BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8398

Length=810
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004236633.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    313   6e-97   Solanum lycopersicum
ref|XP_006350224.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    313   7e-97   Solanum tuberosum [potatoes]
gb|EPS66358.1|  phosphoinositide 3-kinase                               306   7e-97   Genlisea aurea
ref|XP_009802381.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    313   7e-97   Nicotiana sylvestris
gb|AAW80628.1|  phosphoinositide 3-kinase                               313   8e-97   Nicotiana tabacum [American tobacco]
ref|XP_009605436.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    313   9e-97   
ref|XP_004489832.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   1e-96   
ref|XP_010269376.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   1e-96   Nelumbo nucifera [Indian lotus]
gb|AAL86326.1|  putative phosphatidylinositol 3-kinase                  304   2e-96   Arabidopsis thaliana [mouse-ear cress]
gb|KJB15579.1|  hypothetical protein B456_002G185300                    311   3e-96   Gossypium raimondii
gb|KDO82393.1|  hypothetical protein CISIN_1g003462mg                   310   3e-96   Citrus sinensis [apfelsine]
dbj|BAD94035.1|  phosphatidylinositol 3-kinase                          298   5e-96   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940073.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    309   9e-96   
ref|XP_011100557.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   1e-95   Sesamum indicum [beniseed]
ref|XP_010936705.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   1e-95   Elaeis guineensis
ref|XP_010936707.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   1e-95   Elaeis guineensis
ref|XP_008221836.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   1e-95   Prunus mume [ume]
gb|KCW84834.1|  hypothetical protein EUGRSUZ_B016662                    291   1e-95   Eucalyptus grandis [rose gum]
gb|KDO82391.1|  hypothetical protein CISIN_1g003462mg                   310   2e-95   Citrus sinensis [apfelsine]
gb|KDO82389.1|  hypothetical protein CISIN_1g003462mg                   310   2e-95   Citrus sinensis [apfelsine]
ref|XP_010269375.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   2e-95   Nelumbo nucifera [Indian lotus]
ref|XP_006438361.1|  hypothetical protein CICLE_v10030717mg             310   2e-95   Citrus clementina [clementine]
ref|XP_004297475.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   2e-95   Fragaria vesca subsp. vesca
ref|XP_008389664.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    309   2e-95   Malus domestica [apple tree]
ref|XP_010940071.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    309   2e-95   Elaeis guineensis
ref|XP_007044676.1|  Vacuolar protein sorting 34 isoform 1              309   3e-95   
ref|XP_007227349.1|  hypothetical protein PRUPE_ppa001353mg             310   3e-95   
ref|XP_003613218.1|  Phosphatidylinositol 3-kinase                      309   3e-95   Medicago truncatula
ref|XP_004142979.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    309   3e-95   Cucumis sativus [cucumbers]
ref|XP_004489830.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    309   4e-95   Cicer arietinum [garbanzo]
ref|XP_010269370.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   4e-95   Nelumbo nucifera [Indian lotus]
ref|XP_010269374.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    310   4e-95   Nelumbo nucifera [Indian lotus]
ref|XP_010100445.1|  Phosphatidylinositol 3-kinase, root isoform        308   6e-95   
ref|XP_006483879.1|  PREDICTED: phosphatidylinositol 3-kinase, no...    308   6e-95   
ref|XP_008782484.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    308   7e-95   Phoenix dactylifera
ref|XP_008444332.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    309   8e-95   
emb|CDP13176.1|  unnamed protein product                                308   8e-95   Coffea canephora [robusta coffee]
ref|XP_010417983.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    306   9e-95   Camelina sativa [gold-of-pleasure]
ref|XP_010510945.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    305   9e-95   Camelina sativa [gold-of-pleasure]
ref|XP_008795927.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   1e-94   
gb|EYU42801.1|  hypothetical protein MIMGU_mgv1a001464mg                307   2e-94   Erythranthe guttata [common monkey flower]
ref|XP_008795925.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   3e-94   Phoenix dactylifera
ref|XP_008340052.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   3e-94   
gb|KFK40782.1|  hypothetical protein AALP_AA2G040200                    306   3e-94   Arabis alpina [alpine rockcress]
ref|XP_010651488.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   3e-94   Vitis vinifera
ref|XP_006392160.1|  hypothetical protein EUTSA_v10023282mg             306   3e-94   Eutrema salsugineum [saltwater cress]
emb|CDY44616.1|  BnaCnng11650D                                          288   4e-94   Brassica napus [oilseed rape]
ref|XP_002267769.2|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   4e-94   Vitis vinifera
emb|CCD74511.1|  phosphatidylinositol 3-kinase                          305   4e-94   Arabidopsis halleri subsp. halleri
ref|XP_012085401.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   4e-94   Jatropha curcas
ref|XP_012085402.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   4e-94   Jatropha curcas
ref|XP_012085400.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    306   5e-94   Jatropha curcas
gb|ABA03135.1|  phosphatidylinositol 3-kinase 1                         306   6e-94   Phaseolus vulgaris [French bean]
ref|XP_006580982.1|  PREDICTED: phosphatidylinositol 3-kinase, no...    305   6e-94   
ref|XP_006580980.1|  PREDICTED: phosphatidylinositol 3-kinase, no...    306   6e-94   
ref|NP_001236955.1|  phosphatidylinositol 3-kinase, root isoform        306   7e-94   Glycine max [soybeans]
ref|XP_007157437.1|  hypothetical protein PHAVU_002G070100g             305   7e-94   Phaseolus vulgaris [French bean]
ref|XP_010533950.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    305   7e-94   Tarenaya hassleriana [spider flower]
ref|XP_010553608.1|  PREDICTED: phosphatidylinositol 3-kinase VPS34     305   7e-94   Tarenaya hassleriana [spider flower]
gb|KHN08268.1|  Phosphatidylinositol 3-kinase, root isoform             305   8e-94   Glycine soja [wild soybean]
ref|XP_010533951.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    305   8e-94   Tarenaya hassleriana [spider flower]
ref|XP_006301054.1|  hypothetical protein CARUB_v10021447mg             305   9e-94   Capsella rubella
ref|XP_010417982.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    305   9e-94   Camelina sativa [gold-of-pleasure]
ref|XP_002525363.1|  phosphatidylinositol 3-kinase class, putative      305   1e-93   Ricinus communis
ref|XP_002886614.1|  ATVPS34                                            305   1e-93   
ref|XP_010510944.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    305   1e-93   Camelina sativa [gold-of-pleasure]
ref|NP_176251.1|  phosphatidylinositol 3-kinase VPS34                   305   1e-93   Arabidopsis thaliana [mouse-ear cress]
gb|AAA83427.1|  phosphatidylinositol 3-kinase                           305   1e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010040873.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    296   1e-93   
emb|CDY47220.1|  BnaC09g14690D                                          304   2e-93   Brassica napus [oilseed rape]
ref|XP_009113206.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    304   2e-93   Brassica rapa
ref|XP_009113205.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    304   2e-93   
gb|ABA03136.1|  phosphatidylinositol 3-kinase 1                         304   2e-93   Phaseolus vulgaris [French bean]
ref|XP_009113204.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    304   2e-93   Brassica rapa
emb|CDY53049.1|  BnaA09g14140D                                          304   2e-93   Brassica napus [oilseed rape]
gb|AAN62481.1|  phosphatidylinositol 3-kinase                           304   3e-93   Brassica napus [oilseed rape]
ref|XP_009409808.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    303   4e-93   
ref|XP_010474549.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    305   5e-93   
ref|NP_001242315.1|  phosphatidylinositol 3-kinase, nodule isoform      303   5e-93   Glycine max [soybeans]
ref|XP_002318628.1|  phosphatidylinositol 3-kinase family protein       302   1e-92   
ref|XP_011042652.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    302   2e-92   Populus euphratica
ref|XP_010682535.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    300   6e-92   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682534.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    300   6e-92   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011625137.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    297   1e-90   Amborella trichopoda
ref|XP_010023534.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    297   1e-90   Eucalyptus grandis [rose gum]
gb|ERN10666.1|  hypothetical protein AMTR_s00028p00234070               297   1e-90   Amborella trichopoda
gb|KCW84845.1|  hypothetical protein EUGRSUZ_B01668                     295   4e-90   Eucalyptus grandis [rose gum]
gb|AFW62055.1|  hypothetical protein ZEAMMB73_811721                    281   4e-89   
ref|XP_006438362.1|  hypothetical protein CICLE_v10030717mg             293   4e-89   
ref|XP_001762959.1|  predicted protein                                  287   5e-87   
ref|XP_006654109.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    281   3e-85   
ref|XP_004973055.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    282   4e-85   Setaria italica
ref|XP_004973056.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    282   4e-85   
ref|XP_008678534.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    280   2e-84   Zea mays [maize]
ref|NP_001054810.1|  Os05g0180600                                       279   6e-84   
ref|XP_002984319.1|  hypothetical protein SELMODRAFT_268853             277   2e-83   
ref|XP_002972489.1|  hypothetical protein SELMODRAFT_97360              278   2e-83   
ref|XP_003566732.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    276   1e-82   Brachypodium distachyon [annual false brome]
dbj|BAJ91813.1|  predicted protein                                      272   3e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55477.1|  Phosphatidylinositol 3-kinase, root isoform             271   1e-80   Triticum urartu
gb|EMT32616.1|  Phosphatidylinositol 3-kinase, root isoform             270   3e-80   
emb|CAN72914.1|  hypothetical protein VITISV_034007                     273   3e-79   Vitis vinifera
ref|XP_010234573.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    248   8e-73   Brachypodium distachyon [annual false brome]
gb|ESA02209.1|  hypothetical protein GLOINDRAFT_6733                    248   2e-72   
ref|XP_003571627.2|  PREDICTED: phosphatidylinositol 3-kinase, ro...    248   2e-72   Brachypodium distachyon [annual false brome]
ref|XP_001689631.1|  VPS34-like PI-3-kinase                             245   2e-70   Chlamydomonas reinhardtii
ref|XP_002954001.1|  hypothetical protein VOLCADRAFT_40672              241   2e-70   Volvox carteri f. nagariensis
ref|XP_002506109.1|  predicted protein                                  240   2e-69   Micromonas commoda
gb|AAC50017.1|  phosphatidylinositol 3-kinase                           238   5e-69   Chlamydomonas reinhardtii
emb|CEJ02078.1|  hypothetical protein RMCBS344292_16095                 236   7e-69   Rhizopus microsporus
gb|EIE82383.1|  hypothetical protein RO3G_07088                         236   1e-68   Rhizopus delemar RA 99-880
gb|KIY96448.1|  phosphatidylinositol 3-kinase                           233   1e-68   Monoraphidium neglectum
emb|CEG70099.1|  hypothetical protein RMATCC62417_06049                 236   1e-68   Rhizopus microsporus
emb|CEJ04469.1|  hypothetical protein RMCBS344292_18430                 236   7e-68   Rhizopus microsporus
emb|CEG70098.1|  hypothetical protein RMATCC62417_06049                 236   8e-68   Rhizopus microsporus
ref|XP_002983829.1|  hypothetical protein SELMODRAFT_118849             234   1e-67   
ref|XP_002989110.1|  hypothetical protein SELMODRAFT_129115             235   2e-67   
gb|EPB83231.1|  hypothetical protein HMPREF1544_10027                   234   2e-67   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_001061506.1|  Os08g0307400                                       233   7e-67   
dbj|GAN11171.1|  phosphatidylinositol 3-kinase                          233   7e-67   Mucor ambiguus
emb|CDS10815.1|  hypothetical protein LRAMOSA11301                      232   1e-66   Lichtheimia ramosa
emb|CEP14473.1|  hypothetical protein                                   233   1e-66   Parasitella parasitica
emb|CDH58858.1|  atypical pikk pi3k protein kinase                      232   3e-66   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003062450.1|  phosphatidylinositol 4-kinase                      229   1e-65   Micromonas pusilla CCMP1545
gb|EFA77138.1|  phosphatidylinositol 3-kinase                           226   5e-65   Heterostelium album PN500
ref|XP_011399049.1|  Phosphatidylinositol 3-kinase, root isoform        225   3e-64   Auxenochlorella protothecoides
gb|EPZ35311.1|  Phosphatidylinositol Kinase domain-containing pro...    224   5e-64   Rozella allomycis CSF55
ref|XP_004348988.2|  phosphoinositide-3-kinase                          225   1e-63   Capsaspora owczarzaki ATCC 30864
ref|XP_006438360.1|  hypothetical protein CICLE_v10030717mg             221   7e-63   
gb|KDO82390.1|  hypothetical protein CISIN_1g003462mg                   221   8e-63   Citrus sinensis [apfelsine]
ref|XP_006682457.1|  hypothetical protein BATDEDRAFT_36168              219   7e-62   Batrachochytrium dendrobatidis JAM81
gb|KDD73211.1|  hypothetical protein H632_c2423p0                       212   8e-62   Helicosporidium sp. ATCC 50920
dbj|GAM23254.1|  hypothetical protein SAMD00019534_064290               219   1e-61   Acytostelium subglobosum LB1
gb|KFH73635.1|  hypothetical protein MVEG_00850                         218   2e-61   Mortierella verticillata NRRL 6337
ref|XP_002170067.2|  PREDICTED: phosphatidylinositol 3-kinase cat...    216   2e-60   
ref|XP_002677255.1|  predicted protein                                  216   2e-60   Naegleria gruberi strain NEG-M
gb|AAA85726.1|  phosphatidylinositol 3-kinase                           215   2e-60   Dictyostelium discoideum AX3
ref|XP_636122.1|  phosphatidylinositol 3-kinase                         215   2e-60   Dictyostelium discoideum AX4
ref|XP_003291233.1|  phosphatidylinositol 3-kinase                      214   3e-60   Dictyostelium purpureum
emb|CCJ29853.1|  unnamed protein product                                214   3e-60   Pneumocystis jirovecii
tpg|DAA64655.1|  TPA: phosphatidylinositol 3-kinase                     213   3e-59   Emiliania huxleyi
ref|XP_005776813.1|  phosphatidylinositol 3-kinase Vps34                213   4e-59   Emiliania huxleyi CCMP1516
ref|XP_004350853.1|  phosphatidylinositol 3-kinase                      211   5e-59   Cavenderia fasciculata
gb|ADK87856.1|  GOLM25                                                  195   6e-59   Arabidopsis halleri
gb|ADK87852.1|  GOLM25                                                  194   1e-58   Arabidopsis halleri
ref|XP_005646177.1|  phosphatidylinositol 3-kinase                      210   1e-58   Coccomyxa subellipsoidea C-169
gb|ADK87861.1|  GOLM25                                                  193   4e-58   Arabidopsis halleri
gb|ADK87868.1|  GOLM25                                                  192   5e-58   Arabidopsis halleri
gb|ADK87862.1|  GOLM25                                                  192   5e-58   Arabidopsis halleri
gb|ADK87859.1|  GOLM25                                                  191   3e-57   Arabidopsis halleri
gb|ADK87857.1|  GOLM25                                                  189   9e-57   Arabidopsis halleri
ref|XP_003741971.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    204   2e-56   Galendromus occidentalis
ref|XP_011409708.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    194   3e-56   
ref|XP_003958733.1|  hypothetical protein KAFR_0H01890                  203   4e-56   Kazachstania africana CBS 2517
ref|XP_007875266.1|  hypothetical protein PNEG_03203                    201   2e-55   Pneumocystis murina B123
ref|XP_002554568.1|  KLTH0F08404p                                       201   2e-55   Lachancea thermotolerans CBS 6340
ref|XP_002110551.1|  hypothetical protein TRIADDRAFT_22684              200   6e-55   Trichoplax adhaerens
ref|XP_004989703.1|  hypothetical protein PTSG_12885                    199   1e-54   Salpingoeca rosetta
emb|CEP61436.1|  LALA0S03e02828g1_1                                     198   2e-54   Lachancea lanzarotensis
gb|AAQ56466.1|  putative phosphatidylinositol 3-kinase                  183   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|KKA19143.1|  Phosphatidylinositol 3-kinase                           198   3e-54   Rasamsonia emersonii CBS 393.64
emb|CCK67951.1|  hypothetical protein KNAG_0A02620                      197   4e-54   Kazachstania naganishii CBS 8797
ref|XP_001645719.1|  hypothetical protein Kpol_1043p51                  197   4e-54   Vanderwaltozyma polyspora DSM 70294
gb|KHJ30663.1|  putative phosphatidylinositol 3-kinase                  197   6e-54   Erysiphe necator
ref|XP_505213.2|  YALI0F09559p                                          197   6e-54   Yarrowia lipolytica CLIB122
ref|XP_003682547.1|  hypothetical protein TDEL_0F05250                  197   6e-54   Torulaspora delbrueckii
emb|CDH09875.1|  probable Phosphatidylinositol 3-kinase VPS34           197   9e-54   Zygosaccharomyces bailii ISA1307
emb|CDF87744.1|  BN860_13476g1_1                                        197   9e-54   Zygosaccharomyces bailii CLIB 213
emb|CDH17805.1|  probable Phosphatidylinositol 3-kinase VPS34           196   9e-54   Zygosaccharomyces bailii ISA1307
ref|XP_002495847.1|  ZYRO0C04356p                                       196   1e-53   Zygosaccharomyces rouxii
emb|CDR44756.1|  CYFA0S15e02454g1_1                                     196   1e-53   Cyberlindnera fabianii
dbj|GAA95268.1|  hypothetical protein E5Q_01924                         196   1e-53   Mixia osmundae IAM 14324
gb|AAH92169.1|  Pik3c3 protein                                          189   2e-53   Danio rerio [leopard danio]
ref|XP_446727.1|  hypothetical protein                                  196   3e-53   [Candida] glabrata
ref|XP_003675639.1|  hypothetical protein NCAS_0C02830                  195   3e-53   Naumovozyma castellii CBS 4309
ref|XP_008896150.1|  hypothetical protein PPTG_04077                    196   3e-53   Phytophthora parasitica INRA-310
ref|XP_002147483.1|  phosphoinositide 3-kinase, putative                195   3e-53   Talaromyces marneffei ATCC 18224
ref|XP_002900926.1|  phosphatidyl inositol kinase (PIK-A)               196   3e-53   Phytophthora infestans T30-4
ref|XP_002836750.1|  hypothetical protein                               195   3e-53   Tuber melanosporum Mel28
ref|XP_009521543.1|  phosphoinositide 3-kinase                          196   3e-53   Phytophthora sojae
ref|XP_003684818.1|  hypothetical protein TPHA_0C02310                  196   4e-53   Tetrapisispora phaffii CBS 4417
gb|AJV60652.1|  Vps34p                                                  194   5e-53   Saccharomyces cerevisiae YJM1400
ref|XP_002793788.1|  phosphatidylinositol 3-kinase vps34                195   6e-53   
gb|EJT41797.1|  VPS34-like protein                                      194   6e-53   Saccharomyces kudriavzevii IFO 1802
gb|KGY15264.1|  hypothetical protein PABG_11848                         194   6e-53   Paracoccidioides brasiliensis Pb03
gb|EEH33007.2|  phosphatidylinositol 3-kinase vps34                     194   6e-53   Paracoccidioides lutzii Pb01
gb|AJV67322.1|  Vps34p                                                  194   6e-53   Saccharomyces cerevisiae YJM1463
ref|XP_010762682.1|  hypothetical protein PADG_07335                    194   7e-53   Paracoccidioides brasiliensis Pb18
gb|AJV65985.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM1447
gb|EWG94405.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae R103
gb|AJV73604.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM244
gb|AJV63357.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM1419
ref|XP_002383860.1|  phosphoinositide 3-kinase, putative                194   7e-53   Aspergillus flavus NRRL3357
ref|XP_003671234.2|  hypothetical protein NDAI_0G02160                  194   7e-53   Naumovozyma dairenensis CBS 421
gb|EDZ70540.1|  YLR240Wp-like protein                                   194   7e-53   Saccharomyces cerevisiae AWRI1631
ref|NP_013341.1|  phosphatidylinositol 3-kinase VPS34                   194   7e-53   Saccharomyces cerevisiae S288C
ref|XP_001824747.1|  phosphatidylinositol 3-kinase vps34                194   7e-53   Aspergillus oryzae RIB40
gb|EER41354.1|  phosphoinositide 3-kinase                               194   7e-53   Histoplasma capsulatum H143
gb|AJV49916.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM1244
gb|AJV54824.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM1338
gb|AJV53916.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM1332
gb|AJV66873.1|  Vps34p                                                  194   7e-53   Saccharomyces cerevisiae YJM1460
gb|AJV74419.1|  Vps34p                                                  194   8e-53   Saccharomyces cerevisiae YJM270
gb|AJV61103.1|  Vps34p                                                  194   8e-53   Saccharomyces cerevisiae YJM1401
gb|EPS34839.1|  hypothetical protein PDE_09803                          194   8e-53   Penicillium oxalicum 114-2
gb|KJK67917.1|  Phosphatidylinositol 3- and 4-kinase                    194   8e-53   Aspergillus parasiticus SU-1
ref|XP_011104561.1|  vps34p                                             194   8e-53   
gb|AJV60202.1|  Vps34p                                                  194   8e-53   Saccharomyces cerevisiae YJM1399
gb|EGC47238.1|  phosphoinositide 3-kinase                               194   9e-53   Histoplasma capsulatum H88
gb|AGO13756.1|  AaceriAGL113Cp                                          194   9e-53   Saccharomycetaceae sp. 'Ashbya aceri'
gb|EEH02833.1|  conserved hypothetical protein                          194   1e-52   Histoplasma capsulatum G186AR
ref|XP_011276515.1|  Phosphatidylinositol 3-kinase catalytic subu...    193   1e-52   Wickerhamomyces ciferrii
gb|EPQ66753.1|  Phosphatidylinositol 3-kinase                           194   1e-52   Blumeria graminis f. sp. tritici 96224
emb|CCU77453.1|  phosphatidylinositol 3-kinase/VPS34                    194   1e-52   Blumeria graminis f. sp. hordei DH14
dbj|GAM36497.1|  phosphatidylinositol 3-kinase                          194   1e-52   Talaromyces cellulolyticus
gb|EYE98373.1|  putative phosphoinositide 3-kinase                      194   1e-52   Aspergillus ruber CBS 135680
ref|NP_986554.1|  AGL113Cp                                              193   1e-52   Eremothecium gossypii ATCC 10895
gb|EHL00182.1|  putative Phosphatidylinositol 3-kinase vps34            189   1e-52   Glarea lozoyensis 74030
ref|XP_004181893.1|  hypothetical protein TBLA_0H00850                  193   1e-52   Tetrapisispora blattae CBS 6284
dbj|GAA85186.1|  phosphoinositide 3-kinase                              193   1e-52   Aspergillus kawachii IFO 4308
gb|EPE05598.1|  phosphatidylinositol 3-kinase catalytic subunit         194   2e-52   Ophiostoma piceae UAMH 11346
ref|XP_003646060.1|  hypothetical protein Ecym_4166                     193   2e-52   Eremothecium cymbalariae DBVPG#7215
ref|XP_001391565.1|  phosphatidylinositol 3-kinase vps34                193   2e-52   Aspergillus niger CBS 513.88
ref|XP_007295423.1|  phosphatidylinositol 3                             194   2e-52   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_002481619.1|  phosphoinositide 3-kinase, putative                193   2e-52   Talaromyces stipitatus ATCC 10500
gb|KGO44307.1|  C2 calcium/lipid-binding domain, CaLB                   193   2e-52   Penicillium expansum
gb|KGO38881.1|  C2 calcium/lipid-binding domain, CaLB                   193   2e-52   Penicillium expansum
gb|EMR89327.1|  putative phosphatidylinositol 3-kinase catalytic ...    193   2e-52   Botrytis cinerea BcDW1
ref|XP_002567133.1|  Pc21g00590                                         193   2e-52   Penicillium rubens Wisconsin 54-1255
ref|XP_002628247.1|  phosphoinositide 3-kinase                          193   2e-52   Blastomyces gilchristii SLH14081
gb|KJJ23711.1|  Phosphatidylinositol 3-4-kinase catalytic domain        193   2e-52   
gb|KGO68857.1|  C2 calcium/lipid-binding domain, CaLB                   193   2e-52   Penicillium italicum
gb|KDB17242.1|  phosphoinositide 3-kinase                               193   2e-52   Ustilaginoidea virens
gb|EGE81644.1|  phosphoinositide 3-kinase                               193   3e-52   Blastomyces dermatitidis ATCC 18188
emb|CEJ82844.1|  Putative Phosphatidylinositol 3-kinase catalytic...    193   3e-52   Torrubiella hemipterigena
ref|XP_001587332.1|  hypothetical protein SS1G_11324                    193   3e-52   Sclerotinia sclerotiorum 1980 UF-70
gb|EQL33006.1|  phosphatidylinositol 3-kinase                           193   3e-52   Blastomyces dermatitidis ATCC 26199
gb|ESZ89610.1|  phosphatidylinositol 3                                  193   3e-52   Sclerotinia borealis F-4128
ref|XP_001552296.1|  hypothetical protein BC1G_08774                    193   4e-52   
ref|XP_002171412.1|  phosphatidylinositol 3-kinase Pik3                 192   4e-52   Schizosaccharomyces japonicus yFS275
ref|XP_008281618.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    188   4e-52   Stegastes partitus
gb|KIH87667.1|  phosphatidylinositol 3-kinase                           193   5e-52   Sporothrix brasiliensis 5110
ref|XP_001274185.1|  phosphoinositide 3-kinase, putative                192   5e-52   Aspergillus clavatus NRRL 1
gb|ERS98459.1|  hypothetical protein HMPREF1624_05243                   193   5e-52   Sporothrix schenckii ATCC 58251
emb|CCI50463.1|  unnamed protein product                                193   6e-52   Albugo candida
ref|XP_662313.1|  hypothetical protein AN4709.2                         191   7e-52   Aspergillus nidulans FGSC A4
emb|CCA27367.1|  phosphatidyl inositol kinase (PIKA) putative           192   8e-52   Albugo laibachii Nc14
emb|CDM29302.1|  Phosphatidylinositol 3-kinase vps34                    191   8e-52   Penicillium roqueforti FM164
dbj|GAD97644.1|  phosphoinositide 3-kinase, putative                    191   8e-52   Byssochlamys spectabilis No. 5
ref|XP_753770.1|  phosphoinositide 3-kinase                             191   9e-52   Aspergillus fumigatus Af293
gb|KEY80640.1|  phosphoinositide 3 kinase                               191   9e-52   Aspergillus fumigatus var. RP-2014
gb|EDP51610.1|  phosphoinositide 3-kinase, putative                     191   9e-52   Aspergillus fumigatus A1163
ref|XP_002848675.1|  Vps34p                                             191   1e-51   Microsporum canis CBS 113480
ref|XP_001259818.1|  phosphoinositide 3-kinase, putative                191   1e-51   Aspergillus fischeri NRRL 181
ref|XP_003070007.1|  Phosphatidylinositol 3- and 4-kinase family ...    191   1e-51   Coccidioides posadasii C735 delta SOWgp
dbj|GAO14498.1|  hypothetical protein UVI_015750                        192   1e-51   Ustilaginoidea virens
ref|XP_001242874.1|  hypothetical protein CIMG_06770                    191   1e-51   Coccidioides immitis RS
gb|EZG21138.1|  hypothetical protein H107_00813                         192   1e-51   Trichophyton rubrum CBS 202.88
gb|EFW16291.1|  phosphoinositide 3-kinase                               191   1e-51   Coccidioides posadasii str. Silveira
gb|EZF35480.1|  hypothetical protein H101_00996                         192   1e-51   Trichophyton interdigitale H6
gb|EGD98317.1|  phosphoinositide 3-kinase                               192   1e-51   Trichophyton tonsurans CBS 112818
ref|XP_003231578.1|  phosphoinositide 3-kinase                          192   1e-51   Trichophyton rubrum CBS 118892
ref|XP_003023447.1|  hypothetical protein TRV_02431                     192   1e-51   Trichophyton verrucosum HKI 0517
gb|EGE03276.1|  phosphatidylinositol 3-kinase vps34                     191   1e-51   Trichophyton equinum CBS 127.97
gb|EZF78135.1|  hypothetical protein H105_00756                         191   1e-51   Trichophyton soudanense CBS 452.61
gb|EKV12782.1|  Vps34p                                                  191   1e-51   Penicillium digitatum Pd1
ref|XP_003014880.1|  hypothetical protein ARB_06637                     191   1e-51   Trichophyton benhamiae CBS 112371
gb|KIN08000.1|  hypothetical protein OIDMADRAFT_151980                  191   1e-51   Oidiodendron maius Zn
ref|XP_003174287.1|  phosphatidylinositol 3-kinase vps34                191   2e-51   Nannizzia gypsea CBS 118893
gb|EFX03298.1|  phosphoinositide 3-kinase                               191   2e-51   Grosmannia clavigera kw1407
gb|EPX73187.1|  phosphatidylinositol 3-kinase Pik3                      189   2e-51   Schizosaccharomyces octosporus yFS286
gb|EPY50324.1|  phosphatidylinositol 3-kinase Pik3                      189   2e-51   Schizosaccharomyces cryophilus OY26
ref|XP_003053051.1|  predicted protein                                  190   2e-51   [Nectria] haematococca mpVI 77-13-4
emb|CCD42610.1|  similar to phosphatidylinositol 3-kinase               191   2e-51   Botrytis cinerea T4
gb|ETW32648.1|  hypothetical protein PFTANZ_06632                       181   3e-51   Plasmodium falciparum Tanzania (2000708)
gb|KID70100.1|  Phosphatidylinositol Kinase                             190   3e-51   Metarhizium anisopliae ARSEF 549
ref|XP_002544178.1|  phosphatidylinositol 3-kinase vps34                189   3e-51   Uncinocarpus reesii 1704
gb|KFH46181.1|  Phosphatidylinositol 3-kinase catalytic subunit t...    190   4e-51   Acremonium chrysogenum ATCC 11550
emb|CDQ69823.1|  unnamed protein product                                189   4e-51   Oncorhynchus mykiss
gb|KIL91942.1|  hypothetical protein FAVG1_04346                        190   4e-51   
gb|KID72598.1|  Phosphatidylinositol Kinase                             190   4e-51   
ref|XP_007791240.1|  putative phosphatidylinositol 3-kinase protein     179   4e-51   
ref|XP_007823606.2|  phosphatidylinositol 3-kinase                      189   4e-51   
gb|KIE00219.1|  Phosphatidylinositol Kinase                             189   4e-51   
gb|KID89545.1|  Phosphatidylinositol 3-kinase, Vps34 type               189   4e-51   
gb|AAB34500.1|  phosphatidylinositol 3 kinase homolog                   188   5e-51   
ref|XP_007881950.1|  hypothetical protein PFL1_06221                    190   5e-51   
pdb|4PH4|B  Chain B, The Crystal Structure Of Human Vps34 In Comp...    187   5e-51   
gb|AAC49133.1|  SpVps34p                                                188   5e-51   
ref|NP_594699.1|  phosphatidylinositol 3-kinase Pik3                    188   5e-51   
gb|KFG79980.1|  putative phosphoinositide 3-kinase                      190   6e-51   
gb|EYB29336.1|  hypothetical protein FG05_08522                         189   6e-51   
gb|KFM73350.1|  Phosphatidylinositol 3-kinase catalytic subunit t...    182   7e-51   
ref|XP_011320238.1|  hypothetical protein FGSG_08522                    189   7e-51   
gb|ELU04838.1|  hypothetical protein CAPTEDRAFT_155274                  189   8e-51   
ref|XP_009261564.1|  hypothetical protein FPSE_10172                    189   8e-51   
ref|XP_009266284.1|  Phosphatidylinositol 3-kinase vps34                186   8e-51   
ref|XP_005622915.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   9e-51   
ref|XP_007110747.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   9e-51   
gb|KJZ75951.1|  hypothetical protein HIM_04775                          190   9e-51   
ref|XP_006956001.1|  phosphatidylinositol 3-kinase                      187   9e-51   
ref|XP_005993879.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   9e-51   
ref|XP_006968107.1|  phosphatidylinositol 3-kinase                      189   1e-50   
gb|KEY68734.1|  hypothetical protein S7711_00606                        188   1e-50   
gb|KIM84797.1|  hypothetical protein PILCRDRAFT_5847                    188   1e-50   
ref|XP_008101872.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    188   1e-50   
ref|XP_008586443.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
gb|ETR99025.1|  phosphatidylinositol 3-kinase                           188   1e-50   
ref|XP_008101879.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    188   1e-50   
gb|EQK97775.1|  Phosphatidylinositol Kinase                             188   1e-50   
ref|XP_011524333.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
ref|XP_009914705.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
ref|XP_008078002.1|  Protein kinase-like (PK-like)                      189   1e-50   
ref|XP_009914707.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
ref|XP_006691840.1|  phosphatidylinositol 3-kinase-like protein         188   1e-50   
ref|XP_002617561.1|  hypothetical protein CLUG_03005                    189   1e-50   
ref|XP_008426188.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
ref|XP_453887.1|  hypothetical protein                                  187   1e-50   
ref|XP_004855307.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
ref|XP_005807287.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   1e-50   
gb|KJK75760.1|  Phosphatidylinositol 3-kinase catalytic subunit         189   1e-50   
ref|XP_007563698.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_009914704.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
gb|KFA66752.1|  hypothetical protein S40285_05300                       188   2e-50   
gb|KHN98871.1|  Phosphatidylinositol Kinase                             188   2e-50   
gb|EEE68452.1|  hypothetical protein OsJ_26836                          188   2e-50   
ref|XP_008426187.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_001836217.2|  atypical/PIKK/PI3K protein kinase                  187   2e-50   
ref|XP_007807160.1|  phosphoinositide 3-kinase                          189   2e-50   
ref|XP_006194593.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_008830713.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_010636317.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_003335193.2|  hypothetical protein PGTG_16800                    188   2e-50   
ref|XP_003447586.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_011359586.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_010784212.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
emb|CDO94060.1|  unnamed protein product                                187   2e-50   
ref|XP_004422541.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   2e-50   
ref|XP_005172338.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_007944631.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_007464232.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_004415359.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
gb|EHK18660.1|  hypothetical protein TRIVIDRAFT_43914                   187   3e-50   
ref|XP_010746556.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_005697026.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_004683925.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_004283587.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_010784211.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_006938926.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_007895390.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_008071343.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_010636316.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_010746558.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_007060508.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
dbj|BAG60721.1|  unnamed protein product                                186   3e-50   
ref|XP_009093618.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_010816989.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_007233850.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_005612914.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_003315924.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_002828228.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_002609836.1|  hypothetical protein BRAFLDRAFT_280369             187   3e-50   
ref|XP_004878608.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    187   3e-50   
ref|XP_011615112.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_004855306.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_011615113.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_004574230.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_011930097.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_011770153.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
gb|EHK47352.1|  hypothetical protein TRIATDRAFT_157648                  187   3e-50   
ref|XP_006136852.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_007233847.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_007233849.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_002800970.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_009914708.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_005750513.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   3e-50   
ref|XP_006971484.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_008830712.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_011807975.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   3e-50   
ref|XP_010357093.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_009664447.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_006194592.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   4e-50   
ref|XP_003759608.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_010224059.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_008321707.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   4e-50   
ref|XP_010956662.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    187   4e-50   
ref|XP_008321701.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_005750512.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   4e-50   
ref|XP_008689623.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   4e-50   
ref|XP_006136851.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_008641243.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_011930094.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_005586880.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_011436592.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    187   4e-50   
ref|XP_009190905.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    186   4e-50   
ref|NP_001274089.1|  phosphatidylinositol 3-kinase catalytic subu...    186   4e-50   
ref|XP_004283586.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_010564387.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_007944630.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_005296240.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
gb|EMS21211.1|  phosphoinositide 3-kinase                               187   4e-50   
ref|XP_005896412.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    186   4e-50   
ref|XP_004683924.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_004415358.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   4e-50   
ref|XP_008259471.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_007172845.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_004020459.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_003995198.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_006144457.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_006766174.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    186   5e-50   
ref|XP_004752293.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_008071342.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|NP_852079.2|  phosphatidylinositol 3-kinase catalytic subunit...    186   5e-50   
ref|XP_005612913.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_008830711.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_005976634.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_006136850.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_001082892.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_003784781.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
tpg|DAA15981.1|  TPA: phosphatidylinositol 3-kinase catalytic sub...    186   5e-50   
ref|XP_011597370.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_007464231.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_004422540.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_005489733.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_006273967.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|NP_001092537.1|  phosphatidylinositol 3-kinase catalytic subu...    186   5e-50   
ref|XP_010973791.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    186   5e-50   
ref|XP_011485883.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|NP_001012974.1|  phosphatidylinositol 3-kinase catalytic subu...    186   5e-50   
ref|XP_010564384.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_011807974.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_007607016.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_011359580.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_007646590.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_006022548.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   5e-50   
ref|XP_009329812.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_010357092.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_005500462.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|NP_075247.1|  phosphatidylinositol 3-kinase catalytic subunit...    186   6e-50   
ref|XP_009279455.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_006920160.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_005355906.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_011597371.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_006144458.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_005528154.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_009093617.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_008641242.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_002186929.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_010406569.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_006254550.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|XP_002828227.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   6e-50   
ref|NP_002638.2|  phosphatidylinositol 3-kinase catalytic subunit...    186   6e-50   
ref|XP_007081865.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    186   6e-50   
ref|XP_005879397.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_002757241.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_003784780.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
gb|AAX43278.1|  phosphoinositide-3-kinase class 3                       186   7e-50   
ref|XP_001497818.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_007972370.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_008926902.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_007486788.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_010564386.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   7e-50   
ref|XP_005425042.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   8e-50   
ref|XP_010564385.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   8e-50   
emb|CCF40701.1|  phosphatidylinositol 3                                 185   8e-50   
ref|XP_011597368.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   8e-50   
emb|CCE27030.1|  probable 1-phosphatidylinositol 3-kinase               186   8e-50   
ref|XP_005489732.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   8e-50   
ref|XP_010564383.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   8e-50   
ref|XP_011230331.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   9e-50   
ref|XP_010585413.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   9e-50   
ref|XP_010885975.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   9e-50   
gb|EMG45516.1|  Phosphatidylinositol 3-kinase VPS34                     187   9e-50   
ref|XP_003267603.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    186   9e-50   
ref|XP_003642950.2|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   9e-50   
ref|XP_010564382.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   9e-50   
gb|KDN72386.1|  putative phosphatidylinositol 3                         186   9e-50   
ref|XP_005060392.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   1e-49   
ref|XP_010885974.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   1e-49   
ref|XP_002549919.1|  phosphatidylinositol 3-kinase VPS34                186   1e-49   
ref|XP_002935097.2|  PREDICTED: phosphatidylinositol 3-kinase cat...    185   1e-49   
ref|XP_007972369.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    186   1e-49   
ref|XP_003474048.2|  PREDICTED: phosphatidylinositol 3-kinase cat...    185   1e-49   
gb|EWZ39720.1|  phosphatidylinositol 3-kinase                           184   1e-49   
ref|XP_007590779.1|  phosphatidylinositol 3                             185   1e-49   
ref|XP_001528084.1|  phosphatidylinositol 3-kinase VPS34                186   1e-49   
gb|EWY88765.1|  phosphatidylinositol 3-kinase                           184   2e-49   
dbj|BAO41229.1|  phosphatidylinositol 3-kinase VPS34                    185   2e-49   
gb|EXL88632.1|  phosphatidylinositol 3-kinase                           184   2e-49   
ref|XP_007342219.1|  phosphatidylinositol 3-kinase                      184   2e-49   
ref|XP_005372904.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    185   2e-49   
ref|NP_001086836.1|  phosphatidylinositol 3-kinase catalytic subu...    185   2e-49   
emb|CCX16633.1|  Similar to Phosphatidylinositol 3-kinase vps34; ...    184   2e-49   
emb|CAA87094.1|  phosphatidylinositol 3-kinase                          185   2e-49   
ref|XP_004202798.1|  Piso0_001659                                       186   2e-49   
gb|EDK40259.2|  hypothetical protein PGUG_04357                         185   3e-49   
gb|KDR78928.1|  hypothetical protein GALMADRAFT_1365700                 184   3e-49   
ref|XP_006085211.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    184   3e-49   
emb|CCA75314.1|  related to phosphatidylinositol 3-kinase               184   3e-49   
gb|EUD73261.1|  phosphatidylinositol 3-kinase                           186   3e-49   



