BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8375

Length=1000
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB65927.1|  cinnamate 4-hydroxylase                                 430   1e-144   Ipomoea batatas [batate]
gb|AHJ60265.1|  cinnamate 4-monooxygenase                               407   2e-135   Ipomoea purpurea
gb|ADX33333.1|  cinnamate-4-hydroxylase 2                               405   1e-134   Petunia x hybrida [garden petunia]
ref|XP_009607087.1|  PREDICTED: trans-cinnamate 4-monooxygenase         401   3e-133   Nicotiana tomentosiformis
gb|ADX33332.1|  cinnamate-4-hydroxylase 1                               399   3e-132   Petunia x hybrida [garden petunia]
ref|XP_009798122.1|  PREDICTED: trans-cinnamate 4-monooxygenase         399   3e-132   Nicotiana sylvestris
gb|ACF19421.1|  candidate cinnamic acid 4-hydroxylase                   398   6e-132   Capsicum annuum
gb|ABC69413.1|  CYP73A47v2                                              396   2e-131   Nicotiana tabacum [American tobacco]
gb|ABC69046.1|  cinnamic acid 4-hydroxylase                             396   4e-131   Solanum tuberosum [potatoes]
gb|ADO16243.1|  cinnamate 4-hydroxylase                                 395   5e-131   Ocimum tenuiflorum [holy basil]
ref|XP_010253046.1|  PREDICTED: trans-cinnamate 4-monooxygenase         395   7e-131   Nelumbo nucifera [Indian lotus]
ref|XP_011089532.1|  PREDICTED: trans-cinnamate 4-monooxygenase         395   1e-130   Sesamum indicum [beniseed]
ref|XP_010252045.1|  PREDICTED: trans-cinnamate 4-monooxygenase         394   1e-130   Nelumbo nucifera [Indian lotus]
ref|XP_006350887.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    395   1e-130   Solanum tuberosum [potatoes]
gb|ABD77493.2|  cinnamic acid 4-hydroxylase                             394   2e-130   Arnebia euchroma
ref|XP_011080651.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    394   3e-130   Sesamum indicum [beniseed]
ref|XP_009601847.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    394   3e-130   Nicotiana tomentosiformis
gb|AGH32777.1|  cinnamic acid 4-hydroxylase                             394   3e-130   Camellia chekiangoleosa
dbj|BAB71716.1|  cinnamic acid 4-hydroxylase                            393   4e-130   Lithospermum erythrorhizon
ref|XP_004970385.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    393   5e-130   
gb|AAG43824.1|AF212318_1  cinnamic acid 4-hydroxylase                   393   5e-130   Capsicum annuum
gb|EYU46023.1|  hypothetical protein MIMGU_mgv1a004904mg                393   6e-130   Erythranthe guttata [common monkey flower]
ref|XP_009766429.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    393   6e-130   Nicotiana sylvestris
gb|AFN44010.1|  cinnamate 4-hydroxylase                                 392   8e-130   Neolamarckia cadamba
gb|KJB83924.1|  hypothetical protein B456_013G271700                    392   9e-130   Gossypium raimondii
gb|ACH56520.1|  cinnamate-4-hydroxylase                                 392   9e-130   Gossypium hirsutum [American cotton]
gb|AAG10196.1|AF286647_1  cinnamate-4-hydroxylase                       392   9e-130   Gossypium arboreum [tree cotton]
gb|ADO16244.1|  cinnamate 4-hydroxylase                                 392   1e-129   Ocimum basilicum [basil]
gb|ACR10242.1|  cinnamate-4-hydroxylase                                 392   1e-129   Canarium album [Chinese white-olive]
gb|AIY32618.1|  cinnamate-4-hydroxylase                                 391   2e-129   Perilla frutescens [beefsteak-mint]
ref|XP_002523952.1|  cinnamate 4-hydroxylase, putative                  391   2e-129   Ricinus communis
gb|ACZ06240.1|  cinnamate 4-hydroxylase 2                               391   2e-129   Gossypium hirsutum [American cotton]
gb|AFY17065.1|  cinnamate 4-hydroxylase 2                               391   3e-129   Panicum virgatum
gb|AEM63593.1|  cinnamate 4-hydroxylase                                 391   3e-129   Leucaena leucocephala [cassie]
sp|P48522.1|TCMO_CATRO  RecName: Full=Trans-cinnamate 4-monooxyge...    390   9e-129   Catharanthus roseus [chatas]
ref|XP_006432069.1|  hypothetical protein CICLE_v10000921mg             389   1e-128   Citrus clementina [clementine]
gb|AEM63594.1|  cinnamate 4-hydroxylase                                 389   1e-128   Leucaena leucocephala [cassie]
gb|AGX85600.1|  coumarate 4-hydroxylase                                 389   1e-128   Scoparia dulcis [escobilla]
gb|AGJ84133.1|  putative trans-cinnamate 4-hydroxylase                  389   2e-128   Hibiscus cannabinus [bimli-jute]
gb|AAG10197.1|  cinnamate-4-hydroxylase                                 389   2e-128   Gossypium arboreum [tree cotton]
dbj|BAB71717.1|  cinnamic acid 4-hydroxylase                            389   2e-128   Lithospermum erythrorhizon
gb|KJB72975.1|  hypothetical protein B456_011G207000                    389   2e-128   Gossypium raimondii
ref|XP_007017089.1|  Cinnamate-4-hydroxylase                            389   3e-128   Theobroma cacao [chocolate]
pir||PC4237  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) C - ...    387   3e-128
ref|XP_012078176.1|  PREDICTED: trans-cinnamate 4-monooxygenase         388   3e-128   Jatropha curcas
emb|CDP04040.1|  unnamed protein product                                381   4e-128   Coffea canephora [robusta coffee]
ref|XP_008657127.1|  PREDICTED: trans-cinnamate 4-monooxygenase         387   8e-128   Zea mays [maize]
gb|ABF69100.1|  trans-cinnamate 4-hydroxylase                           387   8e-128   Populus tremuloides
ref|NP_001275824.1|  cinnamate 4-hydroxylase CYP73                      388   8e-128   Citrus sinensis [apfelsine]
gb|ABF69099.1|  trans-cinnamate 4-hydroxylase                           387   1e-127   Populus tremuloides
gb|AGE10592.1|  cinnamate 4-hydroxylase                                 387   1e-127   Lonicera japonica [Japanese honeysuckle]
gb|AJT59581.1|  cinnamate-4-hydroxylase                                 387   2e-127   Boehmeria nivea [Chinese silk-plant]
gb|ACZ54906.1|  cinnamate 4-hydroxylase                                 386   2e-127   Leucaena leucocephala [cassie]
ref|XP_011015228.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    386   2e-127   Populus euphratica
ref|XP_011041784.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    386   2e-127   Populus euphratica
ref|XP_003564495.1|  PREDICTED: trans-cinnamate 4-monooxygenase         386   3e-127   Brachypodium distachyon [annual false brome]
ref|XP_002325638.1|  trans-cinnamate 4-monooxygenase family protein     386   3e-127   Populus trichocarpa [western balsam poplar]
emb|CDP19477.1|  unnamed protein product                                385   4e-127   Coffea canephora [robusta coffee]
ref|XP_007205045.1|  hypothetical protein PRUPE_ppa004544mg             385   4e-127   Prunus persica
gb|AGJ71350.1|  cinnamate 4-hydroxylase 1                               385   5e-127   Eucalyptus urophylla
ref|XP_007011365.1|  Cinnamate-4-hydroxylase                            385   6e-127   
ref|XP_008240713.1|  PREDICTED: trans-cinnamate 4-monooxygenase         385   6e-127   Prunus mume [ume]
gb|AID16078.1|  cinnamate 4-hydroxylase                                 385   6e-127   Morus alba
ref|XP_002458683.1|  hypothetical protein SORBIDRAFT_03g038160          385   7e-127   Sorghum bicolor [broomcorn]
gb|ADZ54778.1|  trans-cinnamate 4-monooxygenase                         385   7e-127   Prunus avium [gean]
ref|XP_008456253.1|  PREDICTED: trans-cinnamate 4-monooxygenase         384   1e-126   Cucumis melo [Oriental melon]
ref|XP_010685980.1|  PREDICTED: trans-cinnamate 4-monooxygenase         384   1e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|AGG55322.1|  cinnamate 4-hydroxylase                                 384   1e-126   Paeonia lactiflora [common garden peony]
gb|AHL83550.1|  C4H                                                     384   2e-126   Morus alba var. multicaulis
ref|XP_010032943.1|  PREDICTED: trans-cinnamate 4-monooxygenase         384   2e-126   Eucalyptus grandis [rose gum]
ref|XP_010094425.1|  Trans-cinnamate 4-monooxygenase                    383   3e-126   Morus notabilis
gb|AEM63672.1|  cinnamate 4-hydroxylase                                 383   3e-126   Platycodon grandiflorus [balloon-flower]
gb|AID51447.1|  cinnamate 4-hydroxylase 2                               383   4e-126   Astragalus membranaceus
gb|AGN70893.1|  cinammate 4-hydroxylase                                 383   4e-126   Dendrobium officinale
