRD+ F+E+     G+  + GE +S+
Sbjct  148  VSRDVVFEEDENWDWGRKNAEGEIESS  174



>emb|CDO76211.1| hypothetical protein BN946_scf184602.g1, partial [Trametes cinnabarina]
Length=954

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 80/133 (60%), Gaps = 6/133 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG AER NRT++E+A  ML +AGL     FW  AV  A ++ NR P   L ++ P   
Sbjct  142  QQNGRAERWNRTIVEKAMSMLHHAGL--SHGFWQLAVEAAVHIYNRQPMRRLKWRCPITA  199

Query  708  WSGNPVDYSILRVFGCPAYAHSST----GKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G   D S  RVFGC A+ H       GKL+ +AV+ IF+GY   +KGY+ W+P +R I
Sbjct  200  WDGTVPDVSYFRVFGCKAFVHVQKAKREGKLDKKAVEMIFVGYEPGTKGYKFWNPATRSI  259

Query  540  ILSRDITFDENAL  502
            ++SRD+ FDE + 
Sbjct  260  VISRDVIFDEESF  272



>ref|XP_011551371.1| PREDICTED: uncharacterized protein LOC105383056 [Plutella xylostella]
Length=1896

 Score =   123 bits (309),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 86/131 (66%), Gaps = 4/131 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT++E+ RCML +AGL  +  FWAEAV+TA YL NRSP  ++    PEE 
Sbjct  717  QQNGVAERANRTIMEKVRCMLMDAGLGMK--FWAEAVNTAVYLKNRSPTKAVLGATPEEK  774

Query  708  WSGNPVDYSILRVFGCPAYAH-SSTGKLNPRAVKCIFLGYASESKGYRLWSP-DSRKIIL  535
            WS   V+ + L+VFGC AY    +  KL+ ++   IF+GY+ ESKGYRL  P + R I  
Sbjct  775  WSKKKVNLNNLKVFGCIAYVMVKNRKKLDQKSKPYIFMGYSEESKGYRLIDPTNPRDIKH  834

Query  534  SRDITFDENAL  502
            SRD+ F E+  
Sbjct  835  SRDVVFLEDKF  845



>emb|CAN60145.1| hypothetical protein VITISV_019412 [Vitis vinifera]
Length=1227

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 117/233 (50%), Gaps = 25/233 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL E AR M  +AGL K   FWA+AV TA YL+NR P   ++F+ PEEV
Sbjct  526  QQNGVAERMNRTLNECARSMRLHAGLPK--TFWADAVXTAAYLINRGPSVPMEFRFPEEV  583

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS   V +  L+VFGC +Y H   ++  KL  ++    F+GY  +  GYR W   +RKII
Sbjct  584  WSSKEVKFLHLKVFGCVSYVHIDSNARSKLXAKSKIFFFIGYGDKKFGYRFWDEQNRKII  643

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
             SR    ++ + ++S  +      Q   E V  +   ++S     G    +   S   L 
Sbjct  644  RSR----NDRSTVTSDVIEI---DQKKSEFVNLD-ELTESTVQKGGEEDKENVNSQVDLS  695

Query  357  EPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
             P  E    + R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  696  IPVAE----VRRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  736



>emb|CAN74767.1| hypothetical protein VITISV_041860 [Vitis vinifera]
Length=1945

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER N+T++E ARCML    L K    WAEAV+T+ YL+NR P  S+  K P + 
Sbjct  692  QQNGVSERKNKTVMEMARCMLFEKKLPKL--LWAEAVNTSVYLLNRLPTKSVQSKTPIKA  749

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG       L+VFG   Y H  +   GKL+ RA K +F+GYA+ESKGYR++S    KI+
Sbjct  750  WSGVKPSVKHLKVFGSFCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIV  809

Query  537  LSRDITFDENA  505
            +SRD+ FDEN+
Sbjct  810  ISRDVHFDENS  820



>ref|XP_010534024.1| PREDICTED: uncharacterized protein LOC104809678 [Tarenaya hassleriana]
Length=2364

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR L+E AR M+ +  + KR  FW +AV T+CYL+NR P   L+ K P EV
Sbjct  514  QQNGVAERKNRHLMEVARAMMFHHHVPKR--FWCDAVMTSCYLINRLPTKILNDKSPFEV  571

Query  708  WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             +        LRVFGC  Y      +  KL+P++VKC+FLGY+++ KGY+ + P++RK+ 
Sbjct  572  LNDTQPSLDFLRVFGCLCYVFVPEDNRNKLDPKSVKCVFLGYSTKKKGYKCYQPETRKLF  631

Query  537  LSRDITFDENA  505
            +SRD+ F E+ 
Sbjct  632  VSRDVKFLEDV  642


 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 5/131 (4%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             Q NGVAER NR L+E AR M+ +  + KR  FW + V T+CYL+NR P   L+ K P EV
Sbjct  1408  QQNGVAERKNRHLMEVARAMMFHHHVPKR--FWCDVVMTSCYLINRLPTKILNDKSPFEV  1465

Query  708   WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
              +        LRVFGC  Y      +  KL+P++VKC+FLGY+++ KGY+ + P++RK+ 
Sbjct  1466  LNDTQPSLDFLRVFGCLCYVFVPEDNRNKLDPKSVKCVFLGYSTKKKGYKCYQPETRKLF  1525

Query  537   LSRDITFDENA  505
             +SRD+ F E+ 
Sbjct  1526  VSRDVKFLEDV  1536



>ref|XP_008337163.1| PREDICTED: uncharacterized protein LOC103400289 [Malus domestica]
Length=480

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 113/219 (52%), Gaps = 36/219 (16%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAE  NR LLE+ R ++    + KR  FW+  + TA Y++NR P   L+ K P EV
Sbjct  277  QQNGVAEXKNRDLLEKTRSLMFQMQVPKR--FWSXXLLTATYIINRLPTRVLNAKSPFEV  334

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
              G  VD + L +FGC  Y H   +   KL PRAVKC F+GY+S  KGY+ ++  + K++
Sbjct  335  MKGKTVDLTHLXIFGCTCYVHIQATHRDKLEPRAVKCAFMGYSSSQKGYKCYNSHTGKLV  394

Query  537  LSRDITFDE---------------NALLSSGKVPSTGETQSTGEKVEFEFRPSDSV--TT  409
            +SRDI FDE                +L+ +  +P+ GE  +          P + +  T 
Sbjct  395  VSRDIRFDEVTHFFHKDSENNPQGESLMDTFPLPTPGEIHAN---------PPNPIINTN  445

Query  408  ADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPAR  292
             D    ++  +++AP  +PQ     ++  PRR    PAR
Sbjct  446  IDEVVSEEVPSASAP--QPQAATPQSVIAPRRN---PAR  479



>emb|CAN72453.1| hypothetical protein VITISV_008931 [Vitis vinifera]
Length=977

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER NRT++E ARCML    L K    WAE V+T+ YL+NR P  S   K P E 
Sbjct  357  QQNGVSERNNRTVMEMARCMLFEKKLPKL--LWAEVVNTSVYLLNRLPTKSFQSKTPIEA  414

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       L+VFG   Y H  +   GKL+ RA K +F+GYA+ESKGYR++S    KI+
Sbjct  415  WFGVKPSVKHLKVFGSFCYLHVPSVKRGKLDERAKKGVFVGYAAESKGYRIYSLSRMKIV  474

Query  537  LSRDITFDENA  505
            +SR++ FDEN+
Sbjct  475  ISREVHFDENS  485



>emb|CAN63536.1| hypothetical protein VITISV_002860 [Vitis vinifera]
Length=1041

 Score =   121 bits (304),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 68/201 (34%), Positives = 107/201 (53%), Gaps = 13/201 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N T++   R +L+ +G+ K   FW EAV+ + +++NRSP   +    P+E 
Sbjct  398  QQNGVCERKNSTIMNMVRSLLTTSGIPK--SFWLEAVNWSIHILNRSPTLVVQNMTPKEA  455

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG  +  +  R+FGC AYA+       KL+ +  KCIFLG + + K Y+L++P + KI+
Sbjct  456  WSGRKLVVNHFRIFGCIAYAYIPDEKRRKLDNKGEKCIFLGVSDKLKAYKLYNPSTMKIV  515

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
            LSRD+ FDE    S        +     E +  +F   +       N +++  T   P+V
Sbjct  516  LSRDVVFDEKDTWS-------WKQNGVKENIPVDFDDDEKWQQPMENEQEEEVTQNVPIV  568

Query  357  EPQREYSIAMDRPRRTIKKPA  295
            + Q   +    RP+R  K+PA
Sbjct  569  D-QSPLATESQRPQRVRKRPA  588



>emb|CAN83869.1| hypothetical protein VITISV_037705 [Vitis vinifera]
Length=901

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 119/239 (50%), Gaps = 53/239 (22%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+N TL E AR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  429  QQNGVAERMNXTLNEXARSMRLHAGLPK--TFWADAVSTAAYLINRGPSVPMEFRLPEEV  486