>ref|XP_004236633.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Solanum 
lycopersicum]
Length=815

 Score =   313 bits (803),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>ref|XP_006350224.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Solanum 
tuberosum]
Length=815

 Score =   313 bits (803),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>gb|EPS66358.1| phosphoinositide 3-kinase, partial [Genlisea aurea]
Length=529

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL+DDGR+FHVDFGFILG+DPKPFPPPMKLCK
Sbjct  365  LETFIKSCAGYSVITYILGIGDRHLDNLLLQDDGRIFHVDFGFILGRDPKPFPPPMKLCK  424

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPD+ASDPEKGILK
Sbjct  425  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDVASDPEKGILK  484

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRL+LDDEE I FFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  485  LQEKFRLELDDEESIQFFQDLINESVSALFPQMVETIHRWAQYWR  529



>ref|XP_009802381.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Nicotiana 
sylvestris]
Length=815

 Score =   313 bits (803),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>gb|AAW80628.1| phosphoinositide 3-kinase [Nicotiana tabacum]
Length=814

 Score =   313 bits (802),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_009605436.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Nicotiana 
tomentosiformis]
Length=815

 Score =   313 bits (802),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>ref|XP_004489832.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X3 [Cicer arietinum]
Length=667

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  503  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGSLFHVDFGFILGRDPKPFPPPMKLCK  562

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  563  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  622

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  623  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  667



>ref|XP_010269376.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X4 [Nelumbo nucifera]
Length=691

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  527  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  586

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA DPEKGILK
Sbjct  587  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIAFDPEKGILK  646

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE+CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  647  LQEKFRLDLDDEDCIHFFQDLINESVSALFPQMVETIHRWAQYWR  691



>gb|AAL86326.1| putative phosphatidylinositol 3-kinase [Arabidopsis thaliana]
Length=499

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  335  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  394

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  395  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  454

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  455  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  499



>gb|KJB15579.1| hypothetical protein B456_002G185300 [Gossypium raimondii]
 gb|KJB15580.1| hypothetical protein B456_002G185300 [Gossypium raimondii]
 gb|KJB15581.1| hypothetical protein B456_002G185300 [Gossypium raimondii]
Length=814

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/165 (99%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>gb|KDO82393.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=740

 Score =   310 bits (794),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFG+ILG+DPKPFPPPMKLCK
Sbjct  576  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGYILGRDPKPFPPPMKLCK  635

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  636  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  695

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  696  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  740



>dbj|BAD94035.1| phosphatidylinositol 3-kinase [Arabidopsis thaliana]
Length=367

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVIT+ILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  203  LDTFIKSCAGYSVITHILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  262

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  263  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  322

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQ LINESVSALFPQMVETIHRWAQYWR
Sbjct  323  LQEKFRLDMDDEACIHFFQGLINESVSALFPQMVETIHRWAQYWR  367



>ref|XP_010940073.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Elaeis guineensis]
Length=756

 Score =   309 bits (792),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  586  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  645

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  646  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  705

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE+ IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  706  EKGILKLQEKFRLDLDDEDSIHFFQDLINESVSALFPQMVETIHRWAQYWR  756



>ref|XP_011100557.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Sesamum 
indicum]
Length=815

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL+DDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLQDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEE IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEESIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>ref|XP_010936705.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010936706.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Elaeis guineensis]
Length=813

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  643  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  702

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  703  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  762

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE+ IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  763  EKGILKLQEKFRLDLDDEDSIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_010936707.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Elaeis guineensis]
Length=811

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  641  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  700

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  701  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  760

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE+ IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  761  EKGILKLQEKFRLDLDDEDSIHFFQDLINESVSALFPQMVETIHRWAQYWR  811



>ref|XP_008221836.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Prunus 
mume]
Length=816

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  652  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  711

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  712  EMVEAMGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  771

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  772  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  816



>gb|KCW84834.1| hypothetical protein EUGRSUZ_B016662, partial [Eucalyptus grandis]
 gb|KCW84835.1| hypothetical protein EUGRSUZ_B016662, partial [Eucalyptus grandis]
Length=194

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  30   LDTFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  89

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ESQYYTRFK+YCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG+LK
Sbjct  90   EMVEAMGGTESQYYTRFKTYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGMLK  149

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKF LDLDDE CIHFFQ LI +SV+ALFPQMVETIHRWAQYWR
Sbjct  150  LQEKFNLDLDDEACIHFFQGLITDSVNALFPQMVETIHRWAQYWR  194



>gb|KDO82391.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=805

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFG+ILG+DPKPFPPPMKLCK
Sbjct  641  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGYILGRDPKPFPPPMKLCK  700

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  701  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  760

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  761  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  805



>gb|KDO82389.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=818

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFG+ILG+DPKPFPPPMKLCK
Sbjct  654  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGYILGRDPKPFPPPMKLCK  713

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  714  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  773

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  774  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  818



>ref|XP_010269375.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X3 [Nelumbo nucifera]
Length=814

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA DPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIAFDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE+CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEDCIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_006438361.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 ref|XP_006438363.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51601.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51603.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
Length=818

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFG+ILG+DPKPFPPPMKLCK
Sbjct  654  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGYILGRDPKPFPPPMKLCK  713

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  714  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  773

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  774  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  818



>ref|XP_004297475.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Fragaria 
vesca subsp. vesca]
Length=816

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITY+LGIGDRHLDNLLLRDDG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  652  LETFIKSCAGYSVITYVLGIGDRHLDNLLLRDDGSLFHVDFGFILGRDPKPFPPPMKLCK  711

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  712  EMVEAMGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  771

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  772  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  816



>ref|XP_008389664.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Malus 
domestica]
Length=816

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  652  LETFIKSCAGYSVITYILGIGDRHLDNLLLVDDGRLFHVDFGFILGRDPKPFPPPMKLCK  711