ref|XP_010938024.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    383   5e-126   Elaeis guineensis
dbj|BAJ95120.1|  predicted protein                                      383   5e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEV93475.1|  4-coumarate:CoA ligase                                  382   5e-126   Caragana korshinskii
gb|AHG06398.1|  cinnamic acid 4-hydroxylase                             382   8e-126   Ornithogalum longebracteatum [sea-onion]
ref|XP_010103664.1|  Trans-cinnamate 4-monooxygenase                    382   8e-126   Morus notabilis
gb|AAT39513.1|  cinnamate-4-hydroxylase                                 382   8e-126   Camptotheca acuminata
gb|AFP49808.1|  cinnamate 4-hydroxylase 4                               382   8e-126   Coffea arabica [arabica coffee]
gb|AAC35857.1|  cinnamic acid 4-hydroxylase                             381   8e-126   Capsicum chinense [bonnet pepper]
gb|ABF69101.1|  trans-cinnamate 4-hydroxylase                           382   1e-125   Populus tremuloides
gb|ABF69102.1|  trans-cinnamate 4-hydroxylase                           382   1e-125   Populus tremuloides
sp|Q43054.1|TCMO_POPKI  RecName: Full=Trans-cinnamate 4-monooxyge...    382   1e-125   Populus sieboldii x Populus grandidentata
gb|AEA02458.1|  cinnamate 4-hydroxylase                                 382   1e-125   Prunus armeniaca
ref|XP_002319974.1|  hypothetical protein POPTR_0013s15380g             381   2e-125   Populus trichocarpa [western balsam poplar]
gb|AEA02459.1|  cinnamate 4-hydroxylase                                 381   2e-125   Prunus cerasifera x Prunus munsoniana
gb|ADD54647.1|  cinnamate 4-hydroxylase                                 372   2e-125   Bruguiera gymnorhiza [Burma mangrove]
sp|Q96423.1|TCMO_GLYEC  RecName: Full=Trans-cinnamate 4-monooxyge...    381   2e-125   Glycyrrhiza echinata [hedgehog licorice]
gb|AAU09021.1|  Cinnamic acid 4-hydroxylase                             381   2e-125   Agastache rugosa
gb|ACZ73612.1|  cinnamate 4-hydroxylase                                 381   2e-125   Bambusa oldhamii
gb|AAG50231.1|AF302495_1  cinnamate 4-hydroxylase                       381   2e-125   Populus trichocarpa x Populus deltoides
dbj|BAE72875.1|  Cinnamic acid 4-hydroxylase                            381   2e-125   Glandularia x hybrida [garden verbena]
ref|XP_009354868.1|  PREDICTED: trans-cinnamate 4-monooxygenase         380   3e-125   Pyrus x bretschneideri [bai li]
gb|AFZ78542.1|  cinnamate 4-hydroxylase                                 380   3e-125   Populus tomentosa [Chinese white poplar]
sp|O24312.1|TCMO_POPTM  RecName: Full=Trans-cinnamate 4-monooxyge...    380   4e-125   Populus tremuloides
gb|ACM17896.1|  cinnamate-4-hydroxylase                                 380   5e-125   Rubus occidentalis [black raspberry]
ref|XP_010921158.1|  PREDICTED: trans-cinnamate 4-monooxygenase         380   6e-125   Elaeis guineensis
ref|XP_011021057.1|  PREDICTED: trans-cinnamate 4-monooxygenase         380   7e-125   Populus euphratica
ref|XP_008810838.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    379   8e-125   Phoenix dactylifera
gb|ADN32769.1|  cinnamate 4-hydroxylase                                 379   1e-124   Scutellaria baicalensis [Baikal skullcap]
gb|EMT08179.1|  Trans-cinnamate 4-monooxygenase                         377   1e-124   
gb|AHJ61295.1|  cinnamate-4-hydroxylase                                 379   1e-124   Hordeum vulgare [barley]
gb|ACC63873.1|  trans-cinnamate 4-hydroxylase                           379   1e-124   Populus trichocarpa [western balsam poplar]
gb|ACM69364.1|  cinnamic acid 4-hydroxylase                             379   1e-124   Humulus lupulus [common hop]
gb|ABA59555.1|  cinnamate-4-hydroxylase                                 379   1e-124   Parthenocissus henryana
gb|ACJ37399.1|  trans-cinnamate 4-monooxygenase                         379   1e-124   Echinacea angustifolia [black sampson]
ref|XP_004294725.1|  PREDICTED: trans-cinnamate 4-monooxygenase         379   2e-124   Fragaria vesca subsp. vesca
gb|AIB06733.1|  cinnamate 4-mono-oxygenase                              379   2e-124   Mangifera indica
ref|XP_002881114.1|  cinnamate-4-hydroxylase                            379   2e-124   
sp|Q43240.1|TCMO_ZINVI  RecName: Full=Trans-cinnamate 4-monooxyge...    379   2e-124   Zinnia elegans [garden zinnia]
gb|AHB52741.1|  cinnamate 4-hydroxylase                                 379   2e-124   Pyrus x bretschneideri [bai li]
gb|KHN30609.1|  Trans-cinnamate 4-monooxygenase                         376   3e-124   Glycine soja [wild soybean]
gb|AEK94316.1|  cinnamic acid 4-hydroxylase-like protein                378   3e-124   Pyrus x bretschneideri [bai li]
gb|ADG43134.1|  cinnamate 4-hydroxylase                                 378   4e-124   Isatis tinctoria [woad]
gb|ADT63059.1|  cinnamate 4-hydroxylase                                 374   4e-124   Fagopyrum esculentum
ref|NP_001292707.1|  trans-cinnamate 4-monooxygenase                    378   4e-124   Cucumis sativus [cucumbers]
gb|ABX74779.1|  cinnamate-4-hydroxylase                                 377   5e-124   Rubus coreanus [cha tian pao]
gb|AFD29887.1|  cinnamate 4-hydroxylase                                 377   5e-124   Bambusa emeiensis
gb|AJD25173.1|  cytochrome P450 CYP73A120                               377   5e-124   Salvia miltiorrhiza [Chinese salvia]
emb|CDX84829.1|  BnaA03g14010D                                          377   6e-124   
gb|AIT52342.1|  cinammate 4-hydroxylase 1                               377   6e-124   Daucus carota [carrots]
gb|ABN48717.1|  cinnamate 4-hydroxylase                                 377   6e-124   Salvia miltiorrhiza [Chinese salvia]
gb|EPS68507.1|  cinnamate-4-hydroxylase 1                               374   6e-124   Genlisea aurea
gb|ACE95171.1|  cinnamate-4-hydroxylase                                 377   6e-124   Populus tomentosa [Chinese white poplar]
gb|ABF17875.1|  cinnamate 4-hydroxylase isoform 2                       377   7e-124   Brassica napus [oilseed rape]
gb|ABX74781.1|  cinnamate-4-hydroxylase                                 377   8e-124   Rubus sp. SSL-2007
emb|CDY23995.1|  BnaC03g16960D                                          377   8e-124   Brassica napus [oilseed rape]
gb|AAS48416.1|  cinammate 4-hydroxylase                                 377   8e-124   Allium cepa
ref|NP_001281035.1|  trans-cinnamate 4-monooxygenase                    377   9e-124   Malus domestica [apple tree]
gb|AAT68775.2|  trans-cinnamate 4-hydroxylase                           373   9e-124   Camellia sinensis [black tea]
ref|XP_008792249.1|  PREDICTED: trans-cinnamate 4-monooxygenase         377   9e-124   Phoenix dactylifera
gb|KHN40993.1|  Trans-cinnamate 4-monooxygenase                         374   1e-123   Glycine soja [wild soybean]
sp|Q04468.1|TCMO_HELTU  RecName: Full=Trans-cinnamate 4-monooxyge...    377   1e-123   Helianthus tuberosus [Jerusalem artichoke]
gb|ABC75596.1|  cinnamate 4-hydroxylase                                 377   1e-123   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006410152.1|  hypothetical protein EUTSA_v10016545mg             377   1e-123   Eutrema salsugineum [saltwater cress]
ref|NP_180607.1|  trans-cinnamate 4-monooxygenase                       376   2e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAC99993.1|  cinnamate 4-hydroxylase                                 376   2e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CBI15809.3|  unnamed protein product                                375   2e-123   Vitis vinifera
emb|CAP08828.1|  cinnamate-4-hydroxylase                                376   2e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08829.1|  cinnamate-4-hydroxylase                                376   2e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAB58355.1|  cinnamate-4-hydroxylase                                 376   2e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08846.1|  cinnamate-4-hydroxylase                                375   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132739.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    376   2e-123   Brassica rapa
gb|AFG30055.1|  cinnamate-4-hydroxylase                                 376   2e-123   Malus hybrid cultivar
gb|ACY78690.1|  trans-cinnamate 4-monooxygenase                         376   2e-123   Cynara cardunculus var. scolymus [artichoke]
gb|AGU91429.1|  trans-cinnamate 4-monooxygenase                         375   3e-123   Chrysanthemum boreale