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYR------LWSP  556
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR      +   
Sbjct  487  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYRSTVVSDVTEI  546

Query  555  DSRKIILSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDAST  376
            D +K   S+ +  DE   L+   V      Q  GE+V+            + N++ D ST
Sbjct  547  DQKK---SKFVNLDE---LTESTV------QKGGEEVK-----------ENVNSQVDLST  583

Query  375  STAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
              A +            R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  584  PVAEVC-----------RSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  623



>emb|CAN79061.1| hypothetical protein VITISV_024577 [Vitis vinifera]
Length=1424

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N+T++E A+ ML   GL   + FWAEAV+TA YL+NR P  +L  K P E 
Sbjct  691  QQNGVVERKNQTVMEMAKAMLYEKGL--PKIFWAEAVNTAVYLLNRCPTKALLNKTPIEA  748

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG        +VFGC  Y+        KL+  + KCIF+GY+S+SKGYRL++  + K+I
Sbjct  749  WSGRKPSVRHFKVFGCLCYSQVPKQRRSKLDETSEKCIFMGYSSQSKGYRLYNLKTXKLI  808

Query  537  LSRDITFDENA  505
            +SRD+ FDE  
Sbjct  809  ISRDVIFDEKV  819



>gb|ABA91380.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1138

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 96/162 (59%), Gaps = 33/162 (20%)
 Frame = -1

Query  678  LRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALL  499
            LRVFGC AYAH   GKL PRA+KCIFLGY S  KGY+LW  +++K+++SR++ F E+ +L
Sbjct  528  LRVFGCTAYAHVDNGKLEPRAIKCIFLGYPSGVKGYKLWCSETKKVVISRNVVFHESVML  587

Query  498  SSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQREYSIAMDRP  319
                                  +PS +V      +++ AS   +P      ++SIA D+P
Sbjct  588  HD--------------------KPSTNVPI---ESQEKASVQQSP------KHSIAKDKP  618

Query  318  RRTIKKPARYASDDETNMVAYALSVA*EVDGDS--SCYSEAF  199
            +R  + P RY   +E N+VAYALSVA E++G++  S YSEA 
Sbjct  619  KRNTRPPQRYI--EEANIVAYALSVAEEIEGNAEPSTYSEAI  658



>ref|XP_008356174.1| PREDICTED: uncharacterized protein LOC103419864 [Malus domestica]
Length=1016

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAE+ NR LLE+ R ++    + KR  FW++A+ TA Y++NR P   L+ K P EV
Sbjct  267  QQNGVAEQKNRDLLEKTRSLMFQMQVPKR--FWSQALLTATYIINRLPTRVLNAKSPFEV  324

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
              G  +D + L++FGC  Y H   +   KL PRAVKC F+GY+S  KGY+ ++  + K++
Sbjct  325  MKGRTIDLTHLKIFGCTCYVHIQATHHDKLEPRAVKCAFMGYSSSQKGYKCYNSHTGKLV  384

Query  537  LSRDITFDE  511
            +SRDI FDE
Sbjct  385  VSRDIRFDE  393



>ref|XP_006590044.1| PREDICTED: uncharacterized protein LOC102665857 [Glycine max]
Length=678

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+L   R ML +  + K  +FWA+AV+ A YL N S   S+  K P+E 
Sbjct  543  QQNGVAERKNRTILNMVRSMLKSKKMLK--EFWAKAVACAVYLTNCSLTRSVHEKTPQEA  600

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S L+VFG  AY H       KL+ ++ K +F+GY S SKGY+L++P+SRKI+
Sbjct  601  WSGRKPGISHLKVFGSIAYTHVPDEKRTKLDDKSEKYVFVGYDSRSKGYKLYNPNSRKIV  660

Query  537  LSRDITFDE  511
            +SRD+ FDE
Sbjct  661  ISRDVEFDE  669



>emb|CAN69998.1| hypothetical protein VITISV_006839 [Vitis vinifera]
Length=1211

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K  +FWA+AVSTA YL+NR P   ++F++ EEV
Sbjct  510  QQNGVAERMNRTLNERARSMRLHAGLPK--NFWADAVSTAAYLINRGPSXPMEFRLXEEV  567

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYR  568
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E  GYR
Sbjct  568  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYGDEKFGYR  617



>emb|CAN79644.1| hypothetical protein VITISV_033788 [Vitis vinifera]
Length=1181

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER N T++E ARCML    L K    WAEA++T+ YL+NR P  S+  K P E 
Sbjct  570  QQNGVSERKNITVMEMARCMLFEKKLPKL--LWAEAINTSVYLLNRLPTKSVQSKTPIEA  627

Query  708  WSGNPVDYSILRVFGCPAYAHS---STGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG       L+VFG   Y H      GKL+ RA K +F+GY  ESKGYR++S    KI+
Sbjct  628  WSGVKPSVKHLKVFGSFCYLHVPFVKRGKLDERAEKGVFVGYVVESKGYRIYSLSKMKIV  687

Query  537  LSRDITFDENA  505
            +SRD+ FDEN+
Sbjct  688  ISRDVHFDENS  698



>emb|CAN71038.1| hypothetical protein VITISV_011062 [Vitis vinifera]
Length=646

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 112/230 (49%), Gaps = 44/230 (19%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+A+STA YL+NR P   ++F++PEEV
Sbjct  46   QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAISTATYLINRGPSVPMEFRLPEEV  103

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG  V +S L+VFGC +Y H  +               A      + W   +RK+I SR
Sbjct  104  WSGKEVKFSHLKVFGCVSYVHIDSD--------------ARSKLDAKFWDEQNRKVIRSR  149

Query  528  DITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLVEPQ  349
            ++ F+E  +       ++  T+   +K EF           D  TK + ST  A +    
Sbjct  150  NVIFNEQVMYKDRSTVTSDVTEIDQKKSEF--------VNLDELTK-NLSTPVAKV----  196

Query  348  REYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEAF  199
                    R  R I+ P RY+      ++ Y L       G+  CY EA 
Sbjct  197  -------RRSSRNIRPPQRYSP-----VLNYLLLTD---GGEPECYDEAL  231



>emb|CAN66213.1| hypothetical protein VITISV_005090 [Vitis vinifera]
Length=458

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 78/127 (61%), Gaps = 5/127 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+ ER+NRT+ +R +CML +A L K   FW EA+ T   L+N SP   L   I E V
Sbjct  261  QQNGIVERMNRTICDRIKCMLFHAKLPK--SFWGEAMRTTVDLINLSPSYPLVGGILERV  318

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+   V +  LRVFGC A+ H       KL+ +  +CIFLGY++E  GYRLW P ++KII
Sbjct  319  WTRKFVSFEHLRVFGCRAFVHVLRDKQSKLDSKTKQCIFLGYSNEEFGYRLWDPATKKII  378

Query  537  LSRDITF  517
             SR + F
Sbjct  379  RSRYVVF  385



>emb|CAN73703.1| hypothetical protein VITISV_000540 [Vitis vinifera]
Length=612

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 104/208 (50%), Gaps = 21/208 (10%)
 Frame = -1

Query  801  RDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAH---SSTGK  631
            + FW +AVSTA YL+NR P   ++FK+PE+VWSG  V +S L+VFGC +Y H    +  K
Sbjct  9    KTFWVDAVSTAAYLINRGPSIPMEFKLPEKVWSGKEVKFSHLKVFGCVSYVHIDSDARSK  68

Query  630  LNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFDENALLSSGKVPSTGETQSTGE  451
            L+ ++  C F+GY  E   YR W   +RKII SR++ F++  +        +  T+   +
Sbjct  69   LDAKSKICFFIGYGDEKLSYRFWDEQNRKIIRSRNVIFNKQVIYKDRSTIVSDVTEIDQK  128

Query  450  KVEF----EFRPSDSVTTADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYAS  283
            K EF    EF  ++S     G    +   S   L  P  E    + R  R I+ P RY+ 
Sbjct  129  KSEFVNLDEF--TESTVQKGGEEDKENVNSQVDLSTPVVE----VRRSSRNIRPPQRYSP  182

Query  282  DDETNMVAYALSVA*EVDGDSSCYSEAF  199
                 ++ Y L       G+  CY EA 
Sbjct  183  -----VLNYLLLTD---GGEPECYDEAL  202



>emb|CDO68437.1| hypothetical protein BN946_scf184707.g18 [Trametes cinnabarina]
Length=1053

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 6/133 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG AER NRT++E+A  ML +AGL     FW  AV  A ++ NR P   L ++ P   
Sbjct  241  QQNGRAERWNRTIVEKAMSMLHHAGL--SHGFWQLAVEAAIHIYNRQPMRRLKWRCPITA  298

Query  708  WSGNPVDYSILRVFGCPAYAHSST----GKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G   D S  RVFGC A+ H       GKL+ +AV+ IF+GY   +KGY+ W+P +R I
Sbjct  299  WDGTVPDVSYFRVFGCKAFVHVQKAKREGKLDKKAVEMIFVGYEPGTKGYKFWNPATRSI  358