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  712  EMVEAMGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  771

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  772  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  816



>ref|XP_010940071.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Elaeis guineensis]
Length=813

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/171 (95%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  643  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  702

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  703  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  762

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE+ IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  763  EKGILKLQEKFRLDLDDEDSIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_007044676.1| Vacuolar protein sorting 34 isoform 1 [Theobroma cacao]
 gb|EOY00508.1| Vacuolar protein sorting 34 isoform 1 [Theobroma cacao]
Length=814

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA DPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIACDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_007227349.1| hypothetical protein PRUPE_ppa001353mg [Prunus persica]
 gb|EMJ28548.1| hypothetical protein PRUPE_ppa001353mg [Prunus persica]
Length=846

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  682  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  741

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  742  EMVEAMGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  801

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  802  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  846



>ref|XP_003613218.1| Phosphatidylinositol 3-kinase [Medicago truncatula]
 emb|CAD56881.1| phosphatidylinositol 3-kinase [Medicago truncatula]
 gb|AES96176.1| phosphatidylinositol 3-kinase [Medicago truncatula]
Length=808

 Score =   309 bits (792),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +  + LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDG LFHVDFGFILG+DPKPFPP
Sbjct  638  GITANCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGSLFHVDFGFILGRDPKPFPP  697

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDP
Sbjct  698  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDP  757

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  758  EKGILKLQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  808



>ref|XP_004142979.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Cucumis 
sativus]
 gb|KGN62291.1| hypothetical protein Csa_2G348290 [Cucumis sativus]
Length=814

 Score =   309 bits (791),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGKDPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGKDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQ LINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEACVHFFQGLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_004489830.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489831.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Cicer arietinum]
Length=812

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  648  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGSLFHVDFGFILGRDPKPFPPPMKLCK  707

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  708  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  767

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  768  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  812



>ref|XP_010269370.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269372.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269373.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Nelumbo nucifera]
Length=856

 Score =   310 bits (793),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  692  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  751

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA DPEKGILK
Sbjct  752  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIAFDPEKGILK  811

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE+CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  812  LQEKFRLDLDDEDCIHFFQDLINESVSALFPQMVETIHRWAQYWR  856



>ref|XP_010269374.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Nelumbo nucifera]
Length=855

 Score =   310 bits (793),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  691  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  750

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA DPEKGILK
Sbjct  751  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIAFDPEKGILK  810

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE+CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  811  LQEKFRLDLDDEDCIHFFQDLINESVSALFPQMVETIHRWAQYWR  855



>ref|XP_010100445.1| Phosphatidylinositol 3-kinase, root isoform [Morus notabilis]
 gb|EXB82579.1| Phosphatidylinositol 3-kinase, root isoform [Morus notabilis]
Length=810

 Score =   308 bits (790),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  646  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  705

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  706  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  765

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  766  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  810



>ref|XP_006483879.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform-like 
isoform X1 [Citrus sinensis]
 ref|XP_006483880.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   308 bits (790),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 164/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFG+ILG+DPKPFPPPMKLCK
Sbjct  654  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGYILGRDPKPFPPPMKLCK  713

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGA+SQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  714  EMVEAMGGADSQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  773

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  774  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  818



>ref|XP_008782484.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782485.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Phoenix dactylifera]
Length=813

 Score =   308 bits (789),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 161/171 (94%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  643  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  702

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  703  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  762

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE+ IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  763  EKGILKLQEKFRLDLDDEDSIHFFQDLINDSVSALFPQMVETIHRWAQYWR  813



>ref|XP_008444332.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Cucumis 
melo]
Length=867

 Score =   309 bits (792),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 163/165 (99%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGKDPKPFPPPMKLCK
Sbjct  703  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGKDPKPFPPPMKLCK  762

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  763  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  822

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQ LINESVSALFPQMVETIHRWAQYWR
Sbjct  823  LQEKFRLDLDDEACIHFFQGLINESVSALFPQMVETIHRWAQYWR  867



>emb|CDP13176.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   308 bits (789),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 162/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRL HVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLLHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA DPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIACDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>ref|XP_010417983.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X2 [Camelina 
sativa]
Length=730

 Score =   306 bits (783),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  566  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  625

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  626  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  685

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  686  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  730



>ref|XP_010510945.1| PREDICTED: phosphatidylinositol 3-kinase VPS34-like isoform X2 
[Camelina sativa]
Length=708

 Score =   305 bits (782),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  544  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  603

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  604  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  663

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  664  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  708



>ref|XP_008795927.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Phoenix dactylifera]
Length=767

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  597  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  656

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  657  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  716

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKF+LDLDDE+ IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  717  EKGILKLQEKFQLDLDDEDSIHFFQDLINDSVSALFPQMVETIHRWAQYWR  767



>gb|EYU42801.1| hypothetical protein MIMGU_mgv1a001464mg [Erythranthe guttata]
Length=815

 Score =   307 bits (786),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL+DDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LDTFIKSCAGYSVITYILGIGDRHLDNLLLQDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEE I FFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEESIQFFQDLINESVSALFPQMVETIHRWAQYWR  815



>ref|XP_008795925.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008795926.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Phoenix dactylifera]
Length=813

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/171 (94%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPP
Sbjct  643  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPP  702

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  703  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  762

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKF+LDLDDE+ IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  763  EKGILKLQEKFQLDLDDEDSIHFFQDLINDSVSALFPQMVETIHRWAQYWR  813



>ref|XP_008340052.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Malus 
domestica]
Length=816

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  652  LETFIKSCAGYSVITYILGIGDRHLDNLLLVDDGRLFHVDFGFILGRDPKPFPPPMKLCK  711

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  712  EMVEAMGGAESQYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  771

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  772  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  816



>gb|KFK40782.1| hypothetical protein AALP_AA2G040200 [Arabis alpina]
Length=813

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_010651488.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Vitis vinifera]
 emb|CBI28550.3| unnamed protein product [Vitis vinifera]
Length=815

 Score =   306 bits (785),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESPYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKF+LDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFKLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  815



>ref|XP_006392160.1| hypothetical protein EUTSA_v10023282mg [Eutrema salsugineum]
 gb|ESQ29446.1| hypothetical protein EUTSA_v10023282mg [Eutrema salsugineum]
Length=813

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL +DGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLTEDGRLFHVDFGFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>emb|CDY44616.1| BnaCnng11650D [Brassica napus]
Length=206

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYIL IGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  42   LDTFIKSCAGYSVITYILWIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  101

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EM+EAMGGA+SQYYTRFKSYCCEAYNILRK SNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  102  EMLEAMGGADSQYYTRFKSYCCEAYNILRKPSNLILNLFYLMAGSTIPDIASDPEKGILK  161

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYW  298
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYW
Sbjct  162  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYW  205



>ref|XP_002267769.2| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Vitis vinifera]
 ref|XP_010651480.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Vitis vinifera]
Length=818

 Score =   306 bits (784),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/165 (98%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  654  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  713

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  714  EMVEAMGGAESPYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  773

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKF+LDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  774  LQEKFKLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  818



>emb|CCD74511.1| phosphatidylinositol 3-kinase, partial [Arabidopsis halleri subsp. 
halleri]
Length=775

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  611  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  670

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  671  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  730

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  731  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  775



>ref|XP_012085401.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Jatropha curcas]
 gb|KDP26603.1| hypothetical protein JCGZ_17761 [Jatropha curcas]
Length=809

 Score =   306 bits (783),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  645  LETFIKSCAGYSVITYILGIGDRHLDNLLLREDGRLFHVDFGFILGRDPKPFPPPMKLCK  704

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEK ILK
Sbjct  705  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKSILK  764

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  765  LQEKFRLDLDDEAAIHFFQDLINESVSALFPQMVETIHRWAQYWR  809



>ref|XP_012085402.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X3 [Jatropha curcas]
Length=808

 Score =   306 bits (783),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  644  LETFIKSCAGYSVITYILGIGDRHLDNLLLREDGRLFHVDFGFILGRDPKPFPPPMKLCK  703

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEK ILK
Sbjct  704  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKSILK  763

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  764  LQEKFRLDLDDEAAIHFFQDLINESVSALFPQMVETIHRWAQYWR  808



>ref|XP_012085400.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Jatropha curcas]
Length=814

 Score =   306 bits (783),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLREDGRLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEK ILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKSILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEAAIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>gb|ABA03135.1| phosphatidylinositol 3-kinase 1 [Phaseolus vulgaris]
Length=811

 Score =   306 bits (783),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  647  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  706

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  707  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  766

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  767  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  811



>ref|XP_006580982.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform isoform 
X3 [Glycine max]
Length=806

 Score =   305 bits (782),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  642  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  701

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  702  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  761

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  762  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  806



>ref|XP_006580980.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform isoform 
X1 [Glycine max]
 ref|XP_006580981.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform isoform 
X2 [Glycine max]
 gb|KHN08996.1| Phosphatidylinositol 3-kinase, nodule isoform [Glycine soja]
Length=812

 Score =   306 bits (783),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  648  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  707

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  708  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  767

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  768  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  812



>ref|NP_001236955.1| phosphatidylinositol 3-kinase, root isoform [Glycine max]
 sp|P42347.1|PI3K1_SOYBN RecName: Full=Phosphatidylinositol 3-kinase, root isoform; Short=PI3-kinase; 
Short=PI3K; Short=PtdIns-3-kinase; AltName: 
Full=SPI3K-5 [Glycine max]
 gb|AAA83995.1| phosphatidylinositol 3-kinase [Glycine max]
Length=814

 Score =   306 bits (783),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_007157437.1| hypothetical protein PHAVU_002G070100g [Phaseolus vulgaris]
 gb|ESW29431.1| hypothetical protein PHAVU_002G070100g [Phaseolus vulgaris]
Length=811

 Score =   305 bits (782),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  647  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  706

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  707  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  766

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  767  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  811



>ref|XP_010533950.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X1 [Tarenaya 
hassleriana]
Length=813

 Score =   305 bits (782),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LDTFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_010553608.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 [Tarenaya hassleriana]
Length=810

 Score =   305 bits (782),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  646  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  705

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  706  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  765

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDL+DE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  766  LQEKFRLDLEDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  810



>gb|KHN08268.1| Phosphatidylinositol 3-kinase, root isoform [Glycine soja]
Length=814

 Score =   305 bits (782),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 159/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  650  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_010533951.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X2 [Tarenaya 
hassleriana]
Length=811

 Score =   305 bits (782),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  647  LDTFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  706

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  707  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  766

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  767  LQEKFRLDLDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  811



>ref|XP_006301054.1| hypothetical protein CARUB_v10021447mg [Capsella rubella]
 gb|EOA33952.1| hypothetical protein CARUB_v10021447mg [Capsella rubella]
Length=813

 Score =   305 bits (781),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_010417982.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X1 [Camelina 
sativa]
Length=813

 Score =   305 bits (781),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_002525363.1| phosphatidylinositol 3-kinase class, putative [Ricinus communis]
 gb|EEF37001.1| phosphatidylinositol 3-kinase class, putative [Ricinus communis]
Length=813

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/165 (97%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIA+DPEK ILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIATDPEKSILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDLDDEAAIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_002886614.1| ATVPS34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62873.1| ATVPS34 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_010510944.1| PREDICTED: phosphatidylinositol 3-kinase VPS34-like isoform X1 
[Camelina sativa]
Length=813

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|NP_176251.1| phosphatidylinositol 3-kinase VPS34 [Arabidopsis thaliana]
 sp|P42339.2|PI3K_ARATH RecName: Full=Phosphatidylinositol 3-kinase VPS34; AltName: Full=PI3-kinase 
VPS34; Short=AtVPS34; Short=PI3K VPS34; AltName: 
Full=PtdIns-3-kinase VSP34 [Arabidopsis thaliana]
 gb|AAB71971.1| Phosphatidylinositol 3-kinase [Arabidopsis thaliana]
 gb|AAN41278.1| putative phosphatidylinositol 3-kinase [Arabidopsis thaliana]
 gb|AEE33693.1| phosphatidylinositol 3-kinase VPS34 [Arabidopsis thaliana]
Length=814

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  650  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>gb|AAA83427.1| phosphatidylinositol 3-kinase [Arabidopsis thaliana]
Length=814

 Score =   305 bits (780),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  650  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  709

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  710  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  769

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  770  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_010040873.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Eucalyptus 
grandis]
Length=500

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  336  LDTFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  395

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ESQYYTRFK+YCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG+LK
Sbjct  396  EMVEAMGGTESQYYTRFKTYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGMLK  455

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKF LDLDDE CIHFFQ LI +SV+ALFPQMVETIHRWAQYWR
Sbjct  456  LQEKFNLDLDDEACIHFFQGLITDSVNALFPQMVETIHRWAQYWR  500



>emb|CDY47220.1| BnaC09g14690D [Brassica napus]
Length=813

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_009113206.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X3 [Brassica 
rapa]
Length=807

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  643  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  702

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  703  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  762

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  763  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  807



>ref|XP_009113205.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X2 [Brassica 
rapa]
Length=812

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  648  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  707

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  708  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  767

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  768  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  812



>gb|ABA03136.1| phosphatidylinositol 3-kinase 1 [Phaseolus vulgaris]
Length=811

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  647  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  706

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGSNIPDI SDPEKGILK
Sbjct  707  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSNIPDIVSDPEKGILK  766

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  767  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  811



>ref|XP_009113204.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X1 [Brassica 
rapa]
Length=813

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>emb|CDY53049.1| BnaA09g14140D [Brassica napus]
Length=813

 Score =   304 bits (779),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>gb|AAN62481.1| phosphatidylinositol 3-kinase [Brassica napus]
Length=813

 Score =   304 bits (778),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  649  LETFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLF+LMAGS IPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFYLMAGSTIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_009409808.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Musa 
acuminata subsp. malaccensis]
Length=811

 Score =   303 bits (777),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/171 (93%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDF FILG+DPKPFPP
Sbjct  641  GITAQCLETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFAFILGRDPKPFPP  700

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP
Sbjct  701  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  760

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EKGILKLQEKFRLDLDDE+ IHFFQDLI +SVSALFPQMVETIHRWAQYWR
Sbjct  761  EKGILKLQEKFRLDLDDEDAIHFFQDLITDSVSALFPQMVETIHRWAQYWR  811



>ref|XP_010474549.1| PREDICTED: phosphatidylinositol 3-kinase VPS34-like [Camelina 
sativa]
Length=922

 Score =   305 bits (782),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  758  LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  817

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDPEKGILK
Sbjct  818  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDPEKGILK  877

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  878  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  922



>ref|NP_001242315.1| phosphatidylinositol 3-kinase, nodule isoform [Glycine max]
 sp|P42348.1|PI3K2_SOYBN RecName: Full=Phosphatidylinositol 3-kinase, nodule isoform; 
Short=PI3-kinase; Short=PI3K; Short=PtdIns-3-kinase; AltName: 
Full=SPI3K-1 [Glycine max]
 gb|AAA64468.1| phosphatidylinositol 3-kinase [Glycine max]
Length=812

 Score =   303 bits (776),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  648  LETFIKSCAGYSVITYILGIGDRHLDNLLLRNDGGLFHVDFGFILGRDPKPFPPPMKLCK  707

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAY+ILRKSSNLILNLF+LMAGSNIPDIASDPEKGILK
Sbjct  708  EMVEAMGGAESQYYTRFKSYCCEAYHILRKSSNLILNLFYLMAGSNIPDIASDPEKGILK  767

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  768  LQEKFRLDLDDEASIHFFQDLINESVSALFPQMVETIHRWAQYWR  812



>ref|XP_002318628.1| phosphatidylinositol 3-kinase family protein [Populus trichocarpa]
 gb|EEE96848.1| phosphatidylinositol 3-kinase family protein [Populus trichocarpa]
Length=810

 Score =   302 bits (773),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILG+GDRHLDNLLL +DGRLFHVDFGFILG+DPK FPPPMKLCK
Sbjct  646  LETFIKSCAGYSVITYILGVGDRHLDNLLLTEDGRLFHVDFGFILGRDPKHFPPPMKLCK  705

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  706  EMVEAMGGAESPYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  765

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  766  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  810



>ref|XP_011042652.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Populus 
euphratica]
 ref|XP_011042653.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Populus 
euphratica]
Length=810

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/165 (95%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDFGFILG+DPK FPPPMKLCK
Sbjct  646  LETFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFGFILGRDPKHFPPPMKLCK  705

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEAYNI+RKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  706  EMVEAMGGAESPYYTRFKSYCCEAYNIIRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  765

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLD+DDE CIHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  766  LQEKFRLDMDDEACIHFFQDLINESVSALFPQMVETIHRWAQYWR  810



>ref|XP_010682535.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=812

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILG+GDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  648  LETFIKSCAGYSVITYILGVGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  707

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEA+NILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  708  EMVEAMGGAESLYYTRFKSYCCEAFNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  767

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  768  LQEKFRLDLDDEASIHFFQDLINDSVSALFPQMVETIHRWAQYWR  812



>ref|XP_010682534.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=815

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILG+GDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  651  LETFIKSCAGYSVITYILGVGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  710

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEA+NILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  711  EMVEAMGGAESLYYTRFKSYCCEAFNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  770

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  771  LQEKFRLDLDDEASIHFFQDLINDSVSALFPQMVETIHRWAQYWR  815



>ref|XP_011625137.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Amborella 
trichopoda]
 ref|XP_011625138.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Amborella 
trichopoda]
 ref|XP_011625139.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Amborella 
trichopoda]
Length=807

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DGRLFHVDF +ILG+DPKPFPPPMKLCK
Sbjct  643  LETFIKSCAGYSVITYILGIGDRHLDNLLLREDGRLFHVDFAYILGRDPKPFPPPMKLCK  702

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  703  EMVEAMGGAESPYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  762

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  +HFFQ++IN+SVSALFPQMVETIHRWAQYWR
Sbjct  763  LQEKFRLDLDDEASVHFFQEVINDSVSALFPQMVETIHRWAQYWR  807



>ref|XP_010023534.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Eucalyptus 
grandis]
 gb|KCW59826.1| hypothetical protein EUGRSUZ_H02571 [Eucalyptus grandis]
Length=817

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  653  LDTFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  712

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ESQYYTRFK+YCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  713  EMVEAMGGTESQYYTRFKTYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  772

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKF LDLDDE CIHFFQ LI +SV+ALFPQMVETIHRWAQYWR
Sbjct  773  LQEKFNLDLDDEACIHFFQGLITDSVNALFPQMVETIHRWAQYWR  817



>gb|ERN10666.1| hypothetical protein AMTR_s00028p00234070 [Amborella trichopoda]
Length=833

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLR+DGRLFHVDF +ILG+DPKPFPPPMKLCK
Sbjct  669  LETFIKSCAGYSVITYILGIGDRHLDNLLLREDGRLFHVDFAYILGRDPKPFPPPMKLCK  728

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES YYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  729  EMVEAMGGAESPYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  788

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE  +HFFQ++IN+SVSALFPQMVETIHRWAQYWR
Sbjct  789  LQEKFRLDLDDEASVHFFQEVINDSVSALFPQMVETIHRWAQYWR  833



>gb|KCW84845.1| hypothetical protein EUGRSUZ_B01668 [Eucalyptus grandis]
 gb|KCW84846.1| hypothetical protein EUGRSUZ_B01668 [Eucalyptus grandis]
Length=801

 Score =   295 bits (756),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  637  LDTFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  696

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ESQYYTRFK+YCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG+LK
Sbjct  697  EMVEAMGGTESQYYTRFKTYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGMLK  756

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKF LDLDDE CIHFFQ LI +SV+ALFPQMVETIHRWAQYWR
Sbjct  757  LQEKFSLDLDDEACIHFFQGLITDSVNALFPQMVETIHRWAQYWR  801



>gb|AFW62055.1| hypothetical protein ZEAMMB73_811721 [Zea mays]
Length=369

 Score =   281 bits (719),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDF FILG+DPKPFPP
Sbjct  200  GITAQCLETFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPP  259

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSS+LILNLF LM  S IPDI++D 
Sbjct  260  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSSLILNLFKLMERSGIPDISAD-  318

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E G LKLQEKFRLDLDDEE IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  319  ESGGLKLQEKFRLDLDDEEAIHFFQDLINDSVSALFPQMVETIHRWAQYWR  369



>ref|XP_006438362.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51602.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
Length=813

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 159/165 (96%), Gaps = 5/165 (3%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFG+ILG+DPKPFPPPMKLCK
Sbjct  654  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGYILGRDPKPFPPPMKLCK  713

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAE     RFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  714  EMVEAMGGAE-----RFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  813



>ref|XP_001762959.1| predicted protein [Physcomitrella patens]
 gb|EDQ72164.1| predicted protein [Physcomitrella patens]
Length=813

 Score =   287 bits (735),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETF+KSCAGY VI YILGIGDRHLDNLLL +DGRLFH+DFGFILG+DPKPFPPPMKLCK
Sbjct  649  LETFVKSCAGYCVIMYILGIGDRHLDNLLLCEDGRLFHIDFGFILGRDPKPFPPPMKLCK  708

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAES +Y+RFK+YCCEAYNILRKSSNLILNLF+LMAG+NIPDIASDPEKGILK
Sbjct  709  EMVEAMGGAESPHYSRFKTYCCEAYNILRKSSNLILNLFYLMAGANIPDIASDPEKGILK  768

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEE + FFQ LIN+SVSALFPQMVETIHRWAQYWR
Sbjct  769  LQEKFRLDLDDEEAVQFFQSLINDSVSALFPQMVETIHRWAQYWR  813



>ref|XP_006654109.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Oryza brachyantha]
Length=770

 Score =   281 bits (720),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYI+G+GDRHLDNLLL DDGRLFHVDF FILGKDPKPFPPPMKLCK
Sbjct  607  LETFIKSCAGYSVITYIMGVGDRHLDNLLLTDDGRLFHVDFAFILGKDPKPFPPPMKLCK  666

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSS+LILNLF+LM  SNIPDI S+   G LK
Sbjct  667  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSSLILNLFNLMRRSNIPDITSEENAG-LK  725

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE+ IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  726  LQEKFRLDLDDEDAIHFFQDLINESVSALFPQMVETIHRWAQYWR  770



>ref|XP_004973055.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Setaria italica]
Length=803

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDF FILG+DPKPFPP
Sbjct  634  GITAQCLETFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPP  693

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSS+LILNLF LM  S IPDI++D 
Sbjct  694  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSSLILNLFKLMERSGIPDISAD-  752

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E G LKLQEKFRLDLDDEE IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  753  ESGGLKLQEKFRLDLDDEEAIHFFQDLINESVSALFPQMVETIHRWAQYWR  803



>ref|XP_004973056.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Setaria italica]
Length=805

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDF FILG+DPKPFPP
Sbjct  636  GITAQCLETFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPP  695

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSS+LILNLF LM  S IPDI++D 
Sbjct  696  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSSLILNLFKLMERSGIPDISAD-  754

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E G LKLQEKFRLDLDDEE IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  755  ESGGLKLQEKFRLDLDDEEAIHFFQDLINESVSALFPQMVETIHRWAQYWR  805