gb|KHG02507.1|  Cytochrome P450 protein                                 377   3e-123   Gossypium arboreum [tree cotton]
ref|XP_003544934.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    375   3e-123   Glycine max [soybeans]
emb|CAP08827.1|  cinnamate-4-hydroxylase                                375   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266238.1|  PREDICTED: trans-cinnamate 4-monooxygenase         375   3e-123   Vitis vinifera
ref|XP_010510361.1|  PREDICTED: trans-cinnamate 4-monooxygenase         375   3e-123   Camelina sativa [gold-of-pleasure]
gb|AAC49187.2|  trans-cinnamic acid hydroxylase                         375   4e-123   Pisum sativum [garden pea]
gb|ADO16181.1|  cytochrome P450 mono-oxygenase                          375   4e-123   Artemisia annua [sweet Annie]
sp|Q43067.2|TCMO_PEA  RecName: Full=Trans-cinnamate 4-monooxygena...    375   4e-123   Pisum sativum [garden pea]
gb|AEH68208.1|  cinnamate 4-hydroxylase                                 375   5e-123   Astragalus mongholicus
gb|AAN63028.1|  cinnamate 4-hydroxylase                                 375   5e-123   Ruta graveolens
sp|Q9AR74.1|TCMO_RUTGR  RecName: Full=Trans-cinnamate 4-monooxyge...    375   6e-123   Ruta graveolens
gb|AGC29944.1|  CYP73A107                                               375   6e-123   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|EYU36901.1|  hypothetical protein MIMGU_mgv1a004876mg                375   7e-123   Erythranthe guttata [common monkey flower]
dbj|BAI77480.1|  cinnamate-4-hydroxylase                                375   7e-123   Brassica rapa
ref|NP_001237317.1|  trans-cinnamate 4-monooxygenase                    375   7e-123   Glycine max [soybeans]
gb|AFV47361.1|  C4H                                                     374   7e-123   Helichrysum aureonitens
ref|XP_010414263.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    374   8e-123   Camelina sativa [gold-of-pleasure]
gb|AFD36436.1|  cinnamate 4-hydroxylase 1                               374   8e-123   Astragalus membranaceus
gb|KGN46762.1|  hypothetical protein Csa_6G133710                       370   9e-123   Cucumis sativus [cucumbers]
gb|ACF74449.1|  trans-cinnamate 4-monooxygenase                         374   1e-122   Echinacea angustifolia [black sampson]
ref|XP_008782669.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    374   1e-122   Phoenix dactylifera
ref|NP_001266151.1|  trans-cinnamate 4-monooxygenase                    374   1e-122   
gb|ACR44227.1|  C4H                                                     374   1e-122   Glycine max [soybeans]
emb|CDX97826.1|  BnaC04g41130D                                          374   2e-122   
sp|P37115.1|TCMO_VIGRR  RecName: Full=Trans-cinnamate 4-monooxyge...    374   2e-122   Vigna radiata var. radiata [golden gram]
sp|Q43033.1|TCMO_PETCR  RecName: Full=Trans-cinnamate 4-monooxyge...    374   2e-122   Petroselinum crispum
gb|ABQ53544.1|  cinnamic acid 4-hydroxylase                             363   2e-122   Arachis diogoi
gb|KFK22945.1|  hypothetical protein AALP_AAs47561U000100               373   2e-122   Arabis alpina [alpine rockcress]
ref|XP_007146898.1|  hypothetical protein PHAVU_006G079700g             373   2e-122   Phaseolus vulgaris [French bean]
ref|XP_009374388.1|  PREDICTED: trans-cinnamate 4-monooxygenase         375   3e-122   Pyrus x bretschneideri [bai li]
dbj|BAA24355.1|  trans-cinnamate 4-hydroxylase                          373   3e-122   Arabidopsis thaliana [mouse-ear cress]
gb|ABF17873.1|  cinnamate 4-hydroxylase isoform 1                       373   4e-122   Brassica napus [oilseed rape]
ref|XP_003616037.1|  Trans-cinnamate 4-monooxygenase                    373   4e-122   Medicago truncatula
ref|XP_010922761.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    372   4e-122   Elaeis guineensis
dbj|BAF81522.1|  cinnamate-4-hydroxylase                                372   6e-122   Brassica rapa
ref|XP_009141068.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    372   8e-122   Brassica rapa
gb|AIS92509.1|  cinnamate 4-hydroxylase                                 372   8e-122   Epimedium sagittatum
ref|XP_008788521.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    372   1e-121   Phoenix dactylifera
ref|XP_006294053.1|  hypothetical protein CARUB_v10023044mg             372   1e-121   Capsella rubella
gb|AGP25594.1|  cinnamate 4-hydroxylase                                 372   1e-121   Aquilaria sinensis
prf||2209439A  cytochrome P450 monooxygenase                            371   1e-121
gb|AGO03798.1|  cytochrome P450-like protein                            371   1e-121   Tanacetum cinerariifolium [pyrethrum]
ref|XP_004500376.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    371   2e-121   Cicer arietinum [garbanzo]
ref|XP_007142041.1|  hypothetical protein PHAVU_008G247400g             371   2e-121   Phaseolus vulgaris [French bean]
ref|XP_010931381.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    370   3e-121   
ref|NP_001288861.1|  trans-cinnamate 4-monooxygenase                    370   3e-121   Brassica rapa
gb|AHG97392.1|  C4H catalytic cinnamic acid-4-hydroxylase               370   3e-121   Ageratina adenophora
gb|AAG09206.1|AF175276_1  trans-cinnamic acid hydroxylase               364   3e-121   Pisum sativum [garden pea]
gb|ACB78015.1|  cinnamic acid 4-hydroxylase                             370   3e-121   Trifolium pratense [peavine clover]
dbj|BAJ17666.1|  cinnamate 4-hydroxylase                                370   5e-121   Gynura bicolor
ref|XP_010522015.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    370   6e-121   Tarenaya hassleriana [spider flower]
gb|AHY94893.1|  cinnamate-4-hydroxylase                                 369   7e-121   Prunella vulgaris
ref|XP_010542699.1|  PREDICTED: trans-cinnamate 4-monooxygenase         369   9e-121   Tarenaya hassleriana [spider flower]
ref|XP_006842509.1|  PREDICTED: trans-cinnamate 4-monooxygenase         369   9e-121   Amborella trichopoda
gb|ACB78016.1|  cinnamic acid 4-hydroxylase                             369   9e-121   Trifolium pratense [peavine clover]
gb|AAG09205.1|AF175275_1  trans-cinnamic acid hydroxylase               369   1e-120   Pisum sativum [garden pea]
gb|ACB78014.1|  cinnamic acid 4-hydroxylase                             369   2e-120   Trifolium pratense [peavine clover]
emb|CAP08847.1|  cinnamate-4-hydroxylase                                358   2e-120   Arabidopsis lyrata [lyrate rockcress]
gb|ABE68874.1|  cinnamate 4-hydroxylase                                 368   2e-120   Brassica rapa subsp. pekinensis [bai cai]
gb|AAO62904.1|  cinnamate 4-hydroxylase                                 368   3e-120   Ammi majus [ameo mayor]
gb|AEA72281.1|  cinnamate 4-hydroxylase                                 367   7e-120   Angelica gigas
gb|AJD22263.1|  cinnamate 4-hydroxylase                                 366   1e-119   Angelica dahurica
gb|AFU54390.1|  cinnamate 4-hydroxylase                                 365   2e-119   Fagopyrum tataricum [Kangra buckwheat]
ref|XP_009403855.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    361   4e-119   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG09207.1|AF175277_1  trans-cinnamic acid hydroxylase               358   1e-118   Pisum sativum [garden pea]
gb|ABF58026.1|  cinnamate-4-hydroxylate-like                            361   2e-118   Hibiscus cannabinus [bimli-jute]
ref|XP_008363432.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    355   2e-118   
sp|P37114.1|TCMO_MEDSA  RecName: Full=Trans-cinnamate 4-monooxyge...    362   4e-118   Medicago sativa [alfalfa]
gb|ACY06865.2|  cinnamate 4-hydroxylase                                 362   9e-118   Astragalus chrysochlorus
gb|EMS54616.1|  Trans-cinnamate 4-monooxygenase                         359   9e-118   Triticum urartu
gb|AHA84274.1|  trans-cinnamate 4-monooxygenase                         362   1e-117   Phaseolus vulgaris [French bean]
gb|ABX75854.1|  cinnamate 4-hydroxylase                                 362   1e-117   Acacia auriculiformis x Acacia mangium
gb|AEN19718.1|  cinnamate 4-hydroxylase                                 359   6e-117   Acacia auriculiformis x Acacia mangium
gb|AID69233.1|  cinnamate 4-hydroxylase                                 359   9e-117   Garcinia mangostana [mangosteen]
ref|XP_006410151.1|  hypothetical protein EUTSA_v10016544mg             358   1e-116   Eutrema salsugineum [saltwater cress]
emb|CDX84830.1|  BnaA03g14000D                                          357   5e-116   