Query  540  ILSRDITFDENAL  502
            ++SRD+ FD+ + 
Sbjct  359  VVSRDVIFDKESF  371



>emb|CAN72676.1| hypothetical protein VITISV_020406 [Vitis vinifera]
Length=1183

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGVAER NRT++E AR M+    L     FWAE V+TA YL+N SP  ++  + P E 
Sbjct  531  EQNGVAERKNRTVVEMARSMMKAKNL--SNHFWAEGVATAVYLLNISPTKAVLNRTPYEA  588

Query  708  WSGNPVDYSILRVFGCPAY----AHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G     S L+VFG  AY    +H+ + KL+ ++VKCIF+GY S+SKGY+L++P S KI
Sbjct  589  WYGKKPWVSHLKVFGSVAYTLIESHNRS-KLDEKSVKCIFIGYCSQSKGYKLYNPVSGKI  647

Query  540  ILSRDITFDENA  505
            I+SR++ FDE A
Sbjct  648  IVSRNVVFDEKA  659



>ref|XP_011459846.1| PREDICTED: uncharacterized protein LOC105350128 [Fragaria vesca 
subsp. vesca]
Length=675

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 88/142 (62%), Gaps = 6/142 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NG+AER NR LL + R +L    + K+  FW++ + TA +L+NR P   L  K P E+  
Sbjct  384  NGIAERKNRDLLNKTRALLFQMNVPKK--FWSQGILTATHLINRLPSRVLHMKSPFEIMK  441

Query  702  GNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G   + S LR+FGC  Y H       KL+ +A KC+FLGY++  KGY+ ++P +RK+++S
Sbjct  442  GRKSELSHLRIFGCVCYVHIQAIHRDKLDAKAAKCVFLGYSTTQKGYKCYNPKTRKLVVS  501

Query  531  RDITFDENA-LLSSGKVPSTGE  469
            RD+ FDE++   S  +V + GE
Sbjct  502  RDVRFDESSPFFSRPEVSTQGE  523



>emb|CAN74160.1| hypothetical protein VITISV_018405 [Vitis vinifera]
Length=1302

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 107/207 (52%), Gaps = 14/207 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG+AER+NRTL+ER RC+LS + L   R FW EA++T  +++N +P   L+F +P+ +
Sbjct  444  QLNGLAERMNRTLVERVRCLLSQSQL--PRSFWGEALNTVVHVLNLTPCVPLEFDVPDRI  501

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WS N + Y  LRVFGC A+ H       KL+ +   C+F+GY  +  GYR +    +K++
Sbjct  502  WSNNEISYDHLRVFGCKAFVHIPKDERSKLDAKTRPCVFIGYGQDELGYRFYDSVQKKLV  561

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAPLV  358
               D   D+   +   + P+  E ++  ++ +     + +    D +  + + T  AP  
Sbjct  562  --EDEAHDDQHDMGDVETPTQVEDEAHDDQHDMGDVETPTQVEVDDDVHEQSPTVEAPSN  619

Query  357  EPQREYSIAMDRPRRTIKKPARYASDD  277
             P R       +  R      RY+ DD
Sbjct  620  IPLR-------KSTRDRHPSTRYSVDD  639



>emb|CAN71037.1| hypothetical protein VITISV_011061 [Vitis vinifera]
Length=1220

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q N V+ER N+T++E ARCML    L K    WAEAV+T+ YL+NR P  S+  K P E 
Sbjct  583  QQNEVSERKNKTVMEMARCMLFEKRLPKL--LWAEAVNTSVYLLNRLPTKSVQSKTPIEA  640

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       L+VFG   Y H  +   GKL+ RA K +F+GYA+ESKGYR++S    KI+
Sbjct  641  WFGVKPSVKHLKVFGSLCYLHVPSVKRGKLDERAEKGVFVGYAAESKGYRIYSLSRMKIV  700

Query  537  LSRDITFDENA  505
            +SRD+ FDEN+
Sbjct  701  ISRDVHFDENS  711



>emb|CAN76611.1| hypothetical protein VITISV_040103 [Vitis vinifera]
Length=473

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 101/185 (55%), Gaps = 26/185 (14%)
 Frame = -1

Query  777  STACYLVNRSPHSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKC  607
            +  C ++N     S   ++  +VW+ +PVDYS LRVF CPAY H       KL+ ++ +C
Sbjct  21   TITCVIINLEFSQS---EVEIDVWTSSPVDYSGLRVFECPAYVHIPNEERSKLDAKSRQC  77

Query  606  IFLGYASESKGYRLWSPDSRKIILSRDITFDENALLSSGKVPSTGETQ-----STGEK-V  445
            IFLGY    KG++LW P + K+++SRD+ FDE  +L   +    GE Q     S+ EK +
Sbjct  78   IFLGYQKGVKGFKLWDPKANKVVISRDVVFDEKPML---QCTQKGEKQEPESCSSNEKLI  134

Query  444  EFEFRPSDSVTTADGNTKDDASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNM  265
            + E    D         +D A  +     E Q+ ++IAMDRPRRTIK   R   +D   +
Sbjct  135  QVELETHD--------IEDHAWNAGKSSSEDQQHHNIAMDRPRRTIKPLIRLCFED---L  183

Query  264  VAYAL  250
            V+YAL
Sbjct  184  VSYAL  188



>gb|AAL58228.1|AC084762_2 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF96256.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1167

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+ + A  ML + G+ K   FWAEAV+TA Y++NRSP  ++  + P E 
Sbjct  490  QQNGVAERKNRTINDMANSMLQDKGMPK--SFWAEAVNTAIYILNRSPTKAVPNRTPFEA  547

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       +RVFGC  YA        K + ++ +CIF+GYA   KGYRL++ + +KII
Sbjct  548  WYGKKPVIGHMRVFGCICYAQVPAQKRVKFDNKSDRCIFVGYADGIKGYRLYNLEKKKII  607

Query  537  LSRDITFDENA  505
            +SRD+ FDE+A
Sbjct  608  ISRDVIFDESA  618



>gb|AAL56548.1|AF387862_2 pol polyprotein [Anopheles gambiae]
Length=942

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 78/129 (60%), Gaps = 6/129 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRTL+E ARCML +A L  R  FWAEA++ A YL N S   S++ K P E+
Sbjct  173  QQNGVAERKNRTLVEMARCMLIDAKLGYR--FWAEAINAAVYLQNISSSRSIE-KTPFEL  229

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G   DYS L +FGC A  H       KL+P+  K IF+GYA   K +R   P S KI 
Sbjct  230  WYGKQPDYSNLHIFGCSAIVHVPAEKRSKLDPKGKKLIFVGYADNHKAFRFVDPTSNKIT  289

Query  537  LSRDITFDE  511
            LSRD  F E
Sbjct  290  LSRDAKFIE  298



>emb|CAN60238.1| hypothetical protein VITISV_032906 [Vitis vinifera]
Length=1430

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGVAER NRT++E AR M+    L     FWAE V+TA YL+N SP  ++  + P E 
Sbjct  708  EQNGVAERKNRTVVEMARSMMXAKNL--SNHFWAEGVATAVYLLNISPTKAVLNRTPYEA  765

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G     S L+VFG  AY    +    KL+ ++VKCIF+GY S+SKGY+L++P S KII
Sbjct  766  WYGRKPWVSHLKVFGSVAYTLXBSHNRSKLDEKSVKCIFIGYCSQSKGYKLYNPVSGKII  825

Query  537  LSRDITFDENA  505
            +SR++ FDE A
Sbjct  826  VSRNVVFDEKA  836



>emb|CAN71759.1| hypothetical protein VITISV_020777 [Vitis vinifera]
Length=1472

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 7/130 (5%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER NRT++E AR M+    L     FWAE V+TA YL+N SP  ++  + P E W 
Sbjct  584  NGVAERKNRTVVEMARSMMKAKNL--SNHFWAEGVATAVYLLNISPTKAVLNRTPYEAWY  641

Query  702  GNPVDYSILRVFGCPAY----AHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            G     S L+VFG  AY    +H+ + KL+ ++VKCIF+GY S+SKGY+L++P S KII+
Sbjct  642  GRKPWVSHLKVFGSVAYTLIDSHNRS-KLDEKSVKCIFIGYCSQSKGYKLYNPVSGKIIV  700

Query  534  SRDITFDENA  505
            SR++ FDE A
Sbjct  701  SRNVVFDEKA  710



>emb|CAN70570.1| hypothetical protein VITISV_043111 [Vitis vinifera]
Length=891

 Score =   119 bits (298),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 78/209 (37%), Positives = 110/209 (53%), Gaps = 22/209 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVA+R+NRT+  R RCMLS+A L K   +W+EA+     L+N SP   L   IP  V
Sbjct  208  QQNGVAKRMNRTICYRIRCMLSHAKLSK--SYWSEAMRITIDLINLSPSYPLKGDIPRRV  265