>ref|XP_008678534.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Zea mays]
 ref|XP_008678535.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Zea mays]
 gb|AFW62054.1| hypothetical protein ZEAMMB73_811721 [Zea mays]
Length=803

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYILG+GDRHLDNLLL DDGRLFHVDF FILG+DPKPFPP
Sbjct  634  GITAQCLETFIKSCAGYSVITYILGVGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPP  693

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSS+LILNLF LM  S IPDI++D 
Sbjct  694  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSSLILNLFKLMERSGIPDISAD-  752

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E G LKLQEKFRLDLDDEE IHFFQDLIN+SVSALFPQMVETIHRWAQYWR
Sbjct  753  ESGGLKLQEKFRLDLDDEEAIHFFQDLINDSVSALFPQMVETIHRWAQYWR  803



>ref|NP_001054810.1| Os05g0180600 [Oryza sativa Japonica Group]
 gb|AAW57810.1| putative phosphatidylinositol 3-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF16724.1| Os05g0180600 [Oryza sativa Japonica Group]
 gb|EEE62546.1| hypothetical protein OsJ_17344 [Oryza sativa Japonica Group]
Length=814

 Score =   279 bits (714),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYI+G+GDRHLDNLLL DDGRLFHVDF FILGKDPKPFPP
Sbjct  645  GITAQCLETFIKSCAGYSVITYIMGVGDRHLDNLLLTDDGRLFHVDFAFILGKDPKPFPP  704

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSS+LILNLF+LM  SNIPDI ++ 
Sbjct  705  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSSLILNLFNLMRRSNIPDITNEE  764

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
              G LKLQEKFRLDL+DEE IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  765  NAG-LKLQEKFRLDLEDEEAIHFFQDLINESVSALFPQMVETIHRWAQYWR  814



>ref|XP_002984319.1| hypothetical protein SELMODRAFT_268853 [Selaginella moellendorffii]
 gb|EFJ14829.1| hypothetical protein SELMODRAFT_268853 [Selaginella moellendorffii]
Length=785

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETF+KSCAGY VITYILG+GDRHLDNLLL+ DGRLFHVDFGFILG+D KPFPPPMKLCK
Sbjct  621  LETFVKSCAGYCVITYILGVGDRHLDNLLLQQDGRLFHVDFGFILGRDSKPFPPPMKLCK  680

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG +SQ+Y++FK YCCEAYNILRKSSNLILNL  LM+G+N+PDI+SDPEKG+LK
Sbjct  681  EMVEAMGGMDSQHYSKFKMYCCEAYNILRKSSNLILNLLFLMSGANLPDISSDPEKGVLK  740

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEE + FFQ LIN+SVSALFPQMVETIHRWAQYWR
Sbjct  741  LQEKFRLDLDDEEAVQFFQTLINDSVSALFPQMVETIHRWAQYWR  785



>ref|XP_002972489.1| hypothetical protein SELMODRAFT_97360 [Selaginella moellendorffii]
 gb|EFJ26575.1| hypothetical protein SELMODRAFT_97360 [Selaginella moellendorffii]
Length=803

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETF+KSCAGY VITYILG+GDRHLDNLLL+ DGRLFHVDFGFILG+D KPFPPPMKLCK
Sbjct  639  LETFVKSCAGYCVITYILGVGDRHLDNLLLQQDGRLFHVDFGFILGRDSKPFPPPMKLCK  698

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG +SQ+Y++FK YCCEAYNILRKSSNLILNL  LM+G+N+PDI+SDPEKG+LK
Sbjct  699  EMVEAMGGMDSQHYSKFKMYCCEAYNILRKSSNLILNLLFLMSGANLPDISSDPEKGVLK  758

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDEE + FFQ LIN+SVSALFPQMVETIHRWAQYWR
Sbjct  759  LQEKFRLDLDDEEAVQFFQTLINDSVSALFPQMVETIHRWAQYWR  803



>ref|XP_003566732.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Brachypodium 
distachyon]
Length=821

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYI+G+GDRHLDNLLLRDDG LFHVDF FILG+DPKPFPP
Sbjct  652  GITAQCLETFIKSCAGYSVITYIMGVGDRHLDNLLLRDDGCLFHVDFAFILGRDPKPFPP  711

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGG ESQYYTRFKSYCCEAYNILR +S+LILNLF LM  SNIPDI S+ 
Sbjct  712  PMKLCKEMVEAMGGTESQYYTRFKSYCCEAYNILRNNSSLILNLFKLMGRSNIPDI-SNE  770

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E G LKLQEKFRLDL+DEE IHFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  771  ENGSLKLQEKFRLDLNDEEAIHFFQDLINESVSALFPQMVETIHRWAQYWR  821



>dbj|BAJ91813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=826

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGYSVITYI+G+GDRHLDNLL+RDDG LFHVDFGFILG+DPKPFPP
Sbjct  657  GITAQCLETFIKSCAGYSVITYIMGVGDRHLDNLLIRDDGCLFHVDFGFILGRDPKPFPP  716

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGG ESQYYTRFKSYCCEAYNILR +S+LILNLF LM  S+IPDI++D 
Sbjct  717  PMKLCKEMVEAMGGTESQYYTRFKSYCCEAYNILRNNSSLILNLFTLMERSSIPDISTD-  775

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E   LK+QEKFRLDLDDEE IHFFQ LIN+SVSALFPQMVETIHRWAQYWR
Sbjct  776  ENATLKVQEKFRLDLDDEEAIHFFQGLINDSVSALFPQMVETIHRWAQYWR  826



>gb|EMS55477.1| Phosphatidylinositol 3-kinase, root isoform [Triticum urartu]
Length=838

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYI+G+GDRHLDNLL+RDDG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  675  LETFIKSCAGYSVITYIMGVGDRHLDNLLIRDDGCLFHVDFGFILGRDPKPFPPPMKLCK  734

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ESQYYTRFKSYCCEAYNILR +S+LILNLF LM  S+IPDI+++ E   LK
Sbjct  735  EMVEAMGGTESQYYTRFKSYCCEAYNILRNNSSLILNLFTLMERSSIPDISTE-ENATLK  793

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +QEKFRLDLDDEE IHFFQ LIN+SVSALFPQMVETIHRWAQYWR
Sbjct  794  VQEKFRLDLDDEEAIHFFQGLINDSVSALFPQMVETIHRWAQYWR  838



>gb|EMT32616.1| Phosphatidylinositol 3-kinase, root isoform [Aegilops tauschii]
Length=838

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYI+G+GDRHLDNLL+RDDG LFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  675  LETFIKSCAGYSVITYIMGVGDRHLDNLLIRDDGCLFHVDFGFILGRDPKPFPPPMKLCK  734

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ESQYYTRFKSYCCEAYNILR +S+LILNLF LM  S+IPDI+++ E   LK
Sbjct  735  EMVEAMGGTESQYYTRFKSYCCEAYNILRNNSSLILNLFTLMERSSIPDISTE-ENATLK  793

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +QEKFRLDLDDEE IHFFQ LIN+SVSALFPQMVETIHRWAQYWR
Sbjct  794  VQEKFRLDLDDEEAIHFFQGLINDSVSALFPQMVETIHRWAQYWR  838



>emb|CAN72914.1| hypothetical protein VITISV_034007 [Vitis vinifera]
Length=1586

 Score =   273 bits (697),  Expect = 3e-79, Method: Composition-based stats.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -1

Query  789   LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
             LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILG+DPKPFPPPMKLCK
Sbjct  1376  LETFIKSCAGYSVITYILGIGDRHLDNLLLRDDGRLFHVDFGFILGRDPKPFPPPMKLCK  1435

Query  609   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
             EMVEAMGGAES YYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  1436  EMVEAMGGAESPYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  1495

Query  429   LQEKFRLDLDDEECIHFFQDLINES  355
             LQEKF+LDLDDE CIHFFQDLINES
Sbjct  1496  LQEKFKLDLDDEACIHFFQDLINES  1520



>ref|XP_010234573.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Brachypodium distachyon]
Length=762

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDP---KPFPPPMK  619
            LE+F+KSCAGY VITYILGIGDRHLDNLLLRDDGRLFHVDF F+LG++P    P  PPMK
Sbjct  598  LESFVKSCAGYCVITYILGIGDRHLDNLLLRDDGRLFHVDFSFMLGEEPHRFAPSQPPMK  657

Query  618  LCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG  439
            LCKEMVEAMGG ESQYY RFKSYCCEAYNILRKSSNLILNLFHLM+GSNIP I    EKG
Sbjct  658  LCKEMVEAMGGVESQYYARFKSYCCEAYNILRKSSNLILNLFHLMSGSNIPSIT---EKG  714

Query  438  ILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            I KLQE FRLDL+DEE +HFFQ+LINES+SALFPQ+VETIHRW Q  R
Sbjct  715  IFKLQENFRLDLEDEEAVHFFQELINESISALFPQVVETIHRWVQSRR  762



>gb|ESA02209.1| hypothetical protein GLOINDRAFT_6733 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX72175.1| phosphatidylinositol 3-kinase VPS34 [Rhizophagus irregularis 
DAOM 197198w]
Length=836

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V++T++KSCAGY VITY+LG+GDRHLDNLLL  +G LFHVDFGFILG+DPKPFPP
Sbjct  665  GVSPAVMDTYVKSCAGYCVITYLLGVGDRHLDNLLLSPEGNLFHVDFGFILGRDPKPFPP  724

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGA S +Y RFKSYC  A+NILRKS+NLILNLF LM  +NIPDI  +P
Sbjct  725  PMKLCKEMVEAMGGANSIHYQRFKSYCYIAFNILRKSANLILNLFALMVYANIPDIKIEP  784

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K+QEKFRLDL +EE I +FQ+LIN+SVSALFPQ++ETIH+WAQYWR
Sbjct  785  DKAVWKVQEKFRLDLTEEEAIKYFQNLINDSVSALFPQVIETIHKWAQYWR  835



>ref|XP_003571627.2| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Brachypodium distachyon]
Length=819

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDP---KPFPPPMK  619
            LE+F+KSCAGY VITYILGIGDRHLDNLLLRDDGRLFHVDF F+LG++P    P  PPMK
Sbjct  655  LESFVKSCAGYCVITYILGIGDRHLDNLLLRDDGRLFHVDFSFMLGEEPHRFAPSQPPMK  714

Query  618  LCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG  439
            LCKEMVEAMGG ESQYY RFKSYCCEAYNILRKSSNLILNLFHLM+GSNIP I    EKG
Sbjct  715  LCKEMVEAMGGVESQYYARFKSYCCEAYNILRKSSNLILNLFHLMSGSNIPSIT---EKG  771

Query  438  ILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            I KLQE FRLDL+DEE +HFFQ+LINES+SALFPQ+VETIHRW Q  R
Sbjct  772  IFKLQENFRLDLEDEEAVHFFQELINESISALFPQVVETIHRWVQSRR  819



>ref|XP_001689631.1| VPS34-like PI-3-kinase [Chlamydomonas reinhardtii]
 gb|EDP09369.1| VPS34-like PI-3-kinase [Chlamydomonas reinhardtii]
Length=1098

 Score =   245 bits (625),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 120/171 (70%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807   ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
              L    +ETF++SCAGY V+TYILG+GDRHLDNL+L  DGRLFH+DFG+ILG DPKPFPP
Sbjct  928   GLRAEAVETFVRSCAGYCVMTYILGVGDRHLDNLMLTHDGRLFHIDFGYILGADPKPFPP  987

Query  627   PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             PMKLCKEM+EAMGG  S+YY +F+ Y CEAYNILRK ++LIL+LFHLMAG++I  I +DP
Sbjct  988   PMKLCKEMIEAMGGQGSEYYKQFRMYACEAYNILRKRADLILSLFHLMAGASIEAIRADP  1047

Query  447   EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             EK ILKLQ+KFRLD DDE  + + Q LINES +AL PQ+VET HRWAQYWR
Sbjct  1048  EKAILKLQDKFRLDFDDEAAVEWMQGLINESATALLPQLVETTHRWAQYWR  1098



>ref|XP_002954001.1| hypothetical protein VOLCADRAFT_40672 [Volvox carteri f. nagariensis]
 gb|EFJ45030.1| hypothetical protein VOLCADRAFT_40672, partial [Volvox carteri 
f. nagariensis]
Length=724

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L   V+ETF++SCAGY V+TYILG+GDRHLDNL+L +DGRLFH+DFG+ILG DPKPFPP
Sbjct  554  GLRGEVVETFVRSCAGYCVMTYILGVGDRHLDNLMLTNDGRLFHIDFGYILGNDPKPFPP  613

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGG  S+YY +F+ + CEAYNILRK ++LIL+LFHLMAG++I  I +DP
Sbjct  614  PMKLCKEMIEAMGGQGSEYYKQFRMFACEAYNILRKRADLILSLFHLMAGASIEAIRADP  673

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILKLQ+KFRLD DDE  + + Q LINES +AL PQ+VET HRWAQYWR
Sbjct  674  EKAILKLQDKFRLDFDDEAAVEWMQGLINESATALLPQLVETTHRWAQYWR  724



>ref|XP_002506109.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67367.1| predicted protein [Micromonas sp. RCC299]
Length=804

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L +F+KSCAGY VITYILG+GDRHLDNL+L  DGR+FH+DFGFI+G+DPK FPPPMKLCK
Sbjct  640  LMSFVKSCAGYCVITYILGVGDRHLDNLMLAPDGRMFHIDFGFIMGRDPKIFPPPMKLCK  699

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
            EMVEAMGG ES+Y+ +FK+YCCEAYNILRKS  LILNLF LMA +NIPDI+ D EK +LK
Sbjct  700  EMVEAMGGTESEYFGKFKTYCCEAYNILRKSVVLILNLFSLMADANIPDISQDCEKALLK  759

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            L+ KF LDLDDE  +  FQ LINES +ALFPQ+ ET HRWAQYWR
Sbjct  760  LESKFALDLDDEAAMQHFQVLINESTNALFPQIFETTHRWAQYWR  804



>gb|AAC50017.1| phosphatidylinositol 3-kinase [Chlamydomonas reinhardtii]
Length=732

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L    +ETF++SCAGY V+TYILG+GDRHLDNL+L  DGRLFH+DFG+ILG D KPFPP
Sbjct  562  GLRAEAVETFVRSCAGYCVMTYILGVGDRHLDNLMLTHDGRLFHIDFGYILGADTKPFPP  621

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGG  S+YY +F+ Y CEAYNILRK ++LIL+LFHLMAG++I  I +DP
Sbjct  622  PMKLCKEMIEAMGGQGSEYYKQFRMYACEAYNILRKRADLILSLFHLMAGASIEAIRADP  681

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILKLQ+KFRLD DDE  + + Q LINES +AL PQ+VET HRWAQYWR
Sbjct  682  EKAILKLQDKFRLDFDDEAAVEWMQGLINESATALLPQLVETTHRWAQYWR  732



>emb|CEJ02078.1| hypothetical protein RMCBS344292_16095 [Rhizopus microsporus]
Length=675

 Score =   236 bits (603),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  504  GIDPQVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPDGHLFHVDFGFILGRDPKPFPP  563

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S YY  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  564  PMKLCKEMIEAMGGANSPYYINFQQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEP  623

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  624  DKAVLKVQEKFRLDLSEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  674



>gb|EIE82383.1| hypothetical protein RO3G_07088 [Rhizopus delemar RA 99-880]
Length=684

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  513  GIDPRVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPDGHLFHVDFGFILGRDPKPFPP  572

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S YY  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  573  PMKLCKEMIEAMGGANSPYYMNFQQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEP  632

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  633  DKAVLKVQEKFRLDLSEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  683



>gb|KIY96448.1| phosphatidylinositol 3-kinase [Monoraphidium neglectum]
Length=569

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             LETF++SCAGY V+TYILG+GDRHLDNL+L  DGRLFH+DFG+ILG DPKPFPPPMKLC
Sbjct  404  ALETFVRSCAGYCVMTYILGVGDRHLDNLMLAPDGRLFHIDFGYILGSDPKPFPPPMKLC  463

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEM+EAMGGA+S  Y RF+   CEAYNILRKS++LIL+LFHLMAG++I  I S+PE  +L
Sbjct  464  KEMIEAMGGADSGLYVRFRMLACEAYNILRKSADLILSLFHLMAGASIEAIRSNPENAML  523

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            KLQEK RLD DD + + + Q LINES +A+ PQ++ET HRWAQYWR
Sbjct  524  KLQEKLRLDFDDGQAVEWMQQLINESATAMMPQIMETTHRWAQYWR  569



>emb|CEG70099.1| hypothetical protein RMATCC62417_06049 [Rhizopus microsporus]
Length=714

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  543  GIDPQVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPDGHLFHVDFGFILGRDPKPFPP  602

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S YY  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  603  PMKLCKEMIEAMGGANSPYYINFQQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEP  662

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  663  DKAVLKVQEKFRLDLSEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  713



>emb|CEJ04469.1| hypothetical protein RMCBS344292_18430 [Rhizopus microsporus]
Length=821

 Score =   236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  650  GIDPQVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPDGHLFHVDFGFILGRDPKPFPP  709

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S YY  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  710  PMKLCKEMIEAMGGANSPYYINFQQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEP  769

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  770  DKAVLKVQEKFRLDLSEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  820



>emb|CEG70098.1| hypothetical protein RMATCC62417_06049 [Rhizopus microsporus]
Length=827

 Score =   236 bits (602),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  656  GIDPQVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPDGHLFHVDFGFILGRDPKPFPP  715

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S YY  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  716  PMKLCKEMIEAMGGANSPYYINFQQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEP  775

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  776  DKAVLKVQEKFRLDLSEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  826



>ref|XP_002983829.1| hypothetical protein SELMODRAFT_118849 [Selaginella moellendorffii]
 gb|EFJ15325.1| hypothetical protein SELMODRAFT_118849 [Selaginella moellendorffii]
Length=790

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 13/169 (8%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhl----dnlllrddgrLFHVDFGFILGKDPKPFPPPM  622
            LETF+KSCAGY VITYILG+GDR      +NLL+RDDGRLFHVDFGFILGKDPKPFPPPM
Sbjct  627  LETFVKSCAGYCVITYILGVGDRQAFLHLENLLIRDDGRLFHVDFGFILGKDPKPFPPPM  686

Query  621  KLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEK  442
            KLCKEMV+AMGG  S+YY +FK YCCEA+NILRKSSNLILNLF+LM+ S +         
Sbjct  687  KLCKEMVDAMGGINSEYYGKFKLYCCEAFNILRKSSNLILNLFYLMSNSEV---------  737

Query  441  GILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             ILKLQEKF+L LDDEE I FFQ LINESV+ALFPQ+V+T+HRWAQYWR
Sbjct  738  AILKLQEKFQLSLDDEEAIQFFQLLINESVNALFPQVVDTMHRWAQYWR  786



>ref|XP_002989110.1| hypothetical protein SELMODRAFT_129115 [Selaginella moellendorffii]
 gb|EFJ09904.1| hypothetical protein SELMODRAFT_129115 [Selaginella moellendorffii]
Length=806

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 13/169 (8%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhl----dnlllrddgrLFHVDFGFILGKDPKPFPPPM  622
            LETF+KSCAGY VITYILG+GDR      +NLL+RDDGRLFHVDFGFILGKDPKPFPPPM
Sbjct  643  LETFVKSCAGYCVITYILGVGDRQAFLHLENLLIRDDGRLFHVDFGFILGKDPKPFPPPM  702

Query  621  KLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEK  442
            KLCKEMV+AMGG  S+YY +FK YCCEA+NILRKSSNLILNLF+LM+ S +         
Sbjct  703  KLCKEMVDAMGGINSEYYGKFKLYCCEAFNILRKSSNLILNLFYLMSNSEV---------  753

Query  441  GILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             ILKLQEKF+L LDDEE I FFQ LINESV+ALFPQ+V+T+HRWAQYWR
Sbjct  754  AILKLQEKFQLSLDDEEAIQFFQLLINESVNALFPQVVDTMHRWAQYWR  802



>gb|EPB83231.1| hypothetical protein HMPREF1544_10027 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=839

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  668  GIDPKVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSTDGHLFHVDFGFILGRDPKPFPP  727

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S +Y  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  728  PMKLCKEMIEAMGGANSPHYLNFQQYCYTAFTTLRRNANLILNLFSLMVDANIPDIKIEP  787

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ++K+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  788  EKAVMKVQEKFRLDLTEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  838



>ref|NP_001061506.1| Os08g0307400 [Oryza sativa Japonica Group]
 gb|AAQ56420.1| putative kinase [Oryza sativa Japonica Group]
 dbj|BAF23420.1| Os08g0307400 [Oryza sativa Japonica Group]
Length=827

 Score =   233 bits (595),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 142/168 (85%), Gaps = 6/168 (4%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPP---MK  619
            LETFIKSCAGYSVITYILGIGDRHLDNLLL+DDGRLFHVDF ++LG+ P  F PP   MK
Sbjct  663  LETFIKSCAGYSVITYILGIGDRHLDNLLLQDDGRLFHVDFSYMLGEQPHRFAPPSPPMK  722

Query  618  LCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG  439
            LCKEMVEAMGG ES+YY RFKSYCCEAYNILRKSSNLILNLF+LM GSNI  I    +KG
Sbjct  723  LCKEMVEAMGGTESEYYARFKSYCCEAYNILRKSSNLILNLFYLMTGSNIESIT---DKG  779

Query  438  ILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
              KLQ+ FRLDLDDE+ IHF Q LINES+SA FPQ+VETIH+WAQ  R
Sbjct  780  TSKLQQNFRLDLDDEDAIHFLQGLINESISAFFPQVVETIHQWAQSRR  827



>dbj|GAN11171.1| phosphatidylinositol 3-kinase [Mucor ambiguus]
Length=838

 Score =   233 bits (595),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  667  GIDPKVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSTDGHLFHVDFGFILGRDPKPFPP  726

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S +Y  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  727  PMKLCKEMIEAMGGANSPHYLSFQQYCYTAFTTLRRNANLILNLFSLMVDANIPDIKIEP  786

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K ++K+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  787  DKAVMKVQEKFRLDLTEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  837



>emb|CDS10815.1| hypothetical protein LRAMOSA11301 [Absidia idahoensis var. thermophila]
Length=801

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -1

Query  795  HVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKL  616
             V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  +G LFHVDFGFILG+DPKPFPPPMKL
Sbjct  634  QVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPEGYLFHVDFGFILGRDPKPFPPPMKL  693

Query  615  CKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGI  436
            CKEM+EAMGGA S++Y +F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P+K +
Sbjct  694  CKEMIEAMGGANSRHYDKFRQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEPDKAV  753

Query  435  LKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             K+QEKFRLDL +E  I +FQ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  754  NKVQEKFRLDLSEEAAIAYFQSLISESVNALFPQIMETVHKWAQYWR  800



>emb|CEP14473.1| hypothetical protein [Parasitella parasitica]
Length=836

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V+ET+ +SCAGY VITY+LG+GDRHLDNLLL  DG LFHVDFGFILG+DPKPFPP
Sbjct  665  GIDPKVMETYTRSCAGYCVITYLLGVGDRHLDNLLLATDGHLFHVDFGFILGRDPKPFPP  724