ref|XP_009354880.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    357   5e-116   Pyrus x bretschneideri [bai li]
gb|ACN40359.1|  unknown                                                 356   1e-115   Picea sitchensis
gb|AAW70021.1|  cinnamic acid 4-hydroxylase                             355   5e-115   Ginkgo biloba [ginkgo]
ref|XP_009421412.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    354   6e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421411.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    354   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410039.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    353   2e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132738.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    351   9e-114   Brassica rapa
gb|AAD23378.1|AF096998_1  trans-cinnamate 4-hydroxylase                 350   2e-113   Pinus taeda
emb|CDP18607.1|  unnamed protein product                                340   4e-113   Coffea canephora [robusta coffee]
ref|XP_009141067.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    348   1e-112   Brassica rapa
emb|CDY29671.1|  BnaA04g17560D                                          347   4e-112   Brassica napus [oilseed rape]
ref|XP_009354901.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    345   3e-111   
gb|ABR18390.1|  unknown                                                 335   3e-111   Picea sitchensis
gb|AFX98061.1|  cinnamate 4-hydroxylase                                 342   3e-110   Cunninghamia lanceolata [China fir]
emb|CDX97827.1|  BnaC04g41120D                                          341   7e-110   
ref|XP_004151467.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    337   3e-108   Cucumis sativus [cucumbers]
ref|XP_008457287.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    334   6e-107   Cucumis melo [Oriental melon]
gb|AHF20175.1|  cinnamate 4-hydroxylase                                 328   2e-106   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009416323.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    332   4e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY76296.1|  hypothetical protein OsI_04230                          330   9e-106   Oryza sativa Indica Group [Indian rice]
dbj|BAJ96982.1|  predicted protein                                      330   2e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32263.1|  Trans-cinnamate 4-monooxygenase                         328   9e-105   
gb|EAZ35606.1|  hypothetical protein OsJ_19896                          327   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EYU36905.1|  hypothetical protein MIMGU_mgv1a004883mg                328   2e-104   Erythranthe guttata [common monkey flower]
ref|XP_002461939.1|  hypothetical protein SORBIDRAFT_02g010910          326   6e-104   Sorghum bicolor [broomcorn]
emb|CDM82046.1|  unnamed protein product                                325   8e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003568699.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    325   1e-103   Brachypodium distachyon [annual false brome]
gb|AAG17469.1|AF123610_8  cytochrome P450                               325   2e-103   Triticum aestivum [Canadian hard winter wheat]
gb|ACM47732.1|  cinnamate 4-hydroxylase                                 318   2e-103   Polypodium aureum
ref|XP_011089530.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    323   1e-102   Sesamum indicum [beniseed]
gb|EMT12860.1|  Trans-cinnamate 4-monooxygenase                         322   2e-102   
ref|NP_001149158.1|  trans-cinnamate 4-monooxygenase                    322   3e-102   
dbj|BAK03000.1|  predicted protein                                      322   3e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFY17064.1|  cinnamate 4-hydroxylase 1                               321   4e-102   Panicum virgatum
ref|NP_001140726.1|  putative cytochrome P450 superfamily protein       320   9e-102   Zea mays [maize]
gb|EYU36902.1|  hypothetical protein MIMGU_mgv1a004808mg                320   2e-101   Erythranthe guttata [common monkey flower]
ref|XP_006654260.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    319   2e-101   Oryza brachyantha
gb|EPS58735.1|  cinnamate 4-hydroxylase                                 318   4e-101   Genlisea aurea
gb|EAY97535.1|  hypothetical protein OsI_19463                          318   9e-101   Oryza sativa Indica Group [Indian rice]
ref|NP_001055190.1|  Os05g0320700                                       318   9e-101   
gb|AGW27201.1|  cinnamate 4-hydroxylase 2                               313   2e-100   Salvia miltiorrhiza [Chinese salvia]
gb|EYU36906.1|  hypothetical protein MIMGU_mgv1a025595mg                317   3e-100   Erythranthe guttata [common monkey flower]
gb|AHI17493.2|  cinnamate 4-hydroxylase                                 317   3e-100   Dryopteris fragrans
gb|ADO24190.1|  cinnamate 4-hydroxylase                                 316   6e-100   Allium sativum
ref|NP_001140681.1|  putative cytochrome P450 superfamily protein       315   6e-100   Zea mays [maize]
ref|XP_011089529.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    313   5e-99    Sesamum indicum [beniseed]
gb|AER39775.1|  CYP73A91                                                313   7e-99    Festuca rubra subsp. commutata
ref|XP_001773868.1|  predicted protein                                  312   1e-98    
gb|AER39776.1|  CYP73A91-2                                              311   2e-98    Festuca rubra subsp. commutata
gb|ADF28535.1|  cinnamate 4-hydroxylase                                 311   4e-98    Physcomitrella patens
gb|AER39778.1|  CYP73A91-4                                              311   5e-98    Festuca rubra subsp. commutata
ref|XP_001781223.1|  predicted protein                                  311   5e-98    
gb|AER39777.1|  CYP73A91-3                                              310   6e-98    Festuca rubra subsp. commutata
ref|XP_011089531.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    310   1e-97    
gb|AGO02171.1|  cinnamate 4-hydroxylase                                 301   1e-97    Nekemias grossedentata
ref|XP_002980756.1|  trans-cinnamate 4-hydroxylase                      304   4e-95    
emb|CAK95274.1|  cinnamate-4-hydroxylase                                292   5e-95    
ref|XP_002977018.1|  trans-cinnamate 4-hydroxylase                      303   1e-94    
gb|ADF28536.1|  cinnamate 4-hydroxylase                                 301   3e-94    
gb|AFL65041.1|  trans-cinnamate 4-hydroxylase                           301   4e-94    
emb|CDY23996.1|  BnaC03g16950D                                          297   6e-93    
gb|AFP89925.1|  cinnamate 4-hydroxylase                                 285   4e-92    
gb|AFP89917.1|  cinnamate 4-hydroxylase                                 284   9e-92    
gb|ABV80353.1|  cytochrome P450-dependent monooxygenase                 295   1e-91    
gb|ACE88962.1|  cinnamic acid 4-hydroxylase                             292   3e-91    
gb|AHY28686.1|  cinnamate 4-hydroxylase 1                               281   1e-90    
gb|ACC63872.1|  trans-cinnamate 4-hydroxylase                           292   2e-90    
gb|AFP89924.1|  cinnamate 4-hydroxylase                                 280   2e-90    
ref|XP_001781937.1|  predicted protein                                  291   2e-90    
gb|AIT52343.1|  cinammate 4-hydroxylase 2                               285   2e-90    
ref|XP_002452044.1|  hypothetical protein SORBIDRAFT_04g017460          291   3e-90    
ref|XP_011017615.1|  PREDICTED: cytochrome P450 CYP73A100-like          290   8e-90    
ref|XP_006850963.1|  PREDICTED: cytochrome P450 CYP73A100               289   1e-89    
gb|AIE16481.1|  cinnamate 4-hydroxylase                                 278   2e-89    
ref|XP_011648970.1|  PREDICTED: cytochrome P450 CYP73A100-like          280   2e-88    
gb|EMS49797.1|  Trans-cinnamate 4-monooxygenase                         287   2e-88    
ref|XP_008450760.1|  PREDICTED: cytochrome P450 CYP73A100-like          286   5e-88    
ref|NP_001046814.1|  Os02g0467000                                       286   5e-88    
ref|NP_001046819.1|  Os02g0467600                                       286   5e-88    
gb|AGE10620.1|  cinnamate 4-hydroxylase                                 275   6e-88    
ref|XP_006360653.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    285   7e-88    
ref|XP_010046885.1|  PREDICTED: cytochrome P450 CYP73A100-like          285   8e-88    