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
                 V +  LRVFGC  + H       KL+ +  +CIFLGY++E+ GY LW P ++KII
Sbjct  266  QIRKFVSFEHLRVFGCRTFVHVPRDEQSKLDSKTKQCIFLGYSNENFGYMLWDPTTKKII  325

Query  537  LSRDITFDENAL--LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAP  364
             +RD+ F++  +  L   K P +   Q   E+V       D+V   D  + DD   ++  
Sbjct  326  RNRDVLFEDQTIEYLDQVKKPKSFIVQE--ERV-------DTVDRNDEFSVDDEQATSKL  376

Query  363  LVEPQREYSIAMDRPRRTIKKPARYASDD  277
             +E +   S    R R+  K   RY SDD
Sbjct  377  PIETELRIST---RERQHSK---RYTSDD  399



>gb|ABA99612.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1198

 Score =   119 bits (298),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+ + A  ML + G+ K   FWAEAV+TA Y++NRSP  ++  + P E 
Sbjct  567  QQNGVAERKNRTINDMANSMLQDKGMPK--SFWAEAVNTAIYILNRSPTKAVPNRTPFEA  624

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       +RVFGC  YA        K + ++ +CIF+GYA   KGYRL++ + +KII
Sbjct  625  WYGKKPVIGHMRVFGCICYAQVPAQKRVKFDNKSDRCIFVGYADGIKGYRLYNLEKKKII  684

Query  537  LSRDITFDENA  505
            +SRD+ FDE+A
Sbjct  685  ISRDVIFDESA  695



>emb|CDO76881.1| hypothetical protein BN946_scf184903.g2 [Trametes cinnabarina]
Length=382

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG AER NRT++E+A  ML +AGL     FW  AV  A ++ NR P   L ++ P   
Sbjct  163  QQNGRAERWNRTIVEKAMSMLHHAGL--SHGFWQLAVEAAVHIYNRQPMRRLKWRCPITA  220

Query  708  WSGNPVDYSILRVFGCPAYAHSST----GKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G   D S  RVFGC A+ H       GKL+ +AV+ IF+GY   +KGY+ W+  +  I
Sbjct  221  WDGTVPDVSYFRVFGCKAFVHVQKAKREGKLDKKAVEMIFVGYEPGTKGYKFWNLATHSI  280

Query  540  ILSRDITFDENAL  502
            ++SRD+ FDE + 
Sbjct  281  VVSRDVIFDEESF  293



>gb|KFK32108.1| hypothetical protein AALP_AA6G199700 [Arabis alpina]
Length=1415

 Score =   119 bits (298),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 105/190 (55%), Gaps = 11/190 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q   +AER+N+T++ER RC++S +GL   + FW EA+S+  +L+N SP + L+  IPE V
Sbjct  339  QLKRLAERMNKTIVERIRCLISESGL--AQTFWGEALSSVVHLLNFSPSAPLEGDIPERV  396

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G  V YS LRV GC A+ H       KL  ++ +C+F+GY     GYR + P ++K+I
Sbjct  397  WTGKDVSYSHLRVCGCKAFVHIPKDERSKLEMKSRQCVFIGYGLVEFGYRFYDPVTKKLI  456

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGE-KVEFEFRPSDSVTTADGNTKDDASTSTAPL  361
             SRD+ F E+  +    +  +G+     E  ++ E  PS SV    G  + +    T   
Sbjct  457  RSRDVVFMEDQTIKD--IDKSGKPAQRYECLIDSEVVPSTSV---HGQVESEVHVDTPSA  511

Query  360  VEPQREYSIA  331
              P  + SI 
Sbjct  512  DAPAHDESIG  521



>gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum]
Length=1333

 Score =   119 bits (297),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 133/247 (54%), Gaps = 27/247 (11%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGVAER NRT++E AR  L   GL     FW EAV+T  Y +N SP   +    P E 
Sbjct  602  EQNGVAERKNRTVVEMARSSLKAKGLPDY--FWGEAVATVVYFLNISPTKDVWNTTPLEA  659

Query  708  WSGNPVDYSILRVFGCPAYA----HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W+G     S LR+FGC AYA    HS   KL+ ++ KCIF+GY+ +SK YRL++P S K+
Sbjct  660  WNGKKPRVSHLRIFGCIAYALVNFHS---KLDEKSTKCIFVGYSLQSKAYRLYNPISGKV  716

Query  540  ILSRDITFDENAL--LSSGKVPSTGETQSTGEK--VEFEFRPSDSVTTADGNTKDDASTS  373
            I+SR++ F+E+     +SG + S  +   T E+  V+F   P+ S  ++  ++    ST+
Sbjct  717  IISRNVVFNEDVSWNFNSGNMMSNIQLLPTDEESAVDFGNSPNSSPVSSSVSSPIAPSTT  776

Query  372  TAP---LVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSEA  202
             AP    VEP     I + R  R  KKP    S+       +AL V+     D  CY EA
Sbjct  777  VAPDESSVEP-----IPLRRSTRE-KKPNPKYSNTVNTSCQFALLVS-----DPICYEEA  825

Query  201  FPIAKFK  181
               +++K
Sbjct  826  VEQSEWK  832



>emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera]
Length=1355

 Score =   119 bits (297),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR LLE+ R ++    + K   FW+  V TA YL+NR P   LDF  P EV
Sbjct  648  QQNGVAERKNRDLLEKTRAIMMQMNVPKH--FWSYGVLTATYLINRLPSRVLDFLCPLEV  705

Query  708  WSGNPVDYSILRVFGCPAYAHSST----GKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
                  D S L+VFGC  + H S      KL+PRAVKC+FLGY+   KGYR +   ++++
Sbjct  706  LQQKKPDLSHLKVFGCTCFVHLSATQRRDKLDPRAVKCVFLGYSQTQKGYRCYDTTAKRL  765

Query  540  ILSRDITFDENA  505
             +SRD+ F E +
Sbjct  766  FVSRDVQFVETS  777



>emb|CAN74280.1| hypothetical protein VITISV_010268 [Vitis vinifera]
Length=761

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 80/133 (60%), Gaps = 5/133 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRT+ +R RCMLS+  L K   F  EA++    L+N SP  +L   IPE V
Sbjct  372  QQNGVAERMNRTICDRIRCMLSHTKLPK--SFLGEAMTIVVDLINLSPSYTLKGDIPERV  429

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G  V +  LRVF C A+ H       KL+ +   CIFLGY++E  GYRLW   ++KII
Sbjct  430  WIGKFVSFEHLRVFXCWAFVHVPRDKXSKLDSKTKSCIFLGYSNEEFGYRLWDLATKKII  489

Query  537  LSRDITFDENALL  499
             SRD+   E+  +
Sbjct  490  RSRDVVIFEDQTI  502



>gb|KIJ26272.1| hypothetical protein M422DRAFT_89282, partial [Sphaerobolus stellatus 
SS14]
Length=119

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 69/121 (57%), Gaps = 5/121 (4%)
 Frame = -1

Query  864  LNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDY  685
            +NR ++ER RCML    L     FW  A     YL+NRSP S L    PEE WSG     
Sbjct  1    MNRIIVERGRCMLFEGNL--SSGFWIYAFDCTVYLMNRSPVSRLPDSTPEEAWSGIKPII  58

Query  684  SILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFD  514
            +  R FGCPAYAH   +   KL  +  KCI LGY   +K YRLW P +R +I+SRD+ FD
Sbjct  59   TSFRPFGCPAYAHIPKAQRTKLAWKTRKCIMLGYEVGTKAYRLWDPKTRSVIISRDVIFD  118

Query  513  E  511
            E
Sbjct  119  E  119



>ref|XP_008480740.1| PREDICTED: uncharacterized protein LOC103517484 [Diaphorina citri]
Length=1233

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 82/132 (62%), Gaps = 7/132 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGV+ER NRTL+E+AR M++ +     ++ W EA   ACY++NRSP S+L+ K+P E+
Sbjct  868  EQNGVSERFNRTLVEKARAMITESN--HEKELWGEACLAACYVINRSPTSALERKVPAEL  925

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G+  + S LRVFGC AY H       K  P++ K +F+GY     GYRL+ P  R I+
Sbjct  926  WFGHKPNISKLRVFGCVAYLHRPKQFCTKFGPKSEKYLFVGYC--PNGYRLYDPVGRDIV  983

Query  537  LSRDITFDENAL  502
              RD+ F E+  
Sbjct  984  TGRDVVFFEDKF  995



>emb|CAN83966.1| hypothetical protein VITISV_016198 [Vitis vinifera]
Length=751

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = -1

Query  864  LNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDY  685
            +NRTL ER R    +AGL K   FWA+ VST  YL+NR P   ++FK+PEEVWSG  + +
Sbjct  1    MNRTLNERVRSTRLHAGLPKT--FWADVVSTTAYLINRGPLVPMEFKLPEEVWSGKGLKF  58