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEM+EAMGGA S +Y  F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P
Sbjct  725  PMKLCKEMIEAMGGANSPHYLSFQQYCYTAFTTLRRNANLILNLFSLMVDANIPDIKIEP  784

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ++K+QEKFRLDL +E  I +F+ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  785  EKAVMKVQEKFRLDLTEEAAISYFRGLISESVNALFPQIMETVHKWAQYWR  835



>emb|CDH58858.1| atypical pikk pi3k protein kinase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=847

 Score =   232 bits (591),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -1

Query  795  HVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKL  616
             V+ET+I+SCAGY VITY+LG+GDRHLDNLLL  +G LFHVDFGFILG+DPKPFPPPMKL
Sbjct  680  QVMETYIRSCAGYCVITYLLGVGDRHLDNLLLSPEGYLFHVDFGFILGRDPKPFPPPMKL  739

Query  615  CKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGI  436
            CKEM+EAMGGA S++Y +F+ YC  A+  LR+++NLILNLF LM  +NIPDI  +P+K +
Sbjct  740  CKEMIEAMGGANSRHYDKFRQYCYTAFTTLRRNANLILNLFALMVDANIPDIKIEPDKAV  799

Query  435  LKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             K+QEKFRLDL +E  I +FQ LI+ESV+ALFPQ++ET+H+WAQYWR
Sbjct  800  NKVQEKFRLDLSEEAAIAYFQGLISESVNALFPQIMETVHKWAQYWR  846



>ref|XP_003062450.1| phosphatidylinositol 4-kinase [Micromonas pusilla CCMP1545]
 gb|EEH53269.1| phosphatidylinositol 4-kinase [Micromonas pusilla CCMP1545]
Length=798

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -1

Query  798  PHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMK  619
            P  L  F+KSCAGY VITYILG+GDRHLDNL+L  DGR+FH+DFGFI G+DPK FPPPMK
Sbjct  631  PESLMRFVKSCAGYCVITYILGVGDRHLDNLMLAPDGRMFHIDFGFICGRDPKIFPPPMK  690

Query  618  LCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKG  439
            LCKE+VE MGG ES+++ +FK+YCCEAYNILRK   LILNLF LMA +NIPDI+ D EK 
Sbjct  691  LCKELVETMGGIESEHFGKFKTYCCEAYNILRKHVVLILNLFSLMADANIPDISQDCEKA  750

Query  438  ILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +LKL+ KF LDLDDE  +  FQ LI ES +ALFPQ+ ET HRWAQYWR
Sbjct  751  LLKLESKFALDLDDEAAMQHFQVLITESTNALFPQIFETTHRWAQYWR  798



>gb|EFA77138.1| phosphatidylinositol 3-kinase [Polysphondylium pallidum PN500]
Length=704

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P VL+TF+KSCAGY VITYILGIGDRHLDNLLL  +G LFH+DFG+ILGKDPK FPP
Sbjct  533  GVAPEVLDTFVKSCAGYCVITYILGIGDRHLDNLLLTPNGNLFHIDFGYILGKDPKIFPP  592

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMV  MGG  S+ Y +FK YCCEAYNILRKSS+LI+NLF LM  SNIP I+ + 
Sbjct  593  PMKLCKEMVIGMGGENSKQYEKFKQYCCEAYNILRKSSHLIINLFALMEESNIPTISEER  652

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILK+QEKF+L+L+D+E  +    L+N+SVSALFP MVE +H+W QYWR
Sbjct  653  EKSILKVQEKFQLELNDQEAANSLLQLLNDSVSALFPVMVEMVHKWYQYWR  703



>ref|XP_011399049.1| Phosphatidylinositol 3-kinase, root isoform [Auxenochlorella 
protothecoides]
 gb|KFM26153.1| Phosphatidylinositol 3-kinase, root isoform [Auxenochlorella 
protothecoides]
Length=776

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L P VL  F+KSCA   V+TYILG+GDRHLDNLLL  DGRLFH+DFGFILG+DPKPFPP
Sbjct  606  GLQPGVLANFVKSCAAACVMTYILGVGDRHLDNLLLARDGRLFHIDFGFILGRDPKPFPP  665

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLC+EMV+A+GGA+S++Y RF S+ CEA+N+LRKS+ L+  L  LMAGS +PDIA+DP
Sbjct  666  PMKLCREMVDALGGADSEHYRRFASHACEAFNVLRKSAGLLTGLLRLMAGSRLPDIAADP  725

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +  +LK+QEK RLDL DEE   + + L+ +S SAL P ++ET HRWAQYWR
Sbjct  726  DAALLKVQEKLRLDLGDEEAARYMRQLLADSASALMPAIMETTHRWAQYWR  776



>gb|EPZ35311.1| Phosphatidylinositol Kinase domain-containing protein [Rozella 
allomycis CSF55]
Length=724

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -1

Query  804  LHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPP  625
            + P +LET+IKSCAGY ++TY+LG+GDRHL+NLLL   G LFHVDFGFILGKDPKPFPPP
Sbjct  554  IEPTILETYIKSCAGYCIVTYLLGVGDRHLENLLLTSQGNLFHVDFGFILGKDPKPFPPP  613

Query  624  MKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPE  445
            MKLCKEMVEAMGG  S +Y +FKSYC  A++ILRK SNLILN+F+LM  S I DI+ D E
Sbjct  614  MKLCKEMVEAMGGQSSFHYVQFKSYCYLAFSILRKRSNLILNIFNLMLDSGIQDISLDKE  673

Query  444  KGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
              + +L EKFRLDL +EE ++F ++ I ESV ALFPQM+E IH+WAQYWR
Sbjct  674  FILERLHEKFRLDLSEEEAMNFIENTIQESVKALFPQMMEKIHQWAQYWR  723



>ref|XP_004348988.2| phosphoinositide-3-kinase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91037.1| phosphoinositide-3-kinase [Capsaspora owczarzaki ATCC 30864]
Length=945

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
            ++   V++T++KS AGY VITY+LGIGDRHLDNLLL + G L H+DFG+ILG+DPKPFPP
Sbjct  774  SVSQEVMDTYVKSMAGYCVITYLLGIGDRHLDNLLLSESGNLLHIDFGYILGRDPKPFPP  833

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKL KEMVE MGGA S +Y +F ++C  A+ ILRKSSNLILNLF LM  S++PDIA++P
Sbjct  834  PMKLAKEMVEGMGGANSVHYKKFLAHCYNAFLILRKSSNLILNLFTLMVDSSVPDIANEP  893

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K ++K+QEKF+L L DE+ + FFQ LI+ESVSALF Q+ ETIH+WAQYWR
Sbjct  894  DKAVMKVQEKFQLQLSDEQAVQFFQQLIDESVSALFAQISETIHKWAQYWR  944



>ref|XP_006438360.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51600.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
Length=770

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 116/165 (70%), Gaps = 48/165 (29%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIG                                       
Sbjct  654  LETFIKSCAGYSVITYILGIG---------------------------------------  674

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
                     +SQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  675  ---------DSQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  725

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  726  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  770



>gb|KDO82390.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=770

 Score =   221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 116/165 (70%), Gaps = 48/165 (29%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            LETFIKSCAGYSVITYILGIG                                       
Sbjct  654  LETFIKSCAGYSVITYILGIG---------------------------------------  674

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  430
                     +SQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK
Sbjct  675  ---------DSQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGILK  725

Query  429  LQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LQEKFRLDLDDE C+HFFQDLINESVSALFPQMVETIHRWAQYWR
Sbjct  726  LQEKFRLDLDDEACVHFFQDLINESVSALFPQMVETIHRWAQYWR  770



>ref|XP_006682457.1| hypothetical protein BATDEDRAFT_36168 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76893.1| hypothetical protein BATDEDRAFT_36168 [Batrachochytrium dendrobatidis 
JAM81]
Length=851

 Score =   219 bits (559),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = -1

Query  804  LHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPP  625
            + P  ++T+I+S AGY VITY+LGIGDRHLDNLLL  +G L H+DFGFILG+DPKPFPPP
Sbjct  681  ISPQTMDTYIRSTAGYCVITYLLGIGDRHLDNLLLTREGNLIHIDFGFILGRDPKPFPPP  740

Query  624  MKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPE  445
            MKLCKEMVEAMGGA S  Y +FKSY   A+N LRKS+NLILNLF LM  +NIPDIA +P+
Sbjct  741  MKLCKEMVEAMGGAMSSNYQKFKSYIFIAFNSLRKSANLILNLFSLMVNANIPDIAIEPD  800

Query  444  KGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K + K+QE+FRLDL+DEE I F Q L+ ESV A FPQ++E +H+ AQ WR
Sbjct  801  KAVWKVQERFRLDLNDEEAIQFIQALVIESVGAFFPQVMEQLHKVAQLWR  850



>gb|KDD73211.1| hypothetical protein H632_c2423p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=413

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L   VLE FI+SCA   V+TY+LG+GDRHLDNL+L  DG LFH+DFG++ G+DPKPFPP
Sbjct  243  GLRAAVLENFIRSCAAACVMTYLLGVGDRHLDNLMLTPDGCLFHIDFGYMFGRDPKPFPP  302

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLC+EMV+AMGG  + +Y  F ++C EAYN+LRKSS L+L L HLMAG+N+PDIA DP
Sbjct  303  PMKLCREMVDAMGGPGAPHYAAFTTFCTEAYNLLRKSSGLLLGLVHLMAGANVPDIAPDP  362

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
               +L+++EK R+DL DEE     + L+ +S  AL PQ++ET HRWAQYWR
Sbjct  363  AGALLRMREKLRIDLRDEEAAAHMRQLLADSAGALLPQIMETTHRWAQYWR  413



>dbj|GAM23254.1| hypothetical protein SAMD00019534_064290, partial [Acytostelium 
subglobosum LB1]
Length=822

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P VLETF+KSCAGY VITYILGIGDRHLDNLLL  +G LFH+DFG+ILGKDPK FPP
Sbjct  652  GVAPEVLETFVKSCAGYCVITYILGIGDRHLDNLLLTPNGNLFHIDFGYILGKDPKIFPP  711

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMV  MGG  S+ Y +FK YCCEAY ILRKSS+LI+NLF LM  +NIP I+ + 
Sbjct  712  PMKLCKEMVIGMGGEGSKQYEKFKQYCCEAYLILRKSSHLIINLFALMIDANIPTISEER  771

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILK+QEK +L+L D+E  +    L+N+SVSALFP +VE +H+W+QYWR
Sbjct  772  EKSILKVQEKLQLELTDQEASNSLLQLLNDSVSALFPVVVEIVHKWSQYWR  822



>gb|KFH73635.1| hypothetical protein MVEG_00850 [Mortierella verticillata NRRL 
6337]
Length=832

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V++ ++KSCAGY VI Y+LG+GDRHLDNLLL  +G +FHVDFGFILG+DPKPFP 
Sbjct  661  GVRPDVMDAYVKSCAGYCVIMYLLGVGDRHLDNLLLSPNGNIFHVDFGFILGRDPKPFPA  720

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMK+ KEMVEAMGG  S +Y  FKSYC  AYNILRKS+NLILNLF LM  +NIPDI  +P
Sbjct  721  PMKITKEMVEAMGGFNSVHYQSFKSYCFTAYNILRKSANLILNLFGLMTYANIPDIKMEP  780

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K++E+F+LDL D+E I FFQ+LINES+SA+ PQ+ ETIH W Q +R
Sbjct  781  DKAVWKVEERFQLDLTDDEAIKFFQNLINESLSAVIPQIAETIHTWTQAFR  831



>ref|XP_002170067.2| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Hydra vulgaris]
Length=844

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +HP  ++T++KSCAGY VITYILG+GDRHLDNL+L   G LFH+DFG+ILG+DPKPFPP
Sbjct  673  GIHPETMDTYVKSCAGYCVITYILGVGDRHLDNLMLTKSGNLFHIDFGYILGRDPKPFPP  732

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKL KEMVE MGG  S +Y +F+  C  A+  LR+ +NL LNLF LM  +++PDIA +P
Sbjct  733  PMKLSKEMVEGMGGTASSHYQQFRKLCFTAFLHLRRYANLFLNLFSLMVDASVPDIALEP  792

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K+Q+KFRLDL+DEE + + Q LI+ESVSA+F  + E IH+WAQYWR
Sbjct  793  DKTVKKVQDKFRLDLNDEEAVQYLQALIDESVSAVFASLAEQIHKWAQYWR  843



>ref|XP_002677255.1| predicted protein [Naegleria gruberi]
 gb|EFC44511.1| predicted protein [Naegleria gruberi]
Length=872

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 135/168 (80%), Gaps = 4/168 (2%)
 Frame = -1

Query  786  ETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCKE  607
            + F+KSCAGY VITYILGIGDRHLDN+L+   G +FH+DFGFI+G+DPKPFPPPMKLCKE
Sbjct  704  QNFVKSCAGYCVITYILGIGDRHLDNVLITAQGLMFHIDFGFIMGRDPKPFPPPMKLCKE  763

Query  606  MVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDI----ASDPEKG  439
            MVE MGG++S+ Y +FK  C  AYNILRKS++LILN+F LM  +NI D+      DP + 
Sbjct  764  MVEGMGGSKSEGYIKFKELCVTAYNILRKSAHLILNMFILMIDANIRDLEHGAGMDPIRN  823

Query  438  ILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            I+K+QEKF+LDL+D+E   + Q +INES  ALFPQ++E IHRWAQYWR
Sbjct  824  IMKVQEKFKLDLNDQEANVYMQSIINESEKALFPQLMENIHRWAQYWR  871



>gb|AAA85726.1| phosphatidylinositol 3-kinase [Dictyostelium discoideum AX3]
Length=816

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V++TF+KSCAGY VITYILGIGDRHLDNLLL  +G+LFH+DFG+ILGKDPK  PP
Sbjct  645  GIAPEVMDTFVKSCAGYCVITYILGIGDRHLDNLLLTPNGKLFHIDFGYILGKDPKILPP  704

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMV  MGG  S++Y +FK  CCEAYNILRKSS+LILNLF LM  ++IP I+ D 
Sbjct  705  PMKLCKEMVLGMGGENSKHYEKFKQLCCEAYNILRKSSHLILNLFALMVDASIPSISDDK  764

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILK+QEK +L+L D+E  +    L+N+SV+ALFP ++E  H+W QYW+
Sbjct  765  EKSILKVQEKLQLELTDQEASNSLLQLLNDSVTALFPVIIEMAHKWLQYWK  815



>ref|XP_636122.1| phosphatidylinositol 3-kinase [Dictyostelium discoideum AX4]
 sp|P54676.2|PI3K4_DICDI RecName: Full=Phosphatidylinositol 3-kinase VPS34-like; Short=PI3-kinase; 
Short=PI3K; Short=PtdIns-3-kinase [Dictyostelium 
discoideum]
 gb|EAL62618.1| phosphatidylinositol 3-kinase [Dictyostelium discoideum AX4]
Length=816

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V++TF+KSCAGY VITYILGIGDRHLDNLLL  +G+LFH+DFG+ILGKDPK  PP
Sbjct  645  GIAPEVMDTFVKSCAGYCVITYILGIGDRHLDNLLLTPNGKLFHIDFGYILGKDPKILPP  704

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMV  MGG  S++Y +FK  CCEAYNILRKSS+LILNLF LM  ++IP I+ D 
Sbjct  705  PMKLCKEMVLGMGGENSKHYEKFKQLCCEAYNILRKSSHLILNLFALMVDASIPSISDDK  764

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILK+QEK +L+L D+E  +    L+N+SV+ALFP ++E  H+W QYW+
Sbjct  765  EKSILKVQEKLQLELTDQEASNSLLQLLNDSVTALFPVIIEMAHKWLQYWK  815



>ref|XP_003291233.1| phosphatidylinositol 3-kinase [Dictyostelium purpureum]
 gb|EGC32235.1| phosphatidylinositol 3-kinase [Dictyostelium purpureum]
Length=808

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V++ F+KSCAGY VITYILGIGDRHLDNLLL  +G+LFH+DFG+ILGKDPK  PP
Sbjct  637  GVAPDVMDNFVKSCAGYCVITYILGIGDRHLDNLLLTPNGKLFHIDFGYILGKDPKILPP  696

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMV  MGG  S++Y +FK  CCEAYNILRKSS+LILNLF LMA ++IP I+ D 
Sbjct  697  PMKLCKEMVVGMGGENSKHYEKFKQLCCEAYNILRKSSHLILNLFALMADASIPSISEDK  756

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK ILK+QEK +L+L D+E  +    L+NESVSALFP MVE +H+W QYWR
Sbjct  757  EKSILKVQEKLQLELTDQEASNSLLLLLNESVSALFPVMVEYVHKWYQYWR  807



>emb|CCJ29853.1| unnamed protein product [Pneumocystis jirovecii]
Length=819

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +   V++T++KSCAGY VITY+LG+GDRHLDNLLL  DGR FH DFGFILG+DPKPF P
Sbjct  648  GVKAEVMDTYVKSCAGYCVITYLLGVGDRHLDNLLLCPDGRFFHADFGFILGRDPKPFSP  707

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S YY+RFKSYC  A+  LRKS+NLI+NLF LM  SNI DI  +P
Sbjct  708  AMKLCKEMVEGMGGASSLYYSRFKSYCYTAFITLRKSANLIMNLFSLMVQSNISDIKIEP  767

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ DEE I +FQ LIN+S+SALFP +++ +H  AQYWR
Sbjct  768  DKAVLKVKERFCLEMTDEEAIKYFQQLINDSISALFPVLIDRVHNIAQYWR  818



>tpg|DAA64655.1| TPA_exp: phosphatidylinositol 3-kinase [Emiliania huxleyi]
Length=966

 Score =   213 bits (541),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P VLE F+KSCAGY V  Y++G+GDRHLDNL+LR DG LFH+DFG+ILG+DPKPFPP
Sbjct  797  GIAPAVLERFVKSCAGYCVAMYLMGVGDRHLDNLMLRTDGALFHIDFGYILGRDPKPFPP  856

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKLCKEMVEAMGGA+S+ Y RF+  CCEA+NILR SSNLILNL  LM  + + D+ +  
Sbjct  857  PMKLCKEMVEAMGGADSRLYERFRVLCCEAFNILRASSNLILNLLLLMVDAGVADLKT--  914

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            E+ +LK+ EK RLDL DEE   +FQ+LI+ESVS+LFPQ+ ETIHRWAQYWR
Sbjct  915  EQDVLKVTEKLRLDLSDEEAALYFQELISESVSSLFPQINETIHRWAQYWR  965



>ref|XP_005776813.1| phosphatidylinositol 3-kinase Vps34 [Emiliania huxleyi CCMP1516]
 gb|EOD24384.1| phosphatidylinositol 3-kinase Vps34 [Emiliania huxleyi CCMP1516]
Length=1038

 Score =   213 bits (542),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = -1

Query  807   ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
              + P VLE F+KSCAGY V  Y++G+GDRHLDNL+LR DG LFH+DFG+ILG+DPKPFPP
Sbjct  869   GIAPAVLERFVKSCAGYCVAMYLMGVGDRHLDNLMLRTDGALFHIDFGYILGRDPKPFPP  928

Query  627   PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             PMKLCKEMVEAMGGA+S+ Y RF+  CCEA+NILR SSNLILNL  LM  + + D+ +  
Sbjct  929   PMKLCKEMVEAMGGADSRLYERFRVLCCEAFNILRASSNLILNLLLLMVDAGVADLKT--  986

Query  447   EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             E+ +LK+ EK RLDL DEE   +FQ+LI+ESVS+LFPQ+ ETIHRWAQYWR
Sbjct  987   EQDVLKVTEKLRLDLSDEEAALYFQELISESVSSLFPQINETIHRWAQYWR  1037



>ref|XP_004350853.1| phosphatidylinositol 3-kinase [Dictyostelium fasciculatum]
 gb|EGG14145.1| phosphatidylinositol 3-kinase [Dictyostelium fasciculatum]
Length=822

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = -1

Query  795  HVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKL  616
             VL+TF+KSCAGY VITYILGIGDRHLDNLLL  +G LFH+DFG+ILGKDPK  PPPMKL
Sbjct  655  EVLDTFVKSCAGYCVITYILGIGDRHLDNLLLTPNGNLFHIDFGYILGKDPKILPPPMKL  714

Query  615  CKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGI  436
            CKEMV  MGG  S++Y +FK  CCEAYNILR SS+LI+NLF LM  +NIP I+ + EK I
Sbjct  715  CKEMVIGMGGENSKHYGKFKQLCCEAYNILRNSSHLIINLFALMIDANIPTISEEREKSI  774

Query  435  LKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            L++QEK +L+L D+E  +    L+N+SVSALFP +VE +H+W QYWR
Sbjct  775  LRVQEKLQLELTDQEAANSLLQLLNDSVSALFPVVVEYVHKWYQYWR  821



>gb|ADK87856.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   195 bits (496),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDR LDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRRLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDP  123



>gb|ADK87852.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87853.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87854.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87855.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87858.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87860.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87863.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87864.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87865.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87866.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87867.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87870.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87871.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87872.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87873.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87874.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87875.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDP  123



>ref|XP_005646177.1| phosphatidylinositol 3-kinase [Coccomyxa subellipsoidea C-169]
 gb|EIE21633.1| phosphatidylinositol 3-kinase [Coccomyxa subellipsoidea C-169]
Length=822

 Score =   210 bits (535),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 111/171 (65%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L   VL+TF+KSCAGY V+TYILG+GDRH DNL+L  DGRLFH+DFGFI+G+DPKP+PP
Sbjct  652  GLKAEVLDTFVKSCAGYCVMTYILGVGDRHNDNLMLTPDGRLFHIDFGFIMGRDPKPWPP  711

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            P KL +EMVEAMGGAES+ Y  F ++ CEAYNILRKS+ LIL+LFHLMAG+ IPDI SDP
Sbjct  712  PFKLSREMVEAMGGAESELYRAFCAHACEAYNILRKSAGLILSLFHLMAGAAIPDIRSDP  771

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            EK +LKLQEK RL  DDE  I + Q LI++S S      +E  HR AQ  R
Sbjct  772  EKAMLKLQEKLRLGEDDEVAIEWMQQLISDSSSNAMAGFMEATHRIAQALR  822



>gb|ADK87861.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPM+LCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMELCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDP  123



>gb|ADK87868.1| GOLM25, partial [Arabidopsis halleri]
 gb|ADK87869.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF F LG+DPKPFPPPMKLCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFFLGRDPKPFPPPMKLCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDP  123



>gb|ADK87862.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF FILG+DPKPFPPPMKLCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFAFILGRDPKPFPPPMKLCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNL HLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLLHLMAGSTIPDIASDP  123



>gb|ADK87859.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL DDGRLFHVDF   LG+DPKPFPPPMKLCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRHLDNLLLTDDGRLFHVDFALFLGRDPKPFPPPMKLCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDP  123