gb|AGJ71351.1|  cinnamate 4-hydroxylase 2                               285   9e-88    
ref|XP_004152894.1|  PREDICTED: cytochrome P450 CYP73A100-like          285   1e-87    
ref|XP_002266142.1|  PREDICTED: cytochrome P450 CYP73A100               284   2e-87    
ref|XP_002534996.1|  cinnamate 4-hydroxylase, putative                  283   3e-87    
ref|XP_011078197.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    279   4e-87    
ref|XP_001773101.1|  predicted protein                                  281   5e-87    
ref|XP_006647305.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    281   6e-87    
gb|AAK62344.1|  elicitor-inducible cytochrome P450                      282   1e-86    
ref|XP_009779123.1|  PREDICTED: cytochrome P450 CYP73A100-like          282   1e-86    
emb|CAN70035.1|  hypothetical protein VITISV_027249                     282   1e-86    
ref|XP_008450720.1|  PREDICTED: cytochrome P450 CYP73A100-like          282   1e-86    
gb|EMT17866.1|  Trans-cinnamate 4-monooxygenase                         275   1e-86    
ref|XP_004240122.1|  PREDICTED: cytochrome P450 CYP73A100-like          282   1e-86    
gb|ACR36061.1|  unknown                                                 282   1e-86    
ref|XP_008798169.1|  PREDICTED: cytochrome P450 CYP73A100-like          282   1e-86    
ref|NP_001151365.1|  trans-cinnamate 4-monooxygenase                    281   2e-86    
ref|XP_008450772.1|  PREDICTED: cytochrome P450 CYP73A100-like          281   2e-86    
ref|XP_002266037.1|  PREDICTED: cytochrome P450 CYP73A100               281   2e-86    
ref|XP_006647306.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    281   2e-86    
ref|XP_010928775.1|  PREDICTED: cytochrome P450 CYP73A100-like          281   3e-86    
ref|XP_010927178.1|  PREDICTED: cytochrome P450 CYP73A100-like          280   4e-86    
ref|XP_012084289.1|  PREDICTED: cytochrome P450 CYP73A100-like          279   2e-85    
ref|XP_009618442.1|  PREDICTED: cytochrome P450 CYP73A100-like          279   2e-85    
ref|XP_007225069.1|  hypothetical protein PRUPE_ppa018282mg             277   2e-85    
ref|XP_008450733.1|  PREDICTED: cytochrome P450 CYP73A100-like          278   3e-85    
ref|XP_008223950.1|  PREDICTED: cytochrome P450 CYP73A100-like          278   3e-85    
gb|KGN61199.1|  hypothetical protein Csa_2G068700                       277   5e-85    
ref|XP_009387808.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    268   5e-85    
ref|XP_004299767.1|  PREDICTED: cytochrome P450 CYP73A100-like          277   6e-85    
ref|XP_011648971.1|  PREDICTED: cytochrome P450 CYP73A100-like          277   7e-85    
gb|AGE10593.1|  cinnamate 4-hydroxylase                                 277   8e-85    
ref|XP_010106946.1|  Trans-cinnamate 4-monooxygenase                    280   2e-84    
dbj|BAJ98052.1|  predicted protein                                      276   2e-84    
ref|XP_010263371.1|  PREDICTED: cytochrome P450 CYP73A100-like          276   4e-84    
gb|AIE16514.1|  cinnamate 4-hydroxylase                                 264   4e-84    
ref|XP_007142896.1|  hypothetical protein PHAVU_007G026000g             274   2e-83    
ref|XP_003574953.1|  PREDICTED: cytochrome P450 CYP73A100-like          273   3e-83    
ref|XP_010533060.1|  PREDICTED: cytochrome P450 CYP73A100-like          273   3e-83    
ref|XP_010669584.1|  PREDICTED: cytochrome P450 CYP73A100-like          273   4e-83    
gb|AAD11427.1|  cinnamate 4-hydroxylase                                 273   5e-83    
ref|XP_009417516.1|  PREDICTED: cytochrome P450 CYP73A100-like          272   5e-83    
gb|AHF20176.1|  cinnamate 4-hydroxylase                                 272   6e-83    
ref|XP_009391094.1|  PREDICTED: cytochrome P450 CYP73A100-like          268   2e-82    
gb|KDO62016.1|  hypothetical protein CISIN_1g012770mg                   269   2e-82    
ref|XP_007014539.1|  Trans-cinnamate 4-monooxygenase                    270   4e-82    
ref|XP_003555891.1|  PREDICTED: trans-cinnamate 4-monooxygenase-l...    270   6e-82    
emb|CAA70595.1|  cinnamate 4-hydroxylase                                270   6e-82    
ref|XP_006453189.1|  hypothetical protein CICLE_v10008125mg             268   7e-82    
gb|AAV36369.1|  cinnamate 4-hydroxylase                                 261   1e-81    
gb|AAV36378.1|  cinnamate 4-hydroxylase                                 261   1e-81    
ref|NP_001275769.1|  cinnamate 4-hydroxylase CYP73                      269   1e-81    
gb|KHN11432.1|  Trans-cinnamate 4-monooxygenase                         268   5e-81    
gb|AEK79567.1|  cinnamate 4-hydroxylase                                 259   5e-81    
ref|XP_004497107.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    268   5e-81    
sp|H2DH22.1|C7A10_PANGI  RecName: Full=Cytochrome P450 CYP73A100        267   7e-81    
emb|CDP12494.1|  unnamed protein product                                266   1e-80    
dbj|BAF03070.1|  cinnamate 4-hydroxylase                                258   2e-80    
ref|XP_008782811.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    265   2e-80    
ref|XP_003637406.1|  Trans-cinnamate 4-monooxygenase                    264   1e-79    
dbj|BAF03071.1|  cinnamate 4-hydroxylase                                246   7e-76    
gb|AHY28705.1|  trans-cinnamate 4-hydroxylase 2                         242   1e-75    
emb|CBI40667.3|  unnamed protein product                                248   2e-75    
gb|AHY28711.1|  trans-cinnamate 4-hydroxylase 2                         241   4e-75    
gb|AHY28709.1|  trans-cinnamate 4-hydroxylase 2                         241   4e-75    
gb|EMS65504.1|  Trans-cinnamate 4-monooxygenase                         251   1e-74    
ref|NP_001172628.1|  Os01g0820000                                       251   1e-74    
gb|AAV33887.1|  trans-cinnamate 4-hydroxylase 2                         239   1e-74    
gb|AAV33906.1|  trans-cinnamate 4-hydroxylase 2                         239   1e-74    
gb|AAV33894.1|  trans-cinnamate 4-hydroxylase 2                         238   5e-74    
gb|ABI78932.1|  cinnamate 4-hydroxylase                                 241   9e-74    
pir||PC4236  trans-cinnamate 4-monooxygenase (EC 1.14.13.11) B - ...    240   6e-72 
gb|EMT22866.1|  Trans-cinnamate 4-monooxygenase                         243   2e-71    
dbj|BAE20400.1|  cinnamate 4-hydroxylase                                234   4e-71    
emb|CAA70596.1|  cinnamate 4-hydroxylase                                236   5e-71    
gb|AHY28710.1|  trans-cinnamate 4-hydroxylase 2                         227   5e-70    
gb|KHN05578.1|  Trans-cinnamate 4-monooxygenase                         224   7e-65    
dbj|BAE93150.1|  trans-cinnamate 4-monooxygenase                        212   2e-64    
gb|AHF20174.1|  cinnamate 4-hydroxylase                                 200   6e-60    
ref|XP_008355062.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    196   2e-58    
gb|AAN03651.1|  putative C4H                                            192   6e-57    
gb|AFR37682.1|  cinnamate 4-hydroxylase                                 192   6e-57    
gb|AFR37694.1|  cinnamate 4-hydroxylase                                 192   6e-57    
gb|AFR37685.1|  cinnamate 4-hydroxylase                                 192   7e-57    
gb|AFR37715.1|  cinnamate 4-hydroxylase                                 192   7e-57    
gb|EPS57212.1|  hypothetical protein M569_17608                         194   4e-55    
gb|AHA92090.1|  cinnamate 4-hydroxylase                                 189   6e-53    
gb|ACH59163.1|  trans-cinnamate 4-hydroxylase                           168   9e-48    
dbj|BAO56856.1|  cinnamate-4-hydroxylase                                171   3e-47    
ref|XP_006596898.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    166   4e-46    
ref|XP_008363435.1|  PREDICTED: trans-cinnamate 4-monooxygenase-like    163   1e-45    
gb|AGG18100.1|  cinnamate-4-hydroxylase                                 165   2e-45    
gb|AGG18107.1|  cinnamate-4-hydroxylase                                 164   4e-45    
gb|AEE39521.1|  cinnamate 4 hydroxylase                                 155   7e-43    
gb|EYU18589.1|  hypothetical protein MIMGU_mgv1a004793mg                161   3e-41    
gb|AFP49812.1|  4-coumaric acid 3`-hydroxylase 25                       157   9e-40    
gb|ACO25188.1|  p-coumaroyl ester 3'-hydroxylase                        156   1e-39    
gb|EYU42910.1|  hypothetical protein MIMGU_mgv1a004732mg                156   1e-39    