Query  684  SILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFD  514
            S L+VFGC ++ H    +  KL  ++  C F+GY  E  GYR W   +RKII +R++ F+
Sbjct  59   SHLKVFGCVSHVHIDSDARSKLIAKSKICFFIGYGDEKFGYRFWDEQNRKIIRNRNVIFN  118

Query  513  ENAL  502
            E  +
Sbjct  119  ERVM  122



>gb|EFA07744.1| hypothetical protein TcasGA2_TC002224 [Tribolium castaneum]
Length=2378

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 5/127 (4%)
 Frame = -1

Query  888   QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
             + NGV+ER NRTLL+ ARC+L  + L     FWAEAV+TA YL NR P  SL+ + P E 
Sbjct  1741  EQNGVSERKNRTLLDTARCLLMESKLPS--SFWAEAVNTANYLRNRLPTKSLNGRTPYEA  1798

Query  708   WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
             W+G   D S  +VFG   +        GK +PRA + IFLGYA  SK +R+WSP+ RK+ 
Sbjct  1799  WTGRAPDLSHCKVFGARVFYLNRERDRGKFDPRAQEGIFLGYAENSKAFRIWSPEKRKVF  1858

Query  537   LSRDITF  517
             ++RD+  
Sbjct  1859  ITRDVKL  1865


 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 92/161 (57%), Gaps = 11/161 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGV+ER NRT L+ ARC+L  + L     FWAEAV+TA YL NR P  SL+ + P E 
Sbjct  536  EQNGVSERKNRTFLDTARCLLMESKLPS--SFWAEAVNTANYLRNRLPTKSLNGRTPYEA  593

Query  708  WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G   D S  +VFG   +        GK +PRA + IFLGYA  SK +R+WSP+ RK+ 
Sbjct  594  WTGRAPDLSHCKVFGARVFYLNRERDRGKFDPRAQEGIFLGYAENSKAFRIWSPEKRKVF  653

Query  537  LSRDITFDENALLSSGKV------PSTGETQSTGEKVEFEF  433
            ++RD+   ++   +          P   E+ S+ E V+ EF
Sbjct  654  ITRDVKLLKDDEDNEDNFDVFSSPPDPEESSSSREFVDIEF  694



>emb|CDO76035.1| hypothetical protein BN946_scf184818.g3 [Trametes cinnabarina]
Length=942

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NG AER NRT++E+A  ML +AGL     FW  AV  A ++ N  P   L ++ P   
Sbjct  621  QQNGRAERWNRTIIEKAMSMLHHAGL--SHGFWQLAVEAAVHIYNCQPMRRLKWRCPITA  678

Query  708  WSGNPVDYSILRVFGCPAYAHSST----GKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G   D S  RVFGC A+ H       GKL+ +AV+ IF+GY   +KGY+ W+P +R I
Sbjct  679  WDGTVPDVSYFRVFGCKAFVHMQKAKREGKLDKKAVEMIFVGYEPGTKGYKFWNPATRSI  738

Query  540  ILSRDITFDENAL  502
            ++S D+ FDE + 
Sbjct  739  VISHDVIFDEESF  751



>gb|ADK92880.1| retrotransposon 4 protein [Hypericum perforatum]
Length=1347

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 80/130 (62%), Gaps = 5/130 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NR LL  AR M+    + KR  FW++AV TAC+L+NR P ++     P E+
Sbjct  569  QQNGVAERKNRHLLNVARAMMFKMNVKKR--FWSDAVLTACHLINRIPSATTSGLAPIEI  626

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
                  D S LRVFGC  + H   G   KL+ RAVKCIFLGY+   KGYR + P+S +  
Sbjct  627  LLNKKPDLSYLRVFGCCCFVHVPAGKRDKLDKRAVKCIFLGYSRNQKGYRCFDPESGQRF  686

Query  537  LSRDITFDEN  508
            +SRD+ F E+
Sbjct  687  ISRDVRFIED  696



>gb|ABW74566.1| integrase [Boechera divaricarpa]
Length=1165

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 98/179 (55%), Gaps = 14/179 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGVAER N T++E AR ML    L     FWAE+V TA YL+N SP  ++  + P E 
Sbjct  438  EQNGVAERKNTTVVEMARSMLKERNL--PNQFWAESVRTAVYLLNISPTKAVLNRTPYEA  495

Query  708  WSGNPVDYSILRVFGCPAY----AHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G     S LRVFG   Y    AH+   KL+ ++ KCIFLGY S+SKGYRL++P S KI
Sbjct  496  WCGRKPGVSHLRVFGSVCYSLIDAHNRK-KLDEKSEKCIFLGYCSQSKGYRLYNPVSGKI  554

Query  540  ILSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTAP  364
            + SR++TFDE A+        T      GE VE           +  N+  +   S+AP
Sbjct  555  VESRNVTFDEEAVW-------TWREGDNGELVEIFVNDEQEENPSPANSATNTPASSAP  606



>gb|ACN78973.1| copia-type polyprotein [Glycine max]
 gb|ACN78980.1| copia-type polyprotein [Glycine max]
Length=1042

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+L   RCML    + K  +FWAEAV+ A YL NRSP  ++  + P+E 
Sbjct  317  QQNGVAERKNRTILNMTRCMLKAKNMPK--EFWAEAVACAVYLSNRSPTKNVKDQTPQEA  374

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG       LRVFG  AYAH       KL+ R+ K +F+GY + SKGY+L++P++ K I
Sbjct  375  WSGVKPRVDHLRVFGSIAYAHVPDQGRFKLDDRSEKHVFIGYDASSKGYKLYNPNNGKTI  434

Query  537  LSRDITFDE  511
            +SRD+ F E
Sbjct  435  VSRDVEFYE  443



>gb|AAP46257.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|ABF99717.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1335

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+ + A  ML + G+ K   FWAEAV+TA Y++NRSP  ++  + P E 
Sbjct  616  QQNGVAERKNRTINDMANSMLQDKGMPK--SFWAEAVNTAVYILNRSPTKAVTNRTPFEA  673

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       +RVFGC  YA        K + ++ +CIF+GYA   KGYRL++ + +KII
Sbjct  674  WYGKKPVIGHMRVFGCICYAQVPAQKRVKFDNKSDRCIFVGYADGIKGYRLYNLEKKKII  733

Query  537  LSRDITFDENA  505
            +SRD  FDE+A
Sbjct  734  ISRDAIFDESA  744



>ref|XP_008369160.1| PREDICTED: uncharacterized protein LOC103432739 [Malus domestica]
Length=1034

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV+ER NR ++  A+ ML    L     FWAEAV+T  YL+NR P  +L    P E 
Sbjct  476  QQNGVSERKNRXVVXMAKSMLHEKNL--PYAFWAEAVNTXVYLINRCPTKALKKSTPFEA  533

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            +SG     + L++FG   Y H  +    KL   + KCIF+GY S  KGYRL+ P SRKI+
Sbjct  534  YSGRKPGIAHLKIFGSLCYVHIPSNJXHKLEENSHKCIFVGYGSSEKGYRLFDPISRKIV  593

Query  537  LSRDITFDEN  508
            LSRD+TFDEN
Sbjct  594  LSRDVTFDEN  603



>gb|AAD36943.1|AF069441_3 putative polyprotein [Arabidopsis thaliana]
 emb|CAB77906.1| putative polyprotein [Arabidopsis thaliana]
Length=778

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER+NRT++ER R ML ++ L KR  FWAEA  TA  L+N++P S+ +F+ P++ 
Sbjct  487  QQNGVVERMNRTIMERVRSMLCDSRLPKR--FWAEATHTAVLLINKTPCSANNFEFPDKR  544

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSR  529
            WSG    YS LR +GC  +  +  GKLN RA K + +GY S  KGY++W  + R   L R
Sbjct  545  WSGKAPIYSYLRRYGCVTFVQTDDGKLNLRAKKGVLIGYPSGVKGYKVWLIEERNSHLVR  604

Query  528  D  526
            D
Sbjct  605  D  605



>gb|KFD72989.1| hypothetical protein M514_12352 [Trichuris suis]
Length=839

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 100/176 (57%), Gaps = 12/176 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NG+AERLNRTL+E+AR ML +AGL    D WAEA+ TA YL NR P  +L    PEE 
Sbjct  237  EQNGIAERLNRTLVEKARTMLIDAGL--STDLWAEAIGTANYLRNRCPTKALRNVTPEEA  294

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG   + S L+VFGC A  H       K + ++ +CIF+GY+  SKGYR  +  ++K+ 
Sbjct  295  WSGRKPNLSHLKVFGCLAMVHVPARRRQKWDAKSEECIFVGYSETSKGYRTINRFTKKLN  354

Query  537  LSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTST  370
            ++RD+ F E++       P T +T +  ++ E    P D         +DD  + T
Sbjct  355  IARDVVFLESSF------PGTRQTNAHLDEPEKSV-PDDGEEVMMWKLQDDKPSET  403



>dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsis thaliana]
Length=1499

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 6/130 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKI-PEE  712
            Q NGVAER NRTL+E AR M+    L  +  FWAEA++T+ YL NR P  SL+  + P E
Sbjct  615  QQNGVAERRNRTLVEMARSMIEEKKLSNK--FWAEAIATSTYLQNRLPSKSLEKGVTPME  672