>gb|ADK87857.1| GOLM25, partial [Arabidopsis halleri]
Length=123

 Score =   189 bits (481),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  789  LETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLCK  610
            L+TFIKSCAGYSVITYILGIGDRHLDNLLL +DGRLFHVDF FILG+DP PFPPPMKLCK
Sbjct  10   LDTFIKSCAGYSVITYILGIGDRHLDNLLLTNDGRLFHVDFAFILGRDPNPFPPPMKLCK  69

Query  609  EMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            EMVEAMGGAESQYYTRFKS CCEAYNILRKSSNLILNLFHLMAGS IPDIASDP
Sbjct  70   EMVEAMGGAESQYYTRFKSCCCEAYNILRKSSNLILNLFHLMAGSTIPDIASDP  123



>ref|XP_003741971.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Metaseiulus occidentalis]
Length=913

 Score =   204 bits (519),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = -1

Query  804  LHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPP  625
            + P V++ ++KSCAGY VITY+LG+GDRHLDNLLL   G+LFH+DFG+ILG+DPKPFPPP
Sbjct  743  ISPEVMDNYVKSCAGYGVITYLLGVGDRHLDNLLLTKQGQLFHIDFGYILGRDPKPFPPP  802

Query  624  MKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPE  445
            MKL +EMVEAMGG  S+ Y  FK +C      LR+ +NLILNLF LM  +++PDIA +P+
Sbjct  803  MKLSREMVEAMGGMSSELYNEFKKHCYTTLLHLRRHANLILNLFSLMVDASVPDIALEPD  862

Query  444  KGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K + K+Q+KF L+L DEE +   Q LI+ S SA+ P +VE+IH+WAQYWR
Sbjct  863  KTVKKVQDKFMLELTDEEAVSEMQRLIDSSASAVMPSVVESIHKWAQYWR  912



>ref|XP_011409708.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Amphimedon queenslandica]
Length=303

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P +++T+IKSCAGYSVITY+L +GDRHLDNLLL + G L H+DFG+ILG+DPK FPP
Sbjct  132  GISPEIMDTYIKSCAGYSVITYLLSVGDRHLDNLLLMETGNLIHIDFGYILGRDPKIFPP  191

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PM+L KEMV+AMGG  S+ +++F+ +C  A+  LR+S+NL LNLF LM  S +PDIA +P
Sbjct  192  PMRLSKEMVDAMGGTSSKEFSQFREHCYNAFLTLRRSANLFLNLFSLMLDSGVPDIALEP  251

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K+++KFRLDL DEE + + Q LI+ S+ A+FP++ E IH+ AQ +R
Sbjct  252  DKTVQKVEDKFRLDLSDEEAVKYLQGLIDLSIRAIFPELFEKIHKIAQDFR  302



>ref|XP_003958733.1| hypothetical protein KAFR_0H01890 [Kazachstania africana CBS 
2517]
 emb|CCF59598.1| hypothetical protein KAFR_0H01890 [Kazachstania africana CBS 
2517]
Length=874

 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V+E F+KSCAGYSVITYILG+GDRHLDNLLL  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  708  VMENFVKSCAGYSVITYILGVGDRHLDNLLLTPDGHFFHADFGYILGQDPKPFPPLMKLP  767

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP+  IL
Sbjct  768  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKQSNIPDIRVDPDGAIL  827

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE I  FQ LIN+SV+AL P +++ +H  AQYWR
Sbjct  828  KVKERFNLDISEEEAIIHFQTLINDSVNALLPIVIDRLHNLAQYWR  873



>ref|XP_007875266.1| hypothetical protein PNEG_03203 [Pneumocystis murina B123]
 gb|EMR08363.1| hypothetical protein PNEG_03203 [Pneumocystis murina B123]
Length=834

 Score =   201 bits (512),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 14/185 (8%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnl--------------llrddgrLFHVD  670
             +   V++T++KSCAGY VITY+LG+GDRHLDNL                   G  FH D
Sbjct  649  GVKAEVMDTYVKSCAGYCVITYLLGVGDRHLDNLLLCPDGMIFNIFIFSYNIIGHFFHAD  708

Query  669  FGFILGKDPKPFPPPMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFH  490
            FGFILG+DPKPF P MKLCKEMVE MGGA S YY++FKSYC  A+  LRKS+NLI+NLF 
Sbjct  709  FGFILGRDPKPFSPAMKLCKEMVEGMGGASSSYYSQFKSYCYTAFITLRKSANLIINLFA  768

Query  489  LMAGSNIPDIASDPEKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRW  310
            LM  SNI DI  +P+K +LK++E+F L++ DEE I +FQ LIN+SVSA FP +++ +H  
Sbjct  769  LMLESNISDIKFEPDKSVLKVKERFCLEMTDEEAIKYFQQLINDSVSAFFPVLIDRVHNI  828

Query  309  AQYWR  295
            AQYWR
Sbjct  829  AQYWR  833



>ref|XP_002554568.1| KLTH0F08404p [Lachancea thermotolerans]
 emb|CAR24131.1| KLTH0F08404p [Lachancea thermotolerans CBS 6340]
Length=867

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILGIGDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  701  VMDNFVKSCAGYCVITYILGIGDRHLDNLLITPDGNFFHADFGYILGQDPKPFPPLMKLP  760

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++E+ GGAESQ Y +F+SYC  AY+ILR+++NLILNLF LM  S+IPDI  DP+  +L
Sbjct  761  PQIIESFGGAESQNYNKFRSYCFVAYSILRRNANLILNLFELMKTSDIPDIKIDPDGAML  820

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF LD+ +EE I  FQ+LIN SV+AL P +++ +H  AQYWR
Sbjct  821  KVKEKFCLDMSEEEAIIHFQNLINASVNALLPLVIDRLHNLAQYWR  866



>ref|XP_002110551.1| hypothetical protein TRIADDRAFT_22684 [Trichoplax adhaerens]
 gb|EDV26555.1| hypothetical protein TRIADDRAFT_22684 [Trichoplax adhaerens]
Length=876

 Score =   200 bits (508),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
            +++P V++T++KSCAGY +ITY+LGIGDRHLDNLLL   G LFH+DFG+ILG+DPKPFPP
Sbjct  708  SINPEVMDTYVKSCAGYCIITYLLGIGDRHLDNLLLTKSGNLFHIDFGYILGRDPKPFPP  767

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKL KEMVE MGG  +++Y  F+  C  A+  LR+S+NLILNLF LM  +N+PDIA +P
Sbjct  768  PMKLSKEMVEGMGGQYTEHYQEFRQLCYTAFLHLRRSANLILNLFSLMLDANVPDIAMEP  827

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQ  304
            +K + K+Q+KF LDL DEE +   Q LI+ESV+ALFP +VE IH+ AQ
Sbjct  828  DKTMKKVQDKFVLDLSDEEAVKHIQSLIDESVTALFPVVVEHIHKVAQ  875



>ref|XP_004989703.1| hypothetical protein PTSG_12885 [Salpingoeca rosetta]
 gb|EGD78380.1| hypothetical protein PTSG_12885 [Salpingoeca rosetta]
Length=867

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L+  V++++++SCAGY VITY+LG+GDRHLDNLLLRD+G LFHVDFG+ILG+DPKP+PP
Sbjct  696  GLNKEVMDSYVRSCAGYCVITYLLGVGDRHLDNLLLRDNGLLFHVDFGYILGRDPKPYPP  755

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKL K+MVEAMGGA S+   RF+S+C   + ILRK+++LILNLF LM  SN+ DI+ D 
Sbjct  756  PMKLTKDMVEAMGGASSEEVKRFRSHCFNCFLILRKNASLILNLFALMIDSNVHDISLDR  815

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K ++K++EKFRLD+DDE  + +F++L++ S++ALFP++VE +H  AQY R
Sbjct  816  DKTLVKVEEKFRLDMDDEVAVKYFKELLDNSLAALFPRVVEAVHTLAQYMR  866



>emb|CEP61436.1| LALA0S03e02828g1_1 [Lachancea lanzarotensis]
Length=867

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  701  VIDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  760

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++E+ GGA+S+ Y +F+SYC  AY+ILR+++NLILNLF LM  S+IPDI  DP+  +L
Sbjct  761  PQIIESFGGADSENYNKFRSYCFVAYSILRRNANLILNLFELMKPSDIPDIKIDPDGAML  820

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF LD+ +EE I  FQ+LIN SVSAL P +++ +H  AQYWR
Sbjct  821  KVKEKFCLDMSEEEAIIHFQNLINASVSALLPLVIDRLHNLAQYWR  866



>gb|AAQ56466.1| putative phosphatidylinositol 3-kinase [Oryza sativa Japonica 
Group]
Length=122

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 100/125 (80%), Gaps = 6/125 (5%)
 Frame = -1

Query  660  ILGKDPKPFPPP---MKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFH  490
            +LG+ P  F PP   MKLCKEMVEAMGG ES+YY RFKSYCCEAYNILRKSSNLILNLF+
Sbjct  1    MLGEQPHRFAPPSPPMKLCKEMVEAMGGTESEYYARFKSYCCEAYNILRKSSNLILNLFY  60

Query  489  LMAGSNIPDIASDPEKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRW  310
            LM GSNI  I    +KG  KLQ+ FRLDLDDE+ IHF Q LINES+SA FPQ+VETIH+W
Sbjct  61   LMTGSNIESIT---DKGTSKLQQNFRLDLDDEDAIHFLQGLINESISAFFPQVVETIHQW  117

Query  309  AQYWR  295
            AQ  R
Sbjct  118  AQSRR  122



>gb|KKA19143.1| Phosphatidylinositol 3-kinase [Rasamsonia emersonii CBS 393.64]
Length=910

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  739  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  798

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S +Y +FK +C  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  799  MMKLCKEMVEGMGGANSPHYLQFKQHCFTAYTTLRKSSNLILNLFSLMVDANIPDIRVEP  858

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +EE I  F+ LIN+SV+A+F  +++ +H + Q WR
Sbjct  859  DKAVLKVKERFHLELSEEEAIRHFEQLINDSVNAIFGVVIDRLHDFVQGWR  909



>emb|CCK67951.1| hypothetical protein KNAG_0A02620 [Kazachstania naganishii CBS 
8797]
Length=869

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  +G+ FH DFG+ILG+DPKPFPP MKL 
Sbjct  703  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPEGKFFHADFGYILGQDPKPFPPLMKLP  762

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES+ Y +F+SYC  +Y+ILR+++ LILNLF LM  S IPDI  DP+  IL
Sbjct  763  LQIIEAFGGAESENYNKFRSYCFVSYSILRRNAGLILNLFELMKNSTIPDIRIDPDGAIL  822

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE   +FQ LIN+SV+AL P +++ +H  AQYWR
Sbjct  823  KVKERFNLDMSEEEATFYFQTLINDSVNALLPIVIDHLHNLAQYWR  868



>ref|XP_001645719.1| hypothetical protein Kpol_1043p51 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO17861.1| hypothetical protein Kpol_1043p51 [Vanderwaltozyma polyspora 
DSM 70294]
Length=868

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V+E F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  702  VMENFVKSCAGYCVITYILGVGDRHLDNLLITTDGHFFHADFGYILGQDPKPFPPLMKLP  761

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GG ES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DPE  I 
Sbjct  762  PQIIEAFGGTESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPEGSIQ  821

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  822  KVKERFNLDMSEEEATVHFQNLINDSVNALLPLVIDHLHNLAQYWR  867



>gb|KHJ30663.1| putative phosphatidylinositol 3-kinase [Erysiphe necator]
Length=918

 Score =   197 bits (502),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETF +SCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  747  GVRKEALETFTRSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  806

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGGA S YY +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  807  AMKLCKEMVDGMGGANSDYYAQFKQYCFTAYTTLRKSSNLILNLFSLMVDANIPDIRIEP  866

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F +++ +EE I  F  LI +S SA+FP +++ +H   Q++R
Sbjct  867  DKAVLKVKERFHMEMSEEEAIRHFDTLIEDSSSAIFPVVIDRLHGLVQHFR  917



>ref|XP_505213.2| YALI0F09559p [Yarrowia lipolytica]
 emb|CAG78020.2| YALI0F09559p [Yarrowia lipolytica CLIB122]
Length=821

 Score =   197 bits (500),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P V++TF++SCAGY V+TYILG+GDRHLDNLL+ DDG  FH DFG+ILG+DPKPFPP
Sbjct  650  GVRPEVMDTFVRSCAGYCVMTYILGVGDRHLDNLLISDDGHFFHADFGYILGRDPKPFPP  709

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKL  ++++ MGG  S+ YT+F++YC  AY  LRKS+NLILNLF LM  +NIPDIA + 
Sbjct  710  LMKLPIQIIDGMGGIHSENYTKFRNYCFTAYTTLRKSANLILNLFSLMTEANIPDIAIEK  769

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K++++F L++ DEE I  FQ+LIN+SVSA  P +++ +H  AQYWR
Sbjct  770  DKAVQKVRDRFCLEMSDEEAIVHFQNLINDSVSAFLPMVIDRLHSLAQYWR  820



>ref|XP_003682547.1| hypothetical protein TDEL_0F05250 [Torulaspora delbrueckii]
 emb|CCE93336.1| hypothetical protein TDEL_0F05250 [Torulaspora delbrueckii]
Length=865

 Score =   197 bits (501),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITY+LG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  699  VMDNFVKSCAGYCVITYLLGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  758

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGA+S  Y +F+SYC   Y+ILR+++ LILNLF LM  SNIPDI  DPE  +L
Sbjct  759  PQIIEAFGGAQSPNYNKFRSYCFVVYSILRRNAGLILNLFDLMKTSNIPDIRIDPEGAVL  818

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LDL +EE   +FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  819  KVKERFNLDLSEEEATVYFQNLINDSVNALLPIVIDHLHNLAQYWR  864



>emb|CDH09875.1| probable Phosphatidylinositol 3-kinase VPS34 [Zygosaccharomyces 
bailii ISA1307]
Length=870

 Score =   197 bits (500),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC   Y+ILR+++ LILNLF LM  SNIPDI  DP+  +L
Sbjct  764  PQIIEAFGGAESSNYNKFRSYCFVVYSILRRNAGLILNLFELMKTSNIPDIRIDPDGAVL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  824  KVKERFNLDMSEEEATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  869



>emb|CDF87744.1| BN860_13476g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=870

 Score =   197 bits (500),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC   Y+ILR+++ LILNLF LM  SNIPDI  DP+  +L
Sbjct  764  PQIIEAFGGAESSNYNKFRSYCFVVYSILRRNAGLILNLFELMKTSNIPDIRIDPDGAVL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  824  KVKERFNLDMSEEEATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  869



>emb|CDH17805.1| probable Phosphatidylinositol 3-kinase VPS34 [Zygosaccharomyces 
bailii ISA1307]
Length=870

 Score =   196 bits (499),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC   Y+ILR+++ LILNLF LM  SNIPDI  DP+  +L
Sbjct  764  PQIIEAFGGAESSNYNKFRSYCFVVYSILRRNAGLILNLFELMKTSNIPDIRIDPDGAVL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  824  KVKERFNLDMSEEEATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  869



>ref|XP_002495847.1| ZYRO0C04356p [Zygosaccharomyces rouxii]
 emb|CAR26914.1| ZYRO0C04356p [Zygosaccharomyces rouxii]
Length=870

 Score =   196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC   Y+ILR+++ LILNLF LM  SNIPDI  DP+  +L
Sbjct  764  PQIIEAFGGAESSNYNKFRSYCFVVYSILRRNAGLILNLFELMKTSNIPDIRIDPDGSVL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  824  KVKERFNLDMSEEEATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  869



>emb|CDR44756.1| CYFA0S15e02454g1_1 [Cyberlindnera fabianii]
Length=841

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  675  VMDNFVKSCAGYCVITYILGVGDRHLDNLLICPDGHFFHADFGYILGRDPKPFPPLMKLP  734

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             ++++A GGA+S  Y +F++YC  AY+I RK+SNLILNLF LM  S+IPDIA +P++ + 
Sbjct  735  PQIIDAFGGADSPNYHKFRNYCFVAYSIFRKNSNLILNLFELMRDSSIPDIAIEPDRTVY  794

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF LD+ +EE I  FQ+LIN+SVSAL P++++ +H  AQYWR
Sbjct  795  KVKEKFCLDMSEEEAIIHFQNLINDSVSALLPKVIDRLHSLAQYWR  840



>dbj|GAA95268.1| hypothetical protein E5Q_01924 [Mixia osmundae IAM 14324]
 gb|KEI41238.1| hypothetical protein L969DRAFT_92472 [Mixia osmundae IAM 14324]
Length=900

 Score =   196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+T+I+SCAGY V+TY+LG+GDRHLDNLLL  DG  FHVDFG+ILG+DPKPFPP MK+C
Sbjct  736  VLDTYIRSCAGYCVVTYLLGVGDRHLDNLLLSPDGHFFHVDFGYILGRDPKPFPPAMKIC  795

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMV+AMGGA S +Y RF++ C  A+ ILRK++NLI+NL  LM  +NIPDI  +P+K ++
Sbjct  796  KEMVDAMGGASSPHYLRFRNLCFTAFTILRKNANLIINLVALMVDANIPDIRLEPDKAVM  855

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K+Q+KFRLDL +E+ I +F+ L+NE+ S  +  +++ +H  AQYWR
Sbjct  856  KVQDKFRLDLSEEDAIRYFEGLLNETSS--WAAVLDRLHAAAQYWR  899



>gb|AAH92169.1| Pik3c3 protein [Danio rerio]
 gb|AAI64467.1| Pik3c3 protein [Danio rerio]
Length=372

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +   V++T++KSCAGY VITYILG+GDRHLDNLLL   G+LFH+DFG+ILG+DPKP PP
Sbjct  201  GISSEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPP  260

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKL KEMVE MGG +S+ Y  F+  C  A+  LR+ SNLILNLF LM  +NIPDIA +P
Sbjct  261  PMKLSKEMVEGMGGMQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEP  320

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K+Q+KFRLDL DEE +H+ Q LI+ESV ALF  +VE IH++AQYWR
Sbjct  321  DKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVGALFAAVVEQIHKFAQYWR  371



>ref|XP_446727.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG59654.1| unnamed protein product [Candida glabrata]
Length=889

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITY+LG+GDRHLDNLL+ + G+ FH DFG+ILG+DPKPFPP MKL 
Sbjct  723  VIDNFVKSCAGYCVITYLLGVGDRHLDNLLITEGGQFFHADFGYILGQDPKPFPPLMKLP  782

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GG +S  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DPE  I+
Sbjct  783  PQIIEAFGGTDSSNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRVDPEGSIM  842

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LDL +EE    FQ LIN+SV+AL P +++ +H  AQYWR
Sbjct  843  KVKERFNLDLTEEEATIHFQTLINDSVNALLPIVIDHLHNLAQYWR  888



>ref|XP_003675639.1| hypothetical protein NCAS_0C02830 [Naumovozyma castellii CBS 
4309]
 emb|CCC69273.1| hypothetical protein NCAS_0C02830 [Naumovozyma castellii CBS 
4309]
Length=874

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FHVDFG+ILG+DPKPFPP MKL 
Sbjct  708  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHVDFGYILGQDPKPFPPLMKLP  767

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  768  PQIIEAFGGAESSNYNKFRSYCFVAYSILRRNAGLILNLFELMKMSNIPDIRIDPNGAIL  827

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K+QE+F LD+ +E+    FQ LIN+S++A+ P  ++ +H  AQYWR
Sbjct  828  KVQERFNLDMSEEQATIHFQTLINDSLNAVLPIFIDHLHNLAQYWR  873



>ref|XP_008896150.1| hypothetical protein PPTG_04077 [Phytophthora parasitica INRA-310]
 gb|ETI36166.1| hypothetical protein F443_17654 [Phytophthora parasitica P1569]
 gb|ETK76394.1| hypothetical protein L915_17188 [Phytophthora parasitica]
 gb|ETL29832.1| hypothetical protein L916_17082 [Phytophthora parasitica]
 gb|ETL83061.1| hypothetical protein L917_16908 [Phytophthora parasitica]
 gb|ETM36280.1| hypothetical protein L914_16991 [Phytophthora parasitica]
 gb|ETN18483.1| hypothetical protein PPTG_04077 [Phytophthora parasitica INRA-310]
 gb|ETO64890.1| hypothetical protein F444_17693 [Phytophthora parasitica P1976]
 gb|ETP05990.1| hypothetical protein F441_17521 [Phytophthora parasitica CJ01A1]
 gb|ETP34100.1| hypothetical protein F442_17506 [Phytophthora parasitica P10297]
Length=959

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P  L T++KS AGY V+TY+LGIGDRHLDNL+++ +G LFH+DFGF+ G DPKP+PP
Sbjct  789  GIAPEALSTYVKSVAGYCVLTYLLGIGDRHLDNLMMKAEGHLFHIDFGFVFGADPKPYPP  848

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            P KL KEMVE MGG  S++Y +F +YCC+AYN LRKS++LILNL  LMA S I +++++P
Sbjct  849  PFKLTKEMVEGMGGPTSEHYQKFTTYCCQAYNWLRKSADLILNLLSLMADSGIEELSANP  908

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWA  307
               +LK++EKFRLDL DE+   FF  LIN+SVSALFP +V+ IH+ A
Sbjct  909  ATTLLKVEEKFRLDLTDEQAEQFFLGLINDSVSALFPLLVDWIHKVA  955



>ref|XP_002147483.1| phosphoinositide 3-kinase, putative [Talaromyces marneffei ATCC 
18224]
 gb|EEA23972.1| phosphoinositide 3-kinase, putative [Talaromyces marneffei ATCC 
18224]
 gb|KFX43862.1| Phosphatidylinositol 3-kinase, root isoform [Talaromyces marneffei 
PM1]
Length=907

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++ +IKSCAGY V+TY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  736  GVRKETMDIYIKSCAGYCVVTYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  795

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA SQ+Y +FK +C  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  796  MMKLCKEMVEGMGGANSQHYLQFKQHCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  855

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +EE I  F+ LI++SV+A+F  +++ +H + Q WR
Sbjct  856  DKAVLKVKERFHLELSEEEAIRHFEQLISDSVNAIFGVVIDRLHDFVQGWR  906



>ref|XP_002900926.1| phosphatidyl inositol kinase (PIK-A) [Phytophthora infestans 
T30-4]
 gb|EEY59733.1| phosphatidyl inositol kinase (PIK-A) [Phytophthora infestans 
T30-4]
Length=958

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P  L T++KS AGY V+TY+LGIGDRHLDNL+++ +G +FH+DFGF+ G DPKP+PP
Sbjct  788  GIAPEALSTYVKSVAGYCVLTYLLGIGDRHLDNLMMKAEGHMFHIDFGFVFGADPKPYPP  847

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            P KL KEMVE MGG  S++Y +F +YCC+AYN LRKS++LILNL  LMA S I +++++P
Sbjct  848  PFKLTKEMVEGMGGPTSEHYQKFTTYCCQAYNWLRKSADLILNLLSLMADSGIEELSANP  907