ref|XP_009141948.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    156   2e-39    
gb|AFP49342.1|  trans-cinnamate 4-hydroxylase                           146   2e-39    
dbj|BAC44836.1|  cytochrome P-450                                       155   3e-39    
emb|CDP06248.1|  unnamed protein product                                155   3e-39    
gb|ABO77958.1|  p-coumaroyl quinate/shikimate 3'-hydroxylase            155   3e-39    
ref|XP_008443234.1|  PREDICTED: cytochrome P450 98A2                    155   3e-39    
ref|XP_002440001.1|  hypothetical protein SORBIDRAFT_09g024210          155   4e-39    
emb|CAK22403.1|  p-coumarate 3-hydroxylase                              154   4e-39    
emb|CDY06955.1|  BnaA04g23600D                                          155   4e-39    
ref|XP_004961648.1|  PREDICTED: cytochrome P450 98A1-like               155   6e-39    
gb|AEG19446.1|  CYP98A22                                                154   8e-39    
ref|XP_006836224.1|  PREDICTED: cytochrome P450 98A2                    154   9e-39    
gb|KFK42328.1|  hypothetical protein AALP_AA2G241900                    154   1e-38    
emb|CDY22488.1|  BnaC03g22980D                                          151   1e-38    
gb|AAL06992.1|  At2g40890/T20B5.9                                       151   1e-38    
ref|XP_002881744.1|  CYP98A3                                            154   1e-38    
gb|AAB86449.2|  putative cytochrome P450                                151   1e-38    
ref|NP_001142110.1|  putative cytochrome P450 superfamily protein       154   1e-38    
gb|ABB83676.1|  putative p-coumaroyl 3'-hydroxylase CYP98A-C1           153   3e-38    
emb|CDY14751.1|  BnaC04g47480D                                          152   3e-38    
ref|XP_008347926.1|  PREDICTED: cytochrome P450 98A2-like               150   3e-38    
dbj|BAO20879.1|  coumaroyl shikimate 3-hydroxylase 1                    152   3e-38    
ref|XP_006482026.1|  PREDICTED: cytochrome P450 98A2-like               152   4e-38    
ref|XP_006430495.1|  hypothetical protein CICLE_v10011520mg             152   4e-38    
gb|AFZ78540.1|  p-coumarate 3-hydroxylase                               151   7e-38    
ref|XP_008786871.1|  PREDICTED: cytochrome P450 98A2-like isoform X2    150   7e-38    
emb|CBI24058.3|  unnamed protein product                                148   8e-38    
ref|XP_009596523.1|  PREDICTED: cytochrome P450 98A2-like               151   8e-38    
gb|ACX48910.1|  p-coumaroyl-shikimate 3'-hydroxylase                    151   9e-38    
gb|ACV91106.1|  p-coumaroyl-shikimate 3'-hydroxylase                    151   9e-38    
ref|NP_850337.1|  cytochrome P450 98A3                                  151   9e-38    
ref|XP_010111218.1|  Cytochrome P450 98A2                               151   9e-38    
gb|AAU44038.1|  putative cytochrome P450                                151   9e-38    
gb|ABC59086.1|  cytochrome P450 monooxygenase CYP98A37                  151   1e-37    
ref|XP_008786870.1|  PREDICTED: cytochrome P450 98A2-like isoform X1    151   1e-37    
gb|AEM63674.1|  p-coumarate 3'-hydroxylase                              151   1e-37    
ref|XP_002526203.1|  cytochrome P450, putative                          150   1e-37    
gb|AHY28670.1|  coumarate 3-hydroxylase                                 148   1e-37    
ref|NP_001055922.1|  Os05g0494000                                       150   1e-37    
gb|ABR18076.1|  unknown                                                 150   2e-37    
ref|XP_008365319.1|  PREDICTED: cytochrome P450 98A2-like               150   2e-37    
gb|AAV36185.1|  coumarate 3-hydroxylase                                 147   2e-37    
gb|AFD29885.1|  p-coumarate 3-hydroxylase                               150   2e-37    
gb|AAV36205.1|  coumarate 3-hydroxylase                                 147   2e-37    
ref|XP_006294048.1|  hypothetical protein CARUB_v10023039mg             150   2e-37    
ref|XP_009355326.1|  PREDICTED: cytochrome P450 98A2-like               150   2e-37    
gb|AEH20527.1|  coumarate 3-hydroxylase                                 150   2e-37    
emb|CDY35432.1|  BnaA03g19280D                                          150   2e-37    
gb|ACG25686.1|  cytochrome P450 CYP98A29                                150   2e-37    
gb|KHG28386.1|  Cytochrome P450                                         147   2e-37    
ref|XP_009133464.1|  PREDICTED: cytochrome P450 98A3                    150   2e-37    
ref|XP_009770888.1|  PREDICTED: cytochrome P450 98A2-like isoform X2    150   2e-37    
ref|XP_004249116.1|  PREDICTED: cytochrome P450 98A2-like               150   2e-37    
ref|XP_006841358.1|  PREDICTED: cytochrome P450 71A1                    150   2e-37    
ref|XP_010517530.1|  PREDICTED: cytochrome P450 98A3                    150   2e-37    
ref|XP_009770887.1|  PREDICTED: cytochrome P450 98A2-like isoform X1    150   3e-37    
ref|XP_010508793.1|  PREDICTED: cytochrome P450 98A3-like isoform X1    150   3e-37    
gb|AAT06912.1|  cytochrome P450                                         150   3e-37    
ref|XP_010505845.1|  PREDICTED: cytochrome P450 98A3-like               150   3e-37    
ref|XP_008378903.1|  PREDICTED: cytochrome P450 98A2-like               150   3e-37    
ref|XP_009413956.1|  PREDICTED: cytochrome P450 98A2                    150   3e-37    
ref|XP_003521103.1|  PREDICTED: cytochrome P450 98A2-like               150   3e-37    
ref|XP_010508794.1|  PREDICTED: cytochrome P450 98A3-like isoform X2    150   3e-37    
gb|AAL99201.1|  p-coumaroyl shikimate 3'-hydroxylase isoform 2          149   4e-37    
gb|ADO16250.1|  p-coumaroyl shikimate 3'-hydroxylase                    149   4e-37    
ref|XP_010525432.1|  PREDICTED: cytochrome P450 98A3                    149   4e-37    
ref|XP_010931545.1|  PREDICTED: cytochrome P450 98A2-like               149   4e-37    
gb|AGN54071.1|  cytochrome P450 monooxygenase                           149   4e-37    
gb|AAL99200.1|  p-coumaroyl shikimate 3'-hydroxylase isoform 1          149   5e-37    
ref|XP_002308860.1|  Cytochrome P450 98A3 family protein                149   5e-37    
gb|AAS57921.1|  hydroxylase-like cytochrome P450 CASS                   149   5e-37    
ref|XP_006364777.1|  PREDICTED: cytochrome P450 98A2-like               149   6e-37    
gb|KDP35769.1|  hypothetical protein JCGZ_10726                         149   6e-37    
ref|XP_006411356.1|  hypothetical protein EUTSA_v10016538mg             149   6e-37    
ref|XP_012074684.1|  PREDICTED: cytochrome P450 98A2                    149   7e-37    
gb|AFX98060.1|  p-coumarate 3-hydroxylase                               149   7e-37    
ref|XP_011040720.1|  PREDICTED: cytochrome P450 98A2                    149   7e-37    
gb|AFP49813.1|  4-coumaric acid 3`-hydroxylase 34                       149   8e-37    
ref|XP_002526202.1|  cytochrome P450, putative                          147   8e-37    
ref|XP_009355325.1|  PREDICTED: cytochrome P450 98A2-like               149   9e-37    
ref|XP_002323218.2|  hypothetical protein POPTR_0016s03090g             148   9e-37    
emb|CAD20576.2|  putative cytochrome P450                               148   9e-37    
ref|XP_003568200.1|  PREDICTED: cytochrome P450 98A1                    148   1e-36    
ref|XP_001783465.1|  predicted protein                                  148   1e-36    
dbj|BAE98524.1|  cytochrome P450 like protein                           148   1e-36    
gb|EYU18590.1|  hypothetical protein MIMGU_mgv1a004789mg                148   1e-36    
ref|XP_009628880.1|  PREDICTED: cytochrome P450 98A2-like               148   1e-36    
gb|ABB83677.1|  putative p-coumaroyl 3'-hydroxylase CYP98A-C2           148   1e-36    
emb|CDP19231.1|  unnamed protein product                                148   1e-36    
gb|ABY85195.1|  p-coumaryl-CoA 3'-hydroxylase                           148   1e-36    
emb|CAE47490.1|  cytochrome P450                                        148   2e-36    
ref|XP_011041370.1|  PREDICTED: cytochrome P450 98A2-like               147   2e-36    
ref|XP_002283338.1|  PREDICTED: cytochrome P450 98A2                    147   2e-36    
gb|AFQ37421.1|  p-coumaroyl quinate/shikimate 3'-hydroxylase            147   2e-36    
gb|AAL47685.1|  p-coumarate 3-hydroxylase                               147   2e-36    
ref|XP_004136631.1|  PREDICTED: cytochrome P450 98A2                    147   2e-36    
gb|ADG08112.1|  4-coumarate 3-hydroxylase                               147   2e-36    