Query  711  VWSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            +WSG       L+VFGC  Y H       KL+ +A + IF+GY++ESKGYR++  +  KI
Sbjct  673  IWSGKKPSVDHLKVFGCVCYIHIPDEKRRKLDTKAKQGIFVGYSNESKGYRVFLLNEEKI  732

Query  540  ILSRDITFDE  511
             +S+D+TFDE
Sbjct  733  EVSKDVTFDE  742



>emb|CAN81839.1| hypothetical protein VITISV_033739 [Vitis vinifera]
Length=1088

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 82/130 (63%), Gaps = 5/130 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT++   R MLS   + K   FW EAV+   +++NRSP  ++  K PEE 
Sbjct  346  QQNGVAERKNRTIMNMVRSMLSEKQIPKT--FWPEAVNWTVHVLNRSPTLAVKNKTPEEA  403

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG        R+FGC ++ H       KL+ ++++CI LG + ESK YRL+ P S+KII
Sbjct  404  WSGRKPSVDHFRIFGCISHVHVPDHKRVKLDAKSLRCILLGVSEESKAYRLFDPISQKII  463

Query  537  LSRDITFDEN  508
            +SRD+ F+E+
Sbjct  464  ISRDVVFEED  473



>gb|KFD61291.1| hypothetical protein M514_26539 [Trichuris suis]
Length=1122

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NG+AERLNRTL+E+AR ML +AGL    D WAEA+ TA YL NR P  +L    PEE 
Sbjct  581  EQNGIAERLNRTLVEKARTMLIDAGL--STDLWAEAIGTANYLRNRCPTKALRNVTPEEA  638

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG   + S L+VFGC A  H       K + ++ +CIF+GY+  SKGYR  +  ++K+ 
Sbjct  639  WSGRKPNLSHLKVFGCLAMVHIPERRRQKWDAKSEQCIFVGYSETSKGYRTINRFTKKLN  698

Query  537  LSRDITFDENAL  502
            ++RD+ F E++ 
Sbjct  699  IARDVVFLESSF  710



>gb|KFD64618.1| hypothetical protein M514_23220 [Trichuris suis]
Length=1105

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NG+AERLNRTL+E+AR ML +AGL    D WAEA+ TA YL NR P  +L    PEE 
Sbjct  564  EQNGIAERLNRTLVEKARTMLIDAGL--STDLWAEAIGTANYLRNRCPTKALRNVTPEEA  621

Query  708  WSGNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG   + S L+VFGC A  H       K + ++ +CIF+GY+  SKGYR  +  ++K+ 
Sbjct  622  WSGRKPNLSHLKVFGCLAMVHVPARRRQKWDAKSEECIFVGYSETSKGYRTINRFTKKLN  681

Query  537  LSRDITFDENAL  502
            ++RD+ F E++ 
Sbjct  682  IARDVVFLESSF  693



>gb|AAL75752.1|AC037197_10 Putative copia-type polyprotein [Oryza sativa Japonica Group]
 gb|AAP51797.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1350

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+ + A  ML + G+ K   FWAEAV+TA Y++NRSP  ++  + P E 
Sbjct  539  QQNGVAERKNRTINDMANSMLQDKGMPK--SFWAEAVNTAIYILNRSPTKAVPNRTPFEA  596

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       +RVFGC  YA        K + ++  CIF+GYA   KGYRL++ + +KII
Sbjct  597  WYGKKPVIGHMRVFGCICYAQVPAQKRVKFDNKSDWCIFVGYADGIKGYRLYNLEKKKII  656

Query  537  LSRDITFDENA  505
            +SRD+ FDE+A
Sbjct  657  ISRDVIFDESA  667



>gb|ABA95820.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1142

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+ + A  ML + G+ K   FWAEAV+TA Y++NRSP  ++  + P E 
Sbjct  406  QQNGVAERKNRTINDMANSMLQDKGMPK--SFWAEAVNTAIYILNRSPTKAVPNRTPFEA  463

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       +RVFGC  YA        K + ++ +CIF+GYA   KGYRL++ + +KII
Sbjct  464  WYGKKPVIGHMRVFGCICYAQVPAQKRVKFDNKSDRCIFVGYADGIKGYRLYNLEKKKII  523

Query  537  LSRDITFDENA  505
            + RD+ FDE+A
Sbjct  524  IIRDVIFDESA  534



>emb|CAE04331.1| OSJNBb0016D16.22 [Oryza sativa Japonica Group]
 emb|CAE04855.2| OSJNBa0086O06.3 [Oryza sativa Japonica Group]
Length=1498

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER N+T++  AR +L   G+     FW EAV TA Y++NRSP  +LD + P E 
Sbjct  698  QQNGVAERRNQTVVGMARALLKQRGMPA--IFWGEAVVTAAYILNRSPTKALDGRTPYEA  755

Query  708  WSGNPVDYSILRVFGCPAYAH--SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            W G     S LRVFGC A+A      GKL+ R+   +F+GYA  SK YR+  P+++++ +
Sbjct  756  WHGRKPAVSHLRVFGCLAFAKELGHIGKLDDRSTPGVFIGYAEGSKAYRILDPETQRVRI  815

Query  534  SRDITFDEN  508
            +RD+ FDE 
Sbjct  816  ARDVVFDEG  824



>emb|CAN80304.1| hypothetical protein VITISV_017821 [Vitis vinifera]
Length=939

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 97/209 (46%), Gaps = 41/209 (20%)
 Frame = -1

Query  744  HSSLDFKIPEEVWSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASESKGYRL  565
            H    FK P E+W  +P DYS LR FGC AYAH + GKL PRA KCIF+GY+   KG +L
Sbjct  306  HGGNRFKTPMEMWLSSPCDYSKLRTFGCIAYAHQNEGKLEPRARKCIFVGYSDGVKGCKL  365

Query  564  WSPDSRKIILSRDITFDENALLSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDD  385
            W P ++K  +SRD+ F E   L + +                       +   +G  KD 
Sbjct  366  WCPTTKKCFISRDVDFRECEFLKNDR--------------------EVFINKENGEVKDK  405

Query  384  ASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYSE  205
              T       P   Y +  D  RR+I+ P R+  +D   MVAY+LS+  E+    SC   
Sbjct  406  FETKPQQYDIPLENYQLTRDGARRSIRPPQRFGYND---MVAYSLSIGEEL----SC---  455

Query  204  AFPIAKFKPYLSLVGCSSC*FHNGFDPRW  118
                A+ K YL  + C          P+W
Sbjct  456  ----AEPKNYLEAISCKDS-------PKW  473



>ref|XP_008669041.1| PREDICTED: uncharacterized protein LOC103646095 [Zea mays]
Length=704

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 81/128 (63%), Gaps = 5/128 (4%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAE  +R ++E AR +L ++  +    FW EAVSTA YL+NR P S L  K P EV  
Sbjct  523  NGVAECKHRHIIETARTLLISS--FVPSHFWGEAVSTAVYLINRQPSSKLSGKTPGEVLF  580

Query  702  GNPVDYSILRVFGCPAYAHSST---GKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G P  Y  LRVFGC  Y   S     KL  ++V+C+FLGY+ E KGYR +   SR++ +S
Sbjct  581  GTPPRYDHLRVFGCTCYVLLSPRERTKLTAQSVECVFLGYSPEHKGYRCYDASSRRMRIS  640

Query  531  RDITFDEN  508
            RD++F+EN
Sbjct  641  RDVSFNEN  648



>emb|CAN82574.1| hypothetical protein VITISV_034720 [Vitis vinifera]
Length=1172

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL ERAR M  +AGL K   FWA+AVSTA YL+NR P   ++F++PEEV
Sbjct  573  QQNGVAERMNRTLNERARSMRLHAGLPK--TFWADAVSTAXYLINRXPSVXMEFRLPEEV  630

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASE  583
            WSG  V +S L+VFGC +Y H    +  KL+ ++  C F+GY  E
Sbjct  631  WSGKEVKFSHLKVFGCVSYVHIDSDARSKLDAKSKICFFIGYXGE  675



>emb|CAH66391.1| OSIGBa0134J07.9 [Oryza sativa Indica Group]
Length=1314

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+ + A  ML + G+ K   FWAEAV+TA Y++NRSP  ++  + P E 
Sbjct  623  QQNGVAERKNRTINDMANSMLQDKGMPK--SFWAEAVNTAVYILNRSPTKAVPNRTPFEA  680

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G       +RVF C  YA        K + ++ +CIF+GYA   KGYRL++ + +KII
Sbjct  681  WYGKKPVIGHMRVFACICYAQVPAQKRVKFDNKSNRCIFVGYADGIKGYRLYNLEKKKII  740

Query  537  LSRDITFDENA  505
            +SRD+ FDE+A
Sbjct  741  ISRDVFFDESA  751