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWA  307
               +LK++EKFRLDL DE+   FF  LIN+SVSALFP +V+ IH+ A
Sbjct  908  ATTLLKVEEKFRLDLTDEQAEQFFLGLINDSVSALFPLLVDWIHKVA  954



>ref|XP_002836750.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ80941.1| unnamed protein product [Tuber melanosporum]
Length=812

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +   V++T++KSCAGY VITYILG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  641  GVRAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTPDGHFFHADFGFILGRDPKPFAP  700

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGGA S++Y  FK+YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  701  AMKLCKEMVDGMGGANSRHYIEFKNYCYTAYTTLRKSSNLILNLFALMVDANIPDIRLEP  760

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++++F L++ +E+ I  F+ LI+ S++++ P +++ IH  AQ WR
Sbjct  761  DKAVLKVKDRFCLEMTEEDAIKHFRILIDNSMNSVLPVLIDRIHVLAQIWR  811



>ref|XP_009521543.1| phosphoinositide 3-kinase [Phytophthora sojae]
 gb|EGZ26255.1| phosphoinositide 3-kinase [Phytophthora sojae]
Length=963

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             + P  L T++KS AGY V+TY+LGIGDRHLDNL+++ +G LFH+DFGF+ G DPKP+PP
Sbjct  793  GIAPEALSTYVKSVAGYCVLTYLLGIGDRHLDNLMMKAEGHLFHIDFGFVFGADPKPYPP  852

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            P KL KEMVE MGG  S++Y +F +YCC+AYN LRKS++LILNL  LMA S I +++++P
Sbjct  853  PFKLTKEMVEGMGGPTSEHYQKFTTYCCQAYNWLRKSADLILNLLSLMADSGIEELSANP  912

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWA  307
               +LK++EKFRLDL DE+   FF  LIN+SVSALFP +V+ IH+ A
Sbjct  913  ATTLLKVEEKFRLDLTDEQAEQFFLGLINDSVSALFPLLVDWIHKVA  959



>ref|XP_003684818.1| hypothetical protein TPHA_0C02310 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE62384.1| hypothetical protein TPHA_0C02310 [Tetrapisispora phaffii CBS 
4417]
Length=964

 Score =   196 bits (497),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++TF+KSCAGYSVITY+LG+GDRHLDNLL+  DG  FH DFG++LG+DPKPFPP MKL 
Sbjct  798  VMDTFVKSCAGYSVITYLLGVGDRHLDNLLITPDGHFFHADFGYVLGQDPKPFPPLMKLP  857

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GG ES  + +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DPE  + 
Sbjct  858  PQIIEAFGGIESANFDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPEGAVQ  917

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ LIN+SVSA+ P +++ +H  AQYWR
Sbjct  918  KVKERFNLDMSEEEATIHFQTLINDSVSAILPIVIDHLHNLAQYWR  963



>gb|AJV60652.1| Vps34p [Saccharomyces cerevisiae YJM1400]
 gb|AJV68678.1| Vps34p [Saccharomyces cerevisiae YJM1479]
Length=875

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR++S LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNSGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+S++AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSINALLPIVIDHLHNLAQYWR  874



>ref|XP_002793788.1| phosphatidylinositol 3-kinase vps34 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=909

 Score =   195 bits (495),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  738  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  797

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  798  MMKLCKEMVEGMGGASSPNYIQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  857

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  858  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  908



>gb|EJT41797.1| VPS34-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=875

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRVDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|KGY15264.1| hypothetical protein PABG_11848 [Paracoccidioides brasiliensis 
Pb03]
Length=911

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  740  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  799

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  800  MMKLCKEMVEGMGGASSPNYIQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  859

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  860  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  910



>gb|EEH33007.2| phosphatidylinositol 3-kinase vps34 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=911

 Score =   194 bits (494),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  740  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  799

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  800  MMKLCKEMVEGMGGASSPNYIQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  859

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  860  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  910



>gb|AJV67322.1| Vps34p [Saccharomyces cerevisiae YJM1463]
Length=875

 Score =   194 bits (493),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>ref|XP_010762682.1| hypothetical protein PADG_07335 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH42515.2| hypothetical protein PADG_07335 [Paracoccidioides brasiliensis 
Pb18]
Length=911

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  740  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  799

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  800  MMKLCKEMVEGMGGASSPNYIQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  859

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  860  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  910



>gb|AJV65985.1| Vps34p [Saccharomyces cerevisiae YJM1447]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|EWG94405.1| Vps34p [Saccharomyces cerevisiae R103]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV73604.1| Vps34p [Saccharomyces cerevisiae YJM244]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV63357.1| Vps34p [Saccharomyces cerevisiae YJM1419]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>ref|XP_002383860.1| phosphoinositide 3-kinase, putative [Aspergillus flavus NRRL3357]
 gb|EED46324.1| phosphoinositide 3-kinase, putative [Aspergillus flavus NRRL3357]
Length=902

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  731  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  790

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  791  MMKLCKEMVEGMGGTTSPHYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  850

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  851  DKAVLKVKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRLHEFVQGWR  901



>ref|XP_003671234.2| hypothetical protein NDAI_0G02160 [Naumovozyma dairenensis CBS 
421]
 emb|CCD25991.2| hypothetical protein NDAI_0G02160 [Naumovozyma dairenensis CBS 
421]
Length=913

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  +G  FH DFG+ILG+DPKPFPP MKL 
Sbjct  747  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPEGYFFHADFGYILGQDPKPFPPLMKLP  806

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             ++VEA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  807  PQIVEAFGGAESSNYNKFRSYCFVAYSILRRNAGLILNLFELMKMSNIPDIRIDPNGAIL  866

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K+QE+F LD+ +E+    FQ LIN S++AL P +++ +H  AQYWR
Sbjct  867  KVQERFNLDMSEEDATIHFQTLINGSLNALLPIVIDHLHNLAQYWR  912



>gb|EDZ70540.1| YLR240Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>ref|NP_013341.1| phosphatidylinositol 3-kinase VPS34 [Saccharomyces cerevisiae 
S288c]
 sp|P22543.1|VPS34_YEAST RecName: Full=Phosphatidylinositol 3-kinase VPS34; Short=PI3-kinase 
VPS34; Short=PI3K VPS34; Short=PtdIns-3-kinase VPS34; 
AltName: Full=Carboxypeptidase Y-deficient protein 15; AltName: 
Full=Vacuolar protein sorting-associated protein 34; AltName: 
Full=Vacuolar protein-targeting protein 29 [Saccharomyces 
cerevisiae S288c]
 emb|CAA37610.1| Vps34p [Saccharomyces cerevisiae]
 gb|AAB67396.1| Vps34p: phosphatidylinositol 2-kinase [Saccharomyces cerevisiae]
 gb|EDN59456.1| phosphatidylinositol 3-kinase [Saccharomyces cerevisiae YJM789]
 gb|EDV08569.1| phosphatidylinositol 3-kinase VPS34 [Saccharomyces cerevisiae 
RM11-1a]
 gb|EEU06773.1| Vps34p [Saccharomyces cerevisiae JAY291]
 emb|CAY81469.1| Vps34p [Saccharomyces cerevisiae EC1118]
 tpg|DAA09554.1| TPA: phosphatidylinositol 3-kinase VPS34 [Saccharomyces cerevisiae 
S288c]
 gb|EGA77759.1| Vps34p [Saccharomyces cerevisiae Vin13]
 gb|EGA81714.1| Vps34p [Saccharomyces cerevisiae Lalvin QA23]
 dbj|GAA25109.1| K7_Vps34p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EHN05599.1| Vps34p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW08845.1| Vps34p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG84473.1| Vps34p [Saccharomyces cerevisiae R008]
 gb|EWG89639.1| Vps34p [Saccharomyces cerevisiae P301]
 gb|EWH17101.1| Vps34p [Saccharomyces cerevisiae P283]
 gb|AHY78610.1| Vps34p [Saccharomyces cerevisiae YJM993]
 gb|AJP40386.1| Vps34p [Saccharomyces cerevisiae YJM1078]
 gb|AJV46291.1| Vps34p [Saccharomyces cerevisiae YJM1083]
 gb|AJV46743.1| Vps34p [Saccharomyces cerevisiae YJM1129]
 gb|AJV47195.1| Vps34p [Saccharomyces cerevisiae YJM1133]
 gb|AJV47647.1| Vps34p [Saccharomyces cerevisiae YJM1190]
 gb|AJV48100.1| Vps34p [Saccharomyces cerevisiae YJM1199]
 gb|AJV48557.1| Vps34p [Saccharomyces cerevisiae YJM1202]
 gb|AJV49009.1| Vps34p [Saccharomyces cerevisiae YJM1208]
 gb|AJV49462.1| Vps34p [Saccharomyces cerevisiae YJM1242]
 gb|AJV50329.1| Vps34p [Saccharomyces cerevisiae YJM1248]
 gb|AJV50780.1| Vps34p [Saccharomyces cerevisiae YJM1250]
 gb|AJV51226.1| Vps34p [Saccharomyces cerevisiae YJM1252]
 gb|AJV51678.1| Vps34p [Saccharomyces cerevisiae YJM1273]
 gb|AJV52129.1| Vps34p [Saccharomyces cerevisiae YJM1304]
 gb|AJV52569.1| Vps34p [Saccharomyces cerevisiae YJM1307]
 gb|AJV53023.1| Vps34p [Saccharomyces cerevisiae YJM1311]
 gb|AJV53465.1| Vps34p [Saccharomyces cerevisiae YJM1326]
 gb|AJV54372.1| Vps34p [Saccharomyces cerevisiae YJM1336]
 gb|AJV55260.1| Vps34p [Saccharomyces cerevisiae YJM1341]
 gb|AJV55710.1| Vps34p [Saccharomyces cerevisiae YJM1342]
 gb|AJV56157.1| Vps34p [Saccharomyces cerevisiae YJM1355]
 gb|AJV56612.1| Vps34p [Saccharomyces cerevisiae YJM1356]
 gb|AJV57067.1| Vps34p [Saccharomyces cerevisiae YJM1381]
 gb|AJV57519.1| Vps34p [Saccharomyces cerevisiae YJM1383]
 gb|AJV57971.1| Vps34p [Saccharomyces cerevisiae YJM1385]
 gb|AJV58419.1| Vps34p [Saccharomyces cerevisiae YJM1386]
 gb|AJV58871.1| Vps34p [Saccharomyces cerevisiae YJM1387]
 gb|AJV59319.1| Vps34p [Saccharomyces cerevisiae YJM1388]
 gb|AJV59760.1| Vps34p [Saccharomyces cerevisiae YJM1389]
 gb|AJV62010.1| Vps34p [Saccharomyces cerevisiae YJM1415]
 gb|AJV62464.1| Vps34p [Saccharomyces cerevisiae YJM1417]
 gb|AJV62907.1| Vps34p [Saccharomyces cerevisiae YJM1418]
 gb|AJV63788.1| Vps34p [Saccharomyces cerevisiae YJM1433]
 gb|AJV64234.1| Vps34p [Saccharomyces cerevisiae YJM1434]
 gb|AJV64679.1| Vps34p [Saccharomyces cerevisiae YJM1439]
 gb|AJV65539.1| Vps34p [Saccharomyces cerevisiae YJM1444]
 gb|AJV66421.1| Vps34p [Saccharomyces cerevisiae YJM1450]
 gb|AJV67774.1| Vps34p [Saccharomyces cerevisiae YJM1477]
 gb|AJV68225.1| Vps34p [Saccharomyces cerevisiae YJM1478]
 gb|AJV69127.1| Vps34p [Saccharomyces cerevisiae YJM1526]
 gb|AJV70031.1| Vps34p [Saccharomyces cerevisiae YJM1549]
 gb|AJV70925.1| Vps34p [Saccharomyces cerevisiae YJM1574]
 gb|AJV71361.1| Vps34p [Saccharomyces cerevisiae YJM1592]
 gb|AJV71804.1| Vps34p [Saccharomyces cerevisiae YJM1615]
 gb|AJV72258.1| Vps34p [Saccharomyces cerevisiae YJM189]
 gb|AJV72708.1| Vps34p [Saccharomyces cerevisiae YJM193]
 gb|AJV73159.1| Vps34p [Saccharomyces cerevisiae YJM195]
 gb|AJV73972.1| Vps34p [Saccharomyces cerevisiae YJM248]
 gb|AJV74870.1| Vps34p [Saccharomyces cerevisiae YJM271]
 gb|AJV75261.1| Vps34p [Saccharomyces cerevisiae YJM320]
 gb|AJV75713.1| Vps34p [Saccharomyces cerevisiae YJM326]
 gb|AJV76164.1| Vps34p [Saccharomyces cerevisiae YJM428]
 gb|AJV76616.1| Vps34p [Saccharomyces cerevisiae YJM450]
 gb|AJV77068.1| Vps34p [Saccharomyces cerevisiae YJM451]
 gb|AJV77523.1| Vps34p [Saccharomyces cerevisiae YJM453]
 gb|AJV78416.1| Vps34p [Saccharomyces cerevisiae YJM470]
 gb|AJV78866.1| Vps34p [Saccharomyces cerevisiae YJM541]
 gb|AJV79315.1| Vps34p [Saccharomyces cerevisiae YJM554]
 gb|AJV79767.1| Vps34p [Saccharomyces cerevisiae YJM555]
 gb|AJV80645.1| Vps34p [Saccharomyces cerevisiae YJM681]
 gb|AJV81098.1| Vps34p [Saccharomyces cerevisiae YJM682]
 gb|AJV81552.1| Vps34p [Saccharomyces cerevisiae YJM683]
 gb|AJV82004.1| Vps34p [Saccharomyces cerevisiae YJM689]
 gb|AJV82454.1| Vps34p [Saccharomyces cerevisiae YJM693]
 gb|AJV82908.1| Vps34p [Saccharomyces cerevisiae YJM969]
 gb|AJV83364.1| Vps34p [Saccharomyces cerevisiae YJM972]
 gb|AJV83814.1| Vps34p [Saccharomyces cerevisiae YJM975]
 gb|AJV84266.1| Vps34p [Saccharomyces cerevisiae YJM978]
 gb|AJV84721.1| Vps34p [Saccharomyces cerevisiae YJM981]
 gb|AJV85174.1| Vps34p [Saccharomyces cerevisiae YJM984]
 gb|AJV85627.1| Vps34p [Saccharomyces cerevisiae YJM987]
 gb|AJV86081.1| Vps34p [Saccharomyces cerevisiae YJM990]
 gb|AJV86535.1| Vps34p [Saccharomyces cerevisiae YJM996]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>ref|XP_001824747.1| phosphatidylinositol 3-kinase vps34 [Aspergillus oryzae RIB40]
 dbj|BAE63614.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT81201.1| phosphatidylinositol 3-kinase VPS34, involved in signal transduction 
[Aspergillus oryzae 3.042]
 gb|KDE75071.1| phosphatidylinositol 3-kinase VPS34, involved in signal transduction 
[Aspergillus oryzae 100-8]
 gb|KJJ29358.1| hypothetical protein P034_05708432 [Aspergillus flavus AF70]
Length=902

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  731  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  790

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  791  MMKLCKEMVEGMGGTTSPHYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  850

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  851  DKAVLKVKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRLHEFVQGWR  901



>gb|EER41354.1| phosphoinositide 3-kinase [Histoplasma capsulatum H143]
Length=836

 Score =   194 bits (492),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  665  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  724

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y  FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  725  MMKLCKEMVEGMGGASSPNYLLFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  784

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI++SV+A+F  +++ IH + Q WR
Sbjct  785  DKAVLKVKERFHLEMSEEEAIRHFEQLISDSVNAIFGVVIDRIHDFVQGWR  835



>gb|AJV49916.1| Vps34p [Saccharomyces cerevisiae YJM1244]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV54824.1| Vps34p [Saccharomyces cerevisiae YJM1338]
 gb|AJV61557.1| Vps34p [Saccharomyces cerevisiae YJM1402]
 gb|AJV69579.1| Vps34p [Saccharomyces cerevisiae YJM1527]
 gb|AJV70473.1| Vps34p [Saccharomyces cerevisiae YJM1573]
 gb|AJV77963.1| Vps34p [Saccharomyces cerevisiae YJM456]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV53916.1| Vps34p [Saccharomyces cerevisiae YJM1332]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV66873.1| Vps34p [Saccharomyces cerevisiae YJM1460]
Length=875

 Score =   194 bits (493),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV74419.1| Vps34p [Saccharomyces cerevisiae YJM270]
Length=875

 Score =   194 bits (493),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV61103.1| Vps34p [Saccharomyces cerevisiae YJM1401]
Length=875

 Score =   194 bits (493),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|EPS34839.1| hypothetical protein PDE_09803 [Penicillium oxalicum 114-2]
Length=904

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  733  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  792

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  793  MMKLCKEMVEGMGGTTSPHYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  852

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  853  DKAVLKVKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRLHEFVQGWR  903



>gb|KJK67917.1| Phosphatidylinositol 3- and 4-kinase [Aspergillus parasiticus 
SU-1]
Length=902

 Score =   194 bits (493),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  731  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  790

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  791  MMKLCKEMVEGMGGTTSPHYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  850

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  851  DKAVLKVKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRLHEFVQGWR  901



>ref|XP_011104561.1| vps34p [Saccharomyces arboricola H-6]
 gb|EJS42693.1| vps34p [Saccharomyces arboricola H-6]
Length=875

 Score =   194 bits (493),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|AJV60202.1| Vps34p [Saccharomyces cerevisiae YJM1399]
Length=875

 Score =   194 bits (493),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            VL+ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  709  VLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHADFGYILGQDPKPFPPLMKLP  768

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP   IL
Sbjct  769  PQIIEAFGGAESSNYDKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPNGAIL  828

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +++E+F L++ +E+    FQ+LIN+SV+AL P +++ +H  AQYWR
Sbjct  829  RVRERFNLNMSEEDATVHFQNLINDSVNALLPIVIDHLHNLAQYWR  874



>gb|EGC47238.1| phosphoinositide 3-kinase [Histoplasma capsulatum H88]
Length=912

 Score =   194 bits (493),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  741  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  800

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y  FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  801  MMKLCKEMVEGMGGASSPNYLLFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  860

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI++SV+A+F  +++ IH + Q WR
Sbjct  861  DKAVLKVKERFHLEMSEEEAIRHFEQLISDSVNAIFGVVIDRIHDFVQGWR  911



>gb|AGO13756.1| AaceriAGL113Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=870

 Score =   194 bits (492),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DGR FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGRFFHADFGYILGRDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  S+IPDI  DP+  IL
Sbjct  764  PQIIEAFGGAESNNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSDIPDIQMDPDGAIL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF L++ +E+    FQ+LIN SV+AL P +++ +H  AQYWR
Sbjct  824  KVKEKFCLNMSEEQATVHFQNLINASVNALLPLVIDHLHNLAQYWR  869



>gb|EEH02833.1| conserved hypothetical protein [Histoplasma capsulatum G186AR]
Length=912

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  741  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  800

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y  FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  801  MMKLCKEMVEGMGGASSPNYLLFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  860

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI++SV+A+F  +++ IH + Q WR
Sbjct  861  DKAVLKVKERFHLEMSEEEAIRHFEQLISDSVNAIFGVVIDRIHDFVQGWR  911



>ref|XP_011276515.1| Phosphatidylinositol 3-kinase catalytic subunit type 3 [Wickerhamomyces 
ciferrii]
 emb|CCH41615.1| Phosphatidylinositol 3-kinase catalytic subunit type 3 [Wickerhamomyces 
ciferrii]
Length=834

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  668  VMDNFVKSCAGYCVITYILGVGDRHLDNLLICPDGHFFHADFGYILGQDPKPFPPLMKLP  727

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGA S  Y  F++YC  +Y+ILRK+SNLILNLF +M  S+IPDI  +P++ + 
Sbjct  728  PQIIEAFGGASSPKYNMFRNYCFVSYSILRKNSNLILNLFEMMRDSSIPDITIEPDRAVY  787

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF LD+ +EE I  FQ+LIN+SVSAL P +++ +H  AQYWR
Sbjct  788  KVKEKFCLDMSEEEAIIHFQNLINDSVSALLPMVIDRLHSLAQYWR  833



>gb|EPQ66753.1| Phosphatidylinositol 3-kinase [Blumeria graminis f. sp. tritici 
96224]
Length=920

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFG+ILG+DPKPF P
Sbjct  749  GVRKEALETFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGYILGRDPKPFAP  808

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S  Y +FK YC  AY  LRK SNLILNLF LM  +NIPDI  +P
Sbjct  809  AMKLCKEMVDGMGGSNSTQYAQFKQYCFTAYTTLRKCSNLILNLFSLMVDANIPDIRIEP  868

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +EE I  F  LI +S SA+FP +++ +H + Q++R
Sbjct  869  DKVVLKVKERFHLELSEEEAIRHFDTLIEDSTSAIFPIVIDRLHGFVQHFR  919



>emb|CCU77453.1| phosphatidylinositol 3-kinase/VPS34 [Blumeria graminis f. sp. 
hordei DH14]
Length=922

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    LETFIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFG+ILG+DPKPF P
Sbjct  751  GVRKEALETFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGYILGRDPKPFAP  810

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S  Y +FK YC  AY  LRK SNLILNLF LM  +NIPDI  +P
Sbjct  811  AMKLCKEMVDGMGGSNSSQYAQFKQYCFTAYTTLRKCSNLILNLFSLMVDANIPDIRIEP  870

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +EE I  F  LI +S SA+FP +++ +H + Q++R
Sbjct  871  DKVVLKVKERFHLELSEEEAIRHFDTLIEDSTSAIFPIVIDRLHGFVQHFR  921



>dbj|GAM36497.1| phosphatidylinositol 3-kinase [Talaromyces cellulolyticus]
Length=907

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++ +IKSCAGY V+TY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  736  GVRKETMDIYIKSCAGYCVVTYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  795

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA SQ+Y +FK +C  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  796  MMKLCKEMVEGMGGANSQHYLQFKQHCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  855

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +EE +  F+ LI++SV+A+F  +++ +H + Q WR
Sbjct  856  DKAVLKVKERFHLELSEEEAMRHFEQLISDSVNAIFGVVIDRLHDFVQGWR  906



>gb|EYE98373.1| putative phosphoinositide 3-kinase [Aspergillus ruber CBS 135680]
Length=897

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  726  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  785

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  786  MMKLCKEMVEGMGGTTSPLYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  845

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ IH + Q WR
Sbjct  846  DKAVLKVKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRIHDFVQGWR  896



>ref|NP_986554.1| AGL113Cp [Ashbya gossypii ATCC 10895]
 gb|AAS54378.1| AGL113Cp [Ashbya gossypii ATCC 10895]
 gb|AEY98705.1| FAGL113Cp [Ashbya gossypii FDAG1]
Length=870

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DGR FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLIAPDGRFFHADFGYILGRDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  S+IPDI  DP+  IL
Sbjct  764  PQIIEAFGGAESNNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSDIPDIQMDPDGAIL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF L++ +E+    FQ+LIN SV+AL P +++ +H  AQYWR
Sbjct  824  KVKEKFCLNMSEEQATVHFQNLINASVNALLPLVIDHLHNLAQYWR  869