>gb|ADB65927.1| cinnamate 4-hydroxylase [Ipomoea batatas]
Length=505

 Score =   430 bits (1106),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 238/244 (98%), Positives = 240/244 (98%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTKGMDNNS KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKGMDNNSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNPG+QKKLR+EIDAVLGPG QLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNNPGIQKKLREEIDAVLGPGVQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNPSTWKNPEEFRPERFFEEEKHVEANGNDFRFLPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNPEEFRPERFFEEEKHVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGIVLGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGIVLGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|AHJ60265.1| cinnamate 4-monooxygenase [Ipomoea purpurea]
Length=505

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/244 (92%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK MD NS KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKSMDTNSLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNNPHIQKKLRDEIDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGIILALPILGIVLGRLVQNFELLPPPG SKVDT+EKGGQFSLHILKHSTIVM
Sbjct  441  GAGRRSCPGIILALPILGIVLGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|ADX33333.1| cinnamate-4-hydroxylase 2 [Petunia x hybrida]
Length=505

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 222/244 (91%), Positives = 234/244 (96%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK MD+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLANTKSMDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEEKHVEANGNDFR+LPF
Sbjct  381  HEAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFFEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_009607087.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana tomentosiformis]
 gb|ABC69412.1| CYP73A47v3 [Nicotiana tabacum]
Length=505

 Score =   401 bits (1031),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 221/244 (91%), Positives = 233/244 (95%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLS+TK +D+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSNTKSLDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ADX33332.1| cinnamate-4-hydroxylase 1 [Petunia x hybrida]
Length=506

 Score =   399 bits (1024),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 222/245 (91%), Positives = 232/245 (95%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSST-KGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKLS+T K MDNN+ KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLSTTTKSMDNNALKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +QKKLRDEID+VLGPG Q+TEP THKLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEIQKKLRDEIDSVLGPGVQITEPHTHKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP+TWK PEEFRPERFFEEEKHVEANGNDFR+LP
Sbjct  381  LHDAKLAGYDIPAESKILVNAWWLANNPATWKRPEEFRPERFFEEEKHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKH TIV
Sbjct  441  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHFTIV  500

Query  282  MKPRC  268
            MKPR 
Sbjct  501  MKPRS  505



>ref|XP_009798122.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nicotiana sylvestris]
 gb|ABC69411.1| CYP73A47v1 [Nicotiana tabacum]
Length=505

 Score =   399 bits (1024),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 220/244 (90%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLS+TK  D+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSNTKSSDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKE LRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVIKEALRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ACF19421.1| candidate cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   398 bits (1022),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 218/244 (89%), Positives = 231/244 (95%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK MD+N+ KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLANTKSMDSNALKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EIDAVLGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQQKLREEIDAVLGPGVQVTEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEEKHV+ANGNDFRFLPF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVDANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ABC69413.1| CYP73A47v2 [Nicotiana tabacum]
Length=505