>emb|CAD41085.2| OSJNBb0011N17.2 [Oryza sativa Japonica Group]
Length=1262

 Score =   116 bits (291),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 82/141 (58%), Gaps = 12/141 (9%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER NR LLE AR ++    + K    W+EAV TA YL+NR+P   L  K P E+  
Sbjct  448  NGVAERKNRHLLEIARSLMYTMNVPKF--LWSEAVMTAAYLINRTPSRILGMKTPYEMIF  505

Query  702  GNPVDYSILRVFGCPAYAHS---STGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G        RVFGC  +      S GKL+PRAVKCIF+GY+S  KGY+ WSP  R+  +S
Sbjct  506  GKNEFVVPPRVFGCTCFVRDHRPSIGKLDPRAVKCIFIGYSSSQKGYKCWSPSERRTFVS  565

Query  531  RDITFDENALLSSGKVPSTGE  469
             D+TF E+       VP  GE
Sbjct  566  MDVTFRES-------VPFYGE  579



>gb|ABA93686.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=680

 Score =   115 bits (288),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 122/237 (51%), Gaps = 28/237 (12%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAE +NRT++  ARCMLSNA +   + FWAEA +TACYL+NR P   L+ K P E 
Sbjct  260  QQNGVAECMNRTIISMARCMLSNAHM--NKCFWAEAANTACYLINRLPSIPLNKKTPIE-  316

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGKLNPRAVKCIFLGYASES--KGYRLWSPDSRKIIL  535
            W    V +S+          H+S+G   PR       G A+ S  KGY+LW+P++++  L
Sbjct  317  WGLRGVSHSL----------HASSGGSRPRHPHA---GSATGSRVKGYKLWNPENKRTFL  363

Query  534  SRDITFDENAL----LSSGKVPSTGETQSTGEKVEFEFRPSDSVTTADGNTKDDASTSTA  367
            SR + F+E  +    LS+  +P     +     V+ E          D +  D    S  
Sbjct  364  SRSVVFNEYVMFNDSLSTDVIPGGSNEEQQYVNVQVEHMDDQETEIVDNDVHDTVQHS-P  422

Query  366  PLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDG--DSSCYSEA  202
            P+++PQ +  IA  R +R+     R    +E +MV YA + A +V    + + Y+EA
Sbjct  423  PVLQPQDQ-PIAHRRTKRSCGALVRLI--EECDMVYYAFNCAKQVKNTHEPAAYTEA  476



>gb|AAP46207.1| putative retrotransposon protein [Oryza sativa Japonica Group]
Length=1176

 Score =   116 bits (291),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 82/141 (58%), Gaps = 12/141 (9%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER NR LLE AR ++    + K    W+EAV TA YL+NR+P   L  K P E+  
Sbjct  485  NGVAERKNRHLLEIARSLMYTMNVPKF--LWSEAVMTAAYLINRTPSRILGMKTPYEMIF  542

Query  702  GNPVDYSILRVFGCPAYAHS---STGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G        RVFGC  +      S GKL+PRAVKCIF+GY+S  KGY+ WSP  R+  +S
Sbjct  543  GKNEFVVPPRVFGCTCFVRDHRPSIGKLDPRAVKCIFIGYSSSQKGYKCWSPSERRTFVS  602

Query  531  RDITFDENALLSSGKVPSTGE  469
             D+TF E+       VP  GE
Sbjct  603  MDVTFRES-------VPFYGE  616



>gb|AGW47867.1| polyprotein [Phaseolus vulgaris]
Length=1471

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER NRT+L+  R ML +  + K  +FWAEAV  A Y+ NR PH  LD + P+E 
Sbjct  647  QQNGVAERKNRTILDMVRSMLKSKKMPK--EFWAEAVQCAIYVQNRCPHVKLDDQTPQEA  704

Query  708  WSGNPVDYSILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG     S L+VFG  AYAH       KL  ++ + +F+GY  ++KGY+L  P S+K+ 
Sbjct  705  WSGQKPTVSHLKVFGSVAYAHVPDQRRTKLEDKSKRYVFIGYDEKTKGYKLLDPISKKVT  764

Query  537  LSRDITFDE  511
            +SRD+  +E
Sbjct  765  VSRDVQINE  773



>gb|AAL68641.1|AF458765_1 polyprotein [Oryza sativa Japonica Group]
Length=1472

 Score =   116 bits (290),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 82/141 (58%), Gaps = 12/141 (9%)
 Frame = -1

Query  882  NGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWS  703
            NGVAER NR LLE AR ++    + K    W+EAV TA YL+NR+P   L  K P E+  
Sbjct  658  NGVAERKNRHLLEIARSLMYTMNVPKF--LWSEAVMTAAYLINRTPSRILGMKTPYEMIF  715

Query  702  GNPVDYSILRVFGCPAYAHS---STGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILS  532
            G        RVFGC  +      S GKL+PRAVKCIF+GY+S  KGY+ WSP  R+  +S
Sbjct  716  GKNEFVVPPRVFGCTCFVRDHRPSIGKLDPRAVKCIFIGYSSSQKGYKCWSPSERRTFVS  775

Query  531  RDITFDENALLSSGKVPSTGE  469
             D+TF E+       VP  GE
Sbjct  776  MDVTFRES-------VPFYGE  789



>gb|EFA12979.1| hypothetical protein TcasGA2_TC004282 [Tribolium castaneum]
Length=1175

 Score =   116 bits (290),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 82/242 (34%), Positives = 122/242 (50%), Gaps = 20/242 (8%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NG AERLNRTLLE+AR M+  + L K  D W EAV  A Y+ NR P S L+   P E+
Sbjct  490  EQNGKAERLNRTLLEKARAMILESELSK--DLWGEAVLCAAYVTNRCPTSCLENVTPSEM  547

Query  708  WSGNPVDYSILRVFGCPAYAH----SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            + G   + + LRVFG  AY+H       GK + +   CI +GY     GYRLW P++ K+
Sbjct  548  FYGRKPNLNNLRVFGSVAYSHIPKQKMKGKFDRKCDVCIMIGYT--HNGYRLWIPETGKV  605

Query  540  ILSRDITFDENALLSSGKVPSTGETQSTGEKV--------EFEFRPSDSVTTA-DGNTKD  388
            + +R++ FDEN  ++S    +      T +++        E E    ++ T A D   K 
Sbjct  606  VCARNVIFDENKTITSVNSKNERHVSETDKRIMTYTELQNESEGNVEENKTIAEDEENKI  665

Query  387  DASTSTAPLVEPQREYSIAMDRPRRTIKKPARYASDDETNMVAYALSVA*EVDGDSSCYS  208
            +    +    EP    +  + +  R  ++PA + SD E  +  +ALSV   +D     Y 
Sbjct  666  NEDEESDEDKEPGETQTEGLRKSNRKKRRPAHF-SDYE--LEHFALSVESFIDEVPESYE  722

Query  207  EA  202
            EA
Sbjct  723  EA  724



>gb|EFA05312.1| hypothetical protein TcasGA2_TC015470 [Tribolium castaneum]
Length=2375

 Score =   116 bits (290),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 8/136 (6%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NG AERLNRTLLE+AR M+  + L K  D W EA+  A Y+ NR P S L+   P E+
Sbjct  569  EQNGKAERLNRTLLEKARAMILESELSK--DLWGEAILCAAYVTNRCPTSCLENVTPSEM  626

Query  708  WSGNPVDYSILRVFGCPAYAH----SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            + G   + + LRVFG  AY+H       GK + +   CI +GY     GYRLW P++RK+
Sbjct  627  FYGRKPNLNNLRVFGSVAYSHIPKQKMKGKFDRKCDVCIMIGYT--HNGYRLWIPETRKV  684

Query  540  ILSRDITFDENALLSS  493
            I +R++ FDEN  ++S
Sbjct  685  ICARNVIFDENKTITS  700



>emb|CAN70446.1| hypothetical protein VITISV_026192 [Vitis vinifera]
Length=308

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 74/125 (59%), Gaps = 5/125 (4%)
 Frame = -1

Query  864  LNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEVWSGNPVDY  685
            +N T++ER RCML    L   + FW EA  TACYL+NRSP   L+FK+P + W+      
Sbjct  2    MNCTIIERVRCMLKTTSL--SKAFWGEATQTACYLINRSPSGPLNFKVPNKEWTRKDGSC  59

Query  684  SILRVFGCPAYAH---SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIILSRDITFD  514
            S LRVFGC  + H       KL+ +A+  +F+GY  E  G+RLW    +K++ S+D+ F 
Sbjct  60   SHLRVFGCKCFVHVPKKQRSKLDDKAIPHVFIGYGDEEFGFRLWDLTKKKLVRSKDVVFQ  119

Query  513  ENALL  499
            ++  L
Sbjct  120  DDQTL  124



>ref|XP_003376808.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella 
spiralis]
 gb|EFV57947.1| retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trichinella 
spiralis]
Length=1324