>gb|EHL00182.1| putative Phosphatidylinositol 3-kinase vps34 [Glarea lozoyensis 
74030]
Length=496

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 126/171 (74%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+TF+KSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFG+ILG+DPKPFPP
Sbjct  325  GVRKEALDTFVKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGYILGRDPKPFPP  384

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLC EM++ MGG+ S  Y +FK YC  A+N LRK SNLILNLF LM  +NI DI  +P
Sbjct  385  AMKLCAEMIDGMGGSSSDQYKQFKQYCYTAFNSLRKHSNLILNLFSLMVDANIQDIKLEP  444

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            ++ + K++++F+L+L DEE I +F  LI +S +A  P +V+ +H + Q WR
Sbjct  445  DRVVFKVKDRFQLELSDEEAIRYFDTLIEDSSNAFLPVIVDRLHGFVQNWR  495



>ref|XP_004181893.1| hypothetical protein TBLA_0H00850 [Tetrapisispora blattae CBS 
6284]
 emb|CCH62374.1| hypothetical protein TBLA_0H00850 [Tetrapisispora blattae CBS 
6284]
Length=893

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            +++ F+KSCAGY VITYILG+GDRHLDNLL+  DG  FH DFG+ILG+DPKPFPP MKL 
Sbjct  727  IMDNFVKSCAGYCVITYILGVGDRHLDNLLITRDGHFFHADFGYILGQDPKPFPPLMKLP  786

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             ++++A GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  SNIPDI  DP+  + 
Sbjct  787  PQIIDAFGGAESSNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRIDPDGSVS  846

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F LD+ +EE    FQ LIN+SV+AL P +++ +H  AQYWR
Sbjct  847  KVKERFNLDMSEEEATIHFQQLINDSVNALMPIVIDHLHNLAQYWR  892



>dbj|GAA85186.1| phosphoinositide 3-kinase [Aspergillus kawachii IFO 4308]
Length=901

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  730  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  789

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  790  MMKLCKEMVEGMGGTTSPLYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  849

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI++SV+A+F  +++ +H + Q WR
Sbjct  850  DKAVLKVKERFHLEMSEEEAIRHFEQLISDSVNAIFGVVIDRLHEFVQGWR  900



>gb|EPE05598.1| phosphatidylinositol 3-kinase catalytic subunit [Ophiostoma piceae 
UAMH 11346]
Length=992

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+TF+KSCAGY VITYILG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  821  GMRRETLDTFVKSCAGYCVITYILGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  880

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKL KEMVE MGG+ SQ+Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  881  AMKLSKEMVETMGGSGSQHYRQFKQYCFLAYTALRKSSNLILNLFSLMVDANIPDILWEP  940

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QE+F L+L++E+ I  F+ +I+++++A+ P +++ +H   Q WR
Sbjct  941  DKTVLKVQERFHLELNEEDAIRHFERVIDDNLNAIVPVVIDRLHGIVQAWR  991



>ref|XP_003646060.1| hypothetical protein Ecym_4166 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39243.1| hypothetical protein Ecym_4166 [Eremothecium cymbalariae DBVPG#7215]
Length=870

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
            V++ F+KSCAGY VITYILG+GDRHLDNLL+  DGR FH DFG+ILG+DPKPFPP MKL 
Sbjct  704  VMDNFVKSCAGYCVITYILGVGDRHLDNLLITPDGRFFHADFGYILGRDPKPFPPLMKLP  763

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
             +++EA GGAES  Y +F+SYC  AY+ILR+++ LILNLF LM  S++PDI  DP+  IL
Sbjct  764  PQIIEAFGGAESNNYNKFRSYCFVAYSILRRNAGLILNLFELMKTSDLPDIKIDPDGAIL  823

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++EKF L++ +E+    FQ+LIN SVSAL P +++ +H  AQYWR
Sbjct  824  KVKEKFCLNMSEEQATVHFQNLINASVSALLPLVIDHLHNLAQYWR  869



>ref|XP_001391565.1| phosphatidylinositol 3-kinase vps34 [Aspergillus niger CBS 513.88]
 emb|CAK39401.1| unnamed protein product [Aspergillus niger]
 gb|EHA23989.1| hypothetical protein ASPNIDRAFT_39962 [Aspergillus niger ATCC 
1015]
Length=901

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  730  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  789

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  790  MMKLCKEMVEGMGGTTSPLYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  849

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI++SV+A+F  +++ +H + Q WR
Sbjct  850  DKAVLKVKERFHLEMSEEEAIRHFEQLISDSVNAIFGVVIDRLHEFVQGWR  900



>ref|XP_007295423.1| phosphatidylinositol 3 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD14304.1| phosphatidylinositol 3 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=918

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+ FIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  747  GVRKEALDIFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  806

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S+YY +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  807  AMKLCKEMVDGMGGSSSEYYRQFKQYCFTAYTTLRKSSNLILNLFSLMVDANIPDIKIEP  866

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+  +EE I  F  LI +S +A+FP +++ +H + Q++R
Sbjct  867  DKVVLKVKERFHLEYTEEEAIRHFDTLIEDSSNAIFPVVIDRLHGFVQHFR  917



>ref|XP_002481619.1| phosphoinositide 3-kinase, putative [Talaromyces stipitatus ATCC 
10500]
 gb|EED17627.1| phosphoinositide 3-kinase, putative [Talaromyces stipitatus ATCC 
10500]
Length=906

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++ +IKSCAGY V+TY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  735  GVRKETMDIYIKSCAGYCVVTYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  794

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA SQ+Y +FK +C  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  795  MMKLCKEMVEGMGGANSQHYLQFKQHCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  854

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +EE +  F+ LI++SV+A+F  +++ +H + Q WR
Sbjct  855  DKAVLKVKERFHLELTEEEAMRHFEQLISDSVNAIFGVVIDRLHDFVQGWR  905



>gb|KGO44307.1| C2 calcium/lipid-binding domain, CaLB [Penicillium expansum]
Length=910

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P MKLC
Sbjct  744  TMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLC  803

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P+K +L
Sbjct  804  KEMVEGMGGTSSPHYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVL  863

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  864  KVKERFHLEMTEEEAIRHFEQLIADSVNAIFGVVIDRLHDFVQGWR  909



>gb|KGO38881.1| C2 calcium/lipid-binding domain, CaLB [Penicillium expansum]
 gb|KGO59153.1| C2 calcium/lipid-binding domain, CaLB [Penicillium expansum]
Length=910

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P MKLC
Sbjct  744  TMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLC  803

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P+K +L
Sbjct  804  KEMVEGMGGTSSPHYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVL  863

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  864  KVKERFHLEMTEEEAIRHFEQLIADSVNAIFGVVIDRLHDFVQGWR  909



>gb|EMR89327.1| putative phosphatidylinositol 3-kinase catalytic subunit protein 
[Botrytis cinerea BcDW1]
Length=922

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+ FIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  752  GVRKEALDVFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  811

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S++Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  812  AMKLCKEMVDGMGGSMSEHYPQFKQYCFTAYTTLRKSSNLILNLFSLMVDANIPDIKIEP  871

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +E+ I  F+ LI +S +A+FP +++ +H + Q++R
Sbjct  872  DKVVLKVKERFHLELSEEDAIRHFERLIEDSANAIFPVVIDRLHGFVQHFR  922



>ref|XP_002567133.1| Pc21g00590 [Penicillium rubens Wisconsin 54-1255]
 gb|ABO31328.1| Vps34p [Penicillium chrysogenum]
 emb|CAP94956.1| Pc21g00590 [Penicillium rubens Wisconsin 54-1255]
Length=896

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P MKLC
Sbjct  730  TMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLC  789

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P+K +L
Sbjct  790  KEMVEGMGGTTSPHYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVL  849

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  850  KVKERFHLEMTEEEAIRHFEQLIADSVNAIFGVVIDRLHDFVQGWR  895



>ref|XP_002628247.1| phosphoinositide 3-kinase [Blastomyces dermatitidis SLH14081]
 gb|EEQ72925.1| phosphoinositide 3-kinase [Blastomyces dermatitidis SLH14081]
 gb|EEQ89041.1| phosphoinositide 3-kinase [Blastomyces dermatitidis ER-3]
Length=911

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLL+  DG  FH DFGFILG+DPKPF P
Sbjct  740  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLIAPDGHFFHADFGFILGRDPKPFAP  799

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y  FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  800  MMKLCKEMVEGMGGASSPNYLLFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  859

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  860  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  910



>gb|KJJ23711.1| Phosphatidylinositol 3-4-kinase catalytic domain [Penicillium 
solitum]
Length=910

 Score =   193 bits (491),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P MKLC
Sbjct  744  TMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLC  803

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P+K +L
Sbjct  804  KEMVEGMGGTTSPHYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVL  863

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  864  KVKERFHLEMTEEEAIRHFEQLIADSVNAIFGVVIDRLHDFVQGWR  909



>gb|KGO68857.1| C2 calcium/lipid-binding domain, CaLB [Penicillium italicum]
Length=910

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P MKLC
Sbjct  744  TMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKLC  803

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMVE MGG  S +Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P+K +L
Sbjct  804  KEMVEGMGGTTSPHYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAVL  863

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  864  KVKERFHLEMTEEEAIRHFEQLIADSVNAIFGVVIDRLHDFVQGWR  909



>gb|KDB17242.1| phosphoinositide 3-kinase [Ustilaginoidea virens]
Length=904

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+T++KSCAGY VITYILG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  733  GVRQETLDTYVKSCAGYCVITYILGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  792

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKL KEMVE MGG  S++Y RFK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  793  LMKLSKEMVECMGGVSSEHYNRFKQYCFLAYTALRKSSNLILNLFSLMVHANIPDIRLEP  852

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K ++K++E+F LDL +EE I +F ++I  +++A  P +++ +H WAQ  R
Sbjct  853  DKAVIKVRERFHLDLSEEEAIVYFGNVIEGTLTAFAPVVIDKLHEWAQALR  903



>gb|EGE81644.1| phosphoinositide 3-kinase [Blastomyces dermatitidis ATCC 18188]
Length=913

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLL+  DG  FH DFGFILG+DPKPF P
Sbjct  742  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLIAPDGHFFHADFGFILGRDPKPFAP  801

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y  FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  802  MMKLCKEMVEGMGGASSPNYLLFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  861

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  862  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  912



>emb|CEJ82844.1| Putative Phosphatidylinositol 3-kinase catalytic subunit type 
3 [Torrubiella hemipterigena]
Length=906

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -1

Query  792  VLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKLC  613
             L+T+++SCAGY VITYILG+GDRHLDNLLL  DG  FH DFG+ILG+DPKPF P MKL 
Sbjct  740  ALDTYVRSCAGYCVITYILGVGDRHLDNLLLAPDGHFFHADFGYILGRDPKPFAPVMKLS  799

Query  612  KEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGIL  433
            KEMV+ MGG +S++Y RF+ YC  AY  LRKSSNLILNLF LM  +NIPDI  +P+K +L
Sbjct  800  KEMVDCMGGVQSEHYARFRQYCFLAYTALRKSSNLILNLFSLMVDANIPDIRIEPDKAVL  859

Query  432  KLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            K++E+F L+L +EE I +F  +I+++++AL P +++ +H WAQ +R
Sbjct  860  KVRERFHLELTEEEAIVYFGRVIDDNLAALAPVVIDKLHEWAQAFR  905



>ref|XP_001587332.1| hypothetical protein SS1G_11324 [Sclerotinia sclerotiorum 1980]
 gb|EDN95446.1| hypothetical protein SS1G_11324 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=893

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+ FIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  723  GVRKEALDVFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  782

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S++Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  783  AMKLCKEMVDGMGGSMSEHYPQFKQYCFTAYTTLRKSSNLILNLFSLMVDANIPDIKLEP  842

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +E+ I  F+ LI +S +A+FP +++ +H + Q++R
Sbjct  843  DKVVLKVKERFHLELSEEDAIRHFERLIEDSANAIFPVVIDRLHGFVQHFR  893



>gb|EQL33006.1| phosphatidylinositol 3-kinase [Blastomyces dermatitidis ATCC 
26199]
Length=932

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHLDNLL+  DG  FH DFGFILG+DPKPF P
Sbjct  761  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLDNLLIAPDGHFFHADFGFILGRDPKPFAP  820

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGGA S  Y  FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  821  MMKLCKEMVEGMGGASSPNYLLFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  880

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  881  DKAVLKVKERFHLEMSEEEAIRHFEQLIGDSVNAIFGVVIDRLHDFVQGWR  931



>gb|ESZ89610.1| phosphatidylinositol 3 [Sclerotinia borealis F-4157]
Length=957

 Score =   193 bits (491),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+ FIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  752  GVRKEALDVFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  811

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S++Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  812  AMKLCKEMVDGMGGSMSEHYPQFKQYCFTAYTTLRKSSNLILNLFSLMVDANIPDIKLEP  871

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +E+ I  F+ LI +S +A+FP +++ +H + Q++R
Sbjct  872  DKVVLKVKERFHLELGEEDAIRHFERLIEDSANAIFPVVIDRLHGFVQHFR  922



>ref|XP_001552296.1| hypothetical protein BC1G_08774 [Botrytis cinerea B05.10]
Length=973

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    L+ FIKSCAGY VITY+LG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  803  GVRKEALDVFIKSCAGYCVITYLLGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  862

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMV+ MGG+ S++Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  863  AMKLCKEMVDGMGGSMSEHYPQFKQYCFTAYTTLRKSSNLILNLFSLMVDANIPDIKIEP  922

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L+L +E+ I  F+ LI +S +A+FP +++ +H + Q++R
Sbjct  923  DKVVLKVKERFHLELSEEDAIRHFERLIEDSANAIFPVVIDRLHGFVQHFR  973



>ref|XP_002171412.1| phosphatidylinositol 3-kinase Pik3 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB05119.1| phosphatidylinositol 3-kinase Pik3 [Schizosaccharomyces japonicus 
yFS275]
Length=793

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +HP  ++ +++SCAGY VITY+LG+GDRH DNLLL DDG  FH DFG+ILG+DPK F P
Sbjct  622  GIHPTAMDNYVRSCAGYCVITYLLGVGDRHFDNLLLTDDGHFFHADFGYILGRDPKLFSP  681

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKL KEMVE MGG  S +Y +FKSYC   +  LRKS+NLILNLF LM  +NIPDI  D 
Sbjct  682  AMKLSKEMVEGMGGYNSPFYQKFKSYCYTTFTALRKSANLILNLFSLMVDANIPDIKIDR  741

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K++E+F L++ + E I +F+ LIN+SVSALFPQ+++ +H  AQY R
Sbjct  742  DKVVFKVKERFCLEISESEAIKYFEQLINDSVSALFPQIIDRMHNLAQYMR  792



>ref|XP_008281618.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Stegastes partitus]
Length=509

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +   V++T++KSCAGY VITYILG+GDRHLDNLLL   G+LFH+DFG+ILG+DPKP PP
Sbjct  338  GISSEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPP  397

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
            PMKL KEMVE MGG +S+ Y  F+  C  A+  LR+ SNLILNLF LM  +NIPDIA +P
Sbjct  398  PMKLSKEMVEGMGGMQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEP  457

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K+Q+KFRLDL DEE +H+ Q LI+ESV ALF  +VE IH++AQYWR
Sbjct  458  DKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVGALFAAVVEQIHKFAQYWR  508



>gb|KIH87667.1| phosphatidylinositol 3-kinase [Sporothrix brasiliensis 5110]
Length=999

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             L    L+TF+KSCAGY V+TYILG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  828  GLRRETLDTFVKSCAGYCVVTYILGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  887

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKL KEMVEAMGG+ S++Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  888  AMKLSKEMVEAMGGSGSEHYRQFKQYCFLAYTALRKSSNLILNLFSLMVDANIPDILWEP  947

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK+QE+F L+L++E+ I  F+ +I+++++A+ P +++ +H + Q +R
Sbjct  948  DKTVLKVQERFHLELNEEDAIRHFERVIDDNLNAIVPVVIDRLHEFVQAFR  998



>ref|XP_001274185.1| phosphoinositide 3-kinase, putative [Aspergillus clavatus NRRL 
1]
 gb|EAW12759.1| phosphoinositide 3-kinase, putative [Aspergillus clavatus NRRL 
1]
Length=902

 Score =   192 bits (488),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T++KSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  731  GVRKETMDTYVKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  790

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  791  MMKLCKEMVEGMGGTTSPQYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  850

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K I K++E+F L++ +EE I  F+ LI++SV+A+F  +++ +H + Q WR
Sbjct  851  DKAIFKVKERFHLEMTEEEAIRHFEQLISDSVNAIFGVVIDRLHEFVQGWR  901



>gb|ERS98459.1| hypothetical protein HMPREF1624_05243 [Sporothrix schenckii ATCC 
58251]
 gb|KJR89391.1| phosphatidylinositol 3-kinase [Sporothrix schenckii 1099-18]
Length=1002

 Score =   193 bits (490),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -1

Query  807   ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
              L    L+TF+KSCAGY V+TYILG+GDRHLDNLLL  DG  FH DFGFILG+DPKPF P
Sbjct  831   GLRRETLDTFVKSCAGYCVVTYILGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAP  890

Query  627   PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
              MKL KEMVEAMGG+ S++Y +FK YC  AY  LRKSSNLILNLF LM  +NIPDI  +P
Sbjct  891   AMKLSKEMVEAMGGSGSEHYRQFKQYCFLAYTALRKSSNLILNLFSLMVDANIPDILWEP  950

Query  447   EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             +K +LK+QE+F L+L++E+ I  F+ +I+++++A+ P +++ +H + Q +R
Sbjct  951   DKTVLKVQERFHLELNEEDAIRHFERVIDDNLNAIVPVVIDRLHEFVQAFR  1001



>emb|CCI50463.1| unnamed protein product [Albugo candida]
 emb|CCI50446.1| unnamed protein product [Albugo candida]
Length=1016

 Score =   193 bits (490),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807   ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
              + P  L  +IKS AGY V+TY+LGIGDRHLDNL+++ +G LFH+DFGFI G DPK  PP
Sbjct  846   GVAPEALSNYIKSVAGYCVLTYLLGIGDRHLDNLMMKTEGHLFHIDFGFIFGADPKLLPP  905

Query  627   PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             P KL KEMVE MGG ES +Y RFK+YCC+AYN LRKS++LILNL  LM  + I ++ +DP
Sbjct  906   PFKLTKEMVEGMGGLESVHYLRFKTYCCQAYNWLRKSADLILNLLSLMVDAGIEELTNDP  965

Query  447   EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             E  + K+QEKFRLDL DE+   FF  LIN+SV+ALFP ++E IH+ A   R
Sbjct  966   ETTLQKVQEKFRLDLTDEQAEQFFLGLINDSVTALFPVLMEYIHKVATRLR  1016



>ref|XP_662313.1| hypothetical protein AN4709.2 [Aspergillus nidulans FGSC A4]
 gb|EAA60751.1| hypothetical protein AN4709.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF76951.1| TPA: phosphoinositide 3-kinase, catalytic protein Vps34 (Eurofung) 
[Aspergillus nidulans FGSC A4]
Length=897

 Score =   191 bits (486),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  726  GVRKETMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  785

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  786  MMKLCKEMVEGMGGTSSPLYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  845

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI +S +A+F  +++ +H + Q WR
Sbjct  846  DKAVLKVKERFHLEMTEEEAIRHFEQLIGDSANAIFGVVIDRLHDFVQGWR  896



>emb|CCA27367.1| phosphatidyl inositol kinase (PIKA) putative [Albugo laibachii 
Nc14]
Length=1015

 Score =   192 bits (489),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = -1

Query  807   ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
              + P  L  +IKS AGY V+TY+LGIGDRHLDNL+++  G LFH+DFGFI G DPK  PP
Sbjct  845   GVAPEALSNYIKSVAGYCVLTYLLGIGDRHLDNLMMKTQGHLFHIDFGFIFGADPKLLPP  904

Query  627   PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             P KL KEMVE MGG ES +Y RFK+YCC+AYN LRKS++LILNL  LM  + I ++ +DP
Sbjct  905   PFKLTKEMVEGMGGLESVHYLRFKTYCCQAYNWLRKSADLILNLLSLMIDAGIEELTNDP  964

Query  447   EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
             E  + K+QEKFRLDL DE+   FF  LIN+SV+ALFP ++E IH+ A   R
Sbjct  965   ETTLQKVQEKFRLDLTDEQAEQFFLGLINDSVTALFPVLMEYIHKVATRLR  1015



>emb|CDM29302.1| Phosphatidylinositol 3-kinase vps34 [Penicillium roqueforti FM164]
Length=910

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -1

Query  795  HVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPPPMKL  616
              ++T++KSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P MKL
Sbjct  743  EAMDTYVKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAPMMKL  802

Query  615  CKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDPEKGI  436
            CKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P+K +
Sbjct  803  CKEMVEGMGGTTSPQYLQFKQYCYTAYTTLRKSANLILNLFSLMVDANIPDIRVEPDKAV  862

Query  435  LKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            LK++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  863  LKVKERFHLEMTEEEAIRHFEQLIADSVNAIFGVVIDRLHDFVQGWR  909



>dbj|GAD97644.1| phosphoinositide 3-kinase, putative [Byssochlamys spectabilis 
No. 5]
Length=905

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T+IKSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  734  GVRKEAMDTYIKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  793

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  794  MMKLCKEMVEGMGGTTSPNYMQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  853

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K +LK++E+F L++ +EE I  F+ LI++S +A+F  +++ +H + Q WR
Sbjct  854  DKAVLKVKERFHLEMSEEEAIRHFEQLISDSANAIFGVVIDRLHDFVQGWR  904



>ref|XP_753770.1| phosphoinositide 3-kinase [Aspergillus fumigatus Af293]
 gb|EAL91732.1| phosphoinositide 3-kinase, putative [Aspergillus fumigatus Af293]
Length=898

 Score =   191 bits (486),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = -1

Query  807  ALHPHVLETFIKSCAGYSVITYILGIGdrhldnlllrddgrLFHVDFGFILGKDPKPFPP  628
             +    ++T++KSCAGY VITY+LG+GDRHL+NLLL  DG  FH DFGFILG+DPKPF P
Sbjct  727  GVRKETMDTYVKSCAGYCVITYLLGVGDRHLENLLLAPDGHFFHADFGFILGRDPKPFAP  786

Query  627  PMKLCKEMVEAMGGAESQYYTRFKSYCCEAYNILRKSSNLILNLFHLMAGSNIPDIASDP  448
             MKLCKEMVE MGG  S  Y +FK YC  AY  LRKS+NLILNLF LM  +NIPDI  +P
Sbjct  787  MMKLCKEMVEGMGGTTSPQYLQFKQYCFTAYTTLRKSANLILNLFSLMVDANIPDIRVEP  846

Query  447  EKGILKLQEKFRLDLDDEECIHFFQDLINESVSALFPQMVETIHRWAQYWR  295
            +K + K++E+F L++ +EE I  F+ LI +SV+A+F  +++ +H + Q WR
Sbjct  847  DKAVFKVKERFHLEMTEEEAIRHFEQLIGDSVNAIFGVVIDRLHEFVQGWR  897



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1697011271292