 Score =   115 bits (289),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 104/184 (57%), Gaps = 17/184 (9%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGVAER+NRTL+E+AR ML +A L    D WAEAV TA YL NR P  +L    PEE 
Sbjct  581  QQNGVAERMNRTLVEKARTMLIDANL--SPDLWAEAVGTANYLRNRCPTKALRKVTPEEA  638

Query  708  WSGNPVDYSILRVFGCPAYAHSSTG---KLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            WSG   + + L+VFGC A  H  +G   K +P++ + IF+GY   SKGYR     ++K+ 
Sbjct  639  WSGRKPNLAHLKVFGCLAMVHVPSGQRKKWDPKSEERIFVGYCETSKGYRTVDRKTKKMY  698

Query  537  LSRDITFDENALLSSGKVPSTGETQS-----TGEKVEFEFRPSDSVTTADGNTKDDASTS  373
            ++RD+ F E+    + +    G T S      GE+    +   DS     G+T+ D +  
Sbjct  699  VTRDVKFLESQFPGT-QASKEGSTNSLMNPDVGEETVIVWTSQDS-----GSTEMDPN-P  751

Query  372  TAPL  361
            TAPL
Sbjct  752  TAPL  755



>gb|KDQ18753.1| hypothetical protein BOTBODRAFT_82843, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=203

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 72/132 (55%), Gaps = 5/132 (4%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
              NGVAER NRTL E    +LS A L     FW  A++   +  NRSP S+L    P EV
Sbjct  73   HQNGVAERANRTLSEGVTALLSEAKL--PPSFWLRALAAFVHSHNRSPTSALSHTTPYEV  130

Query  708  WSGNPVDYSILRVFGCPAYAHSSTGK---LNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W G   D S LRVFGC AY H    K   L P + KCIF+GY S+ K +  W P+++K I
Sbjct  131  WHGCKPDVSHLRVFGCAAYVHIQKNKRSGLQPHSRKCIFVGYPSQYKAWTFWDPETKKEI  190

Query  537  LSRDITFDENAL  502
            +S    FDE   
Sbjct  191  ISNSAQFDERVF  202



>emb|CAE03128.3| OJ000114_01.9 [Oryza sativa Japonica Group]
Length=1601

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N+T++  AR +L   G+     FW EAV TA Y++NRSP  +LD + P E 
Sbjct  801  QQNGVVERRNQTVVGMARALLKQRGMPA--IFWGEAVVTAAYILNRSPTKALDGRTPYEA  858

Query  708  WSGNPVDYSILRVFGCPAYAH--SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            W G     S LRVFGC A+A      GKL+ R+   +F+GYA  SK YR+  P+++++ +
Sbjct  859  WHGRKPAVSHLRVFGCLAFAKELGHIGKLDDRSTPGVFIGYAEGSKAYRILDPETQRVRI  918

Query  534  SRDITFDENALLSSGKVPSTGETQS----TGEKVEFE  436
            +RD+ FDE       K    G T +    T E V FE
Sbjct  919  TRDVVFDEGRGWVWDKAVDDGSTPTYDDFTIEYVHFE  955



>gb|AAT93883.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1248

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N+T++  AR +L + G+     FW EAV TA Y++NRSP  +LD K P E 
Sbjct  454  QQNGVVERRNQTVVGMARALLKHRGMPA--IFWGEAVVTAVYILNRSPTKALDGKTPYEA  511

Query  708  WSGNPVDYSILRVFGCPAYAH--SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            W G+    S LRVFGC A+A      GKL+ R+   +F+GYA  SK YR+  P+++++  
Sbjct  512  WHGHKPAVSHLRVFGCLAFAKELGHIGKLDDRSTPGVFIGYAEGSKAYRILDPETQRVRT  571

Query  534  SRDITFDENALLSSGKVPSTGETQS----TGEKVEFE  436
             RD+ FDE       K    G T +    T E V FE
Sbjct  572  VRDVVFDEGRGWVWDKAVDDGSTPTYDDFTIEYVHFE  608



>gb|AAG60200.1|AC084763_20 putative gag-pol polyprotein [Oryza sativa Japonica Group]
Length=1611

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N+T++  AR +L   G+     FW EAV TA Y++NRSP  +LD + P E 
Sbjct  811  QQNGVVERRNQTVVGMARALLKQRGMPA--IFWGEAVVTAAYILNRSPTKALDGRTPYEA  868

Query  708  WSGNPVDYSILRVFGCPAYAH--SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            W G     S LRVFGC A+A      GKL+ R+   +F+GYA  SK YR+  P+++++ +
Sbjct  869  WHGRKPAVSHLRVFGCLAFAKELGHIGKLDDRSTPGVFIGYAEGSKAYRILDPETQRVRI  928

Query  534  SRDITFDENALLSSGKVPSTGETQS----TGEKVEFE  436
            +RD+ FDE       K    G T +    T E V FE
Sbjct  929  TRDVVFDEGRGWVWDKAVDDGSTPTYDDFTIEYVHFE  965



>gb|AAN05503.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
Length=1586

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N+T++  AR +L   G+     FW EAV TA Y++NRSP  +LD + P E 
Sbjct  801  QQNGVVERRNQTVVGMARALLKQRGMPA--IFWGEAVVTAAYILNRSPTKALDGRTPYEA  858

Query  708  WSGNPVDYSILRVFGCPAYAH--SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            W G     S LRVFGC A+A      GKL+ R+   +F+GYA  SK YR+  P+++++ +
Sbjct  859  WHGRKPAVSHLRVFGCLAFAKELGHIGKLDDRSTPGVFIGYAEGSKAYRILDPETQRVRI  918

Query  534  SRDITFDENALLSSGKVPSTGETQS----TGEKVEFE  436
            +RD+ FDE       K    G T +    T E V FE
Sbjct  919  TRDVVFDEGRGWVWDKAVDDGSTPTYDDFTIEYVHFE  955



>ref|NP_001175469.1| Os08g0248500 [Oryza sativa Japonica Group]
 dbj|BAH94197.1| Os08g0248500 [Oryza sativa Japonica Group]
Length=1487

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            Q NGV ER N+T++  AR +L   G+     FW EAV TA Y++NRSP  +LD + P E 
Sbjct  702  QQNGVVERRNQTVVGMARALLKQRGMPA--IFWGEAVVTAAYILNRSPTKALDGRTPYEA  759

Query  708  WSGNPVDYSILRVFGCPAYAH--SSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKIIL  535
            W G     S LRVFGC A+A      GKL+ R+   +F+GYA  SK YR+  P+++++ +
Sbjct  760  WHGRKPAVSHLRVFGCLAFAKELGHIGKLDDRSTPGVFIGYAEGSKAYRILDPETQRVRI  819

Query  534  SRDITFDENALLSSGKVPSTGETQS----TGEKVEFE  436
            +RD+ FDE       K    G T +    T E V FE
Sbjct  820  TRDVVFDEGRGWVWDKAVDDGSTPTYDDFTIEYVHFE  856



>gb|EFA07743.1| hypothetical protein TcasGA2_TC002223 [Tribolium castaneum]
Length=1384

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 11/161 (7%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGV+ER +RTLL+ ARC+L  + L     FWAEAV+TA YL NR P  SL+ + P E 
Sbjct  576  EQNGVSERKDRTLLDTARCLLMESKLPS--SFWAEAVNTANYLRNRLPTKSLNGRTPYEA  633

Query  708  WSGNPVDYSILRVFGCPAYA---HSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKII  538
            W+G   D S  +VFG   +        GK +PRA + IFLGYA  SK +R+WSP+ RK+ 
Sbjct  634  WTGRAPDLSHCKVFGARVFYLNRERDRGKFDPRAQEGIFLGYAENSKAFRIWSPEKRKVF  693

Query  537  LSRDITFDENALLSSGKV------PSTGETQSTGEKVEFEF  433
            +++D+   ++   +          P   E+ S+ E V+ EF
Sbjct  694  ITQDVKLLKDDEDNEDNFDVFPSPPDPEESSSSREFVDIEF  734



>emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera]
Length=1274

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -1

Query  888  QXNGVAERLNRTLLERARCMLSNAGLWKRRDFWAEAVSTACYLVNRSPHSSLDFKIPEEV  709
            + NGVAER NRT++E AR M+    L     FWAE V+TA YL+N SP  ++  + P E 
Sbjct  597  EQNGVAERKNRTVVEMARSMMKAKNL--SNHFWAEGVATAVYLLNISPTKAVLNRTPYEA  654

Query  708  WSGNPVDYSILRVFGCPAY----AHSSTGKLNPRAVKCIFLGYASESKGYRLWSPDSRKI  541
            W G     S L+VFG  AY    +H+ +  L+ +++KCIF+GY S+SKGY+L++P S KI
Sbjct  655  WYGRKPWVSHLKVFGSVAYTLIDSHNHSN-LDEKSIKCIFIGYCSQSKGYKLYNPVSGKI  713

Query  540  ILSRDITFDENA  505
            I+SR++  DE A
Sbjct  714  IVSRNVVXDEKA  725



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2032267776884