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 220/244 (90%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLS+TK  D+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSNTKSSDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKE LRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVIKEALRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG DIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGLDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ABC69046.1| cinnamic acid 4-hydroxylase [Solanum tuberosum]
Length=505

 Score =   396 bits (1017),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 219/244 (90%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK MD+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLANTKSMDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDEIDTVLGPGMQVTEPDMPKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEEKHVEANGNDFRFLPF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEEKHVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFE+LPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFEMLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ADO16243.1| cinnamate 4-hydroxylase [Ocimum tenuiflorum]
Length=505

 Score =   395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 217/244 (89%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK  D +S KCAIDH+ EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLVSTKAADKDSLKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPGAQ+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDELDTVLGPGAQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_010253046.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   395 bits (1015),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 217/244 (89%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  D+N  KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKPTDHNGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYD+PAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDVPAESKILVNAWWLANNPAQWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_011089532.1| PREDICTED: trans-cinnamate 4-monooxygenase [Sesamum indicum]
Length=505

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 218/244 (89%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N+S KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKAMSNDSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID V+GPG  LTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTVVGPGVPLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLAN+P+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLSGYDIPAESKILVNAWWLANDPAHWKNPEEFRPERFLEEESSVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_010252045.1| PREDICTED: trans-cinnamate 4-monooxygenase [Nelumbo nucifera]
Length=505

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 217/244 (89%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  DN   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKPTDNTGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGVQITEPDTYKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_006350887.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Solanum tuberosum]
Length=526

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 218/244 (89%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK MD+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  282  RKKLANTKSMDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  341

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  342  ELVNHPHIQKKLRDEIDTVLGPGMQVTEPDMPKLPYLQAVIKETLRLRMAIPLLVPHMNL  401

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLAN+P+ WK PEEFRPERFFEEEKHVEANGNDFRFLPF
Sbjct  402  HDAKLAGYDIPAESKILVNAWWLANDPAHWKKPEEFRPERFFEEEKHVEANGNDFRFLPF  461

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFE+LPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  462  GVGRRSCPGIILALPILGITLGRLVQNFEMLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  521

Query  279  KPRC  268
            KPR 
Sbjct  522  KPRS  525



>gb|ABD77493.2| cinnamic acid 4-hydroxylase [Arnebia euchroma]
Length=504

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/244 (89%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK++STK   +N  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKIASTKSTTSNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEIDA+LGPG Q+TEPDTHKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPRIQKKLRDEIDAILGPGVQVTEPDTHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLNGYDIPAESKILVNAWWLANNPEQWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>ref|XP_011080651.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Sesamum indicum]
Length=505

 Score =   394 bits (1011),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 217/244 (89%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK +DN+  KCAIDHI EAQQKGEINEDN LYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKALDNDGLKCAIDHILEAQQKGEINEDNALYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG  +TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTVLGPGVPVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNP+EFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKNPDEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LG LVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGGLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_009601847.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana tomentosiformis]
Length=506

 Score =   394 bits (1011),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 220/245 (90%), Positives = 232/245 (95%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLS-STKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL+ +TK MDNNS KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLANTTKSMDNNSLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +QKKLRDEID+VLG G Q+TEP+ +KLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEIQKKLRDEIDSVLGVGVQITEPELNKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP+TWK PEEFRPERFFEEEKHVEANGNDFR+LP
Sbjct  381  LHDAKLAGYDIPAESKILVNAWWLANNPATWKKPEEFRPERFFEEEKHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
            MKPR 
Sbjct  501  MKPRS  505



>gb|AGH32777.1| cinnamic acid 4-hydroxylase [Camellia chekiangoleosa]
Length=505

 Score =   394 bits (1011),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 216/244 (89%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK L+STK MDNNS KCAIDHI +AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKNLASTKSMDNNSLKCAIDHILDAQHKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQKKLR E+DAVLGPG Q+TEPDT+KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPQVQKKLRQELDAVLGPGTQITEPDTYKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLG YDIPAESKILVNAWWLANNP +WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGSYDIPAESKILVNAWWLANNPESWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>dbj|BAB71716.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 216/244 (89%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK++STK    N  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKIASTKSTTTNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID +LGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTILGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLNGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_004970385.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Setaria italica]
Length=505

 Score =   393 bits (1009),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+DA LGPG Q+TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRQELDAALGPGHQITEPDTHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYD+PAESKILVNAW+LANNP +W+ PEEFRPERF EEE+HVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDVPAESKILVNAWYLANNPDSWRRPEEFRPERFLEEERHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKIDTTEKGGQFSLHILKHSTIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AAG43824.1|AF212318_1 cinnamic acid 4-hydroxylase [Capsicum annuum]
Length=505

 Score =   393 bits (1009),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 216/244 (89%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLS+TK MD+N+ KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSNTKSMDSNALKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EIDAVLGPG Q+TEPDTHKLP LQAVIKETLRLRMA PLLVPHMN+
Sbjct  321  ELVNHPHIQQKLREEIDAVLGPGVQVTEPDTHKLPDLQAVIKETLRLRMATPLLVPHMNI  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVN WWLANNP+ WK PEEFRPERF +EEKHV+ANGNDFRFLPF
Sbjct  381  HDAKLAGYDIPAESKILVNPWWLANNPAHWKKPEEFRPERFLKEEKHVDANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|EYU46023.1| hypothetical protein MIMGU_mgv1a004904mg [Erythranthe guttata]
Length=505

 Score =   393 bits (1009),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK +DN+  KCAIDHI EAQQKGEI+EDNVLYIVENINVAAIETTLWS+EWGIA
Sbjct  261  RKKLGSTKPVDNDGLKCAIDHILEAQQKGEISEDNVLYIVENINVAAIETTLWSVEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QK+LRDEIDAV+GPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPQIQKRLRDEIDAVVGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLANNP+TW+NPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HEAKLGGYDIPAESKILVNAWWLANNPATWRNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILG+ LGRLVQNFE+LPPPG  ++DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGVTLGRLVQNFEMLPPPGQERIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_009766429.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Nicotiana sylvestris]
Length=506

 Score =   393 bits (1009),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 219/245 (89%), Positives = 232/245 (95%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLS-STKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL+ +TK MDNN+ KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLANTTKSMDNNALKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +QKKLRDEID+VLG G Q+TEP+ +KLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEIQKKLRDEIDSVLGVGVQITEPELNKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP+TWK PEEFRPERFFEEEKHVEANGNDFR+LP
Sbjct  381  LHDAKLAGYDIPAESKILVNAWWLANNPATWKKPEEFRPERFFEEEKHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
            MKPR 
Sbjct  501  MKPRS  505



>gb|AFN44010.1| cinnamate 4-hydroxylase [Neolamarckia cadamba]
Length=505

 Score =   392 bits (1008),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 218/244 (89%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK MD+NS KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKSMDSNSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLR+EID VLGPG Q+TEPDT+KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPRVQRKLREEIDTVLGPGVQVTEPDTNKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGGHDIPAESKILVNAWWLANNPENWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|KJB83924.1| hypothetical protein B456_013G271700 [Gossypium raimondii]
Length=505

 Score =   392 bits (1008),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 228/243 (94%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M+N+  KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMNNDGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|ACH56520.1| cinnamate-4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   392 bits (1008),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 228/243 (94%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M+N+  KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMNNDGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AAG10196.1|AF286647_1 cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|KHG13044.1| Cytochrome P450 protein [Gossypium arboreum]
Length=505

 Score =   392 bits (1008),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 228/243 (94%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M+N+  KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMNNDGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|ADO16244.1| cinnamate 4-hydroxylase [Ocimum basilicum]
Length=505

 Score =   392 bits (1007),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 216/244 (89%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK  D +S KCAIDH+ EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLVSTKPADKDSVKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ACR10242.1| cinnamate-4-hydroxylase [Canarium album]
Length=505

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 228/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M+N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKSMNNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLREEIDVVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLAN+P+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANDPAHWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AIY32618.1| cinnamate-4-hydroxylase [Perilla frutescens]
Length=505

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK MD +  KCAIDH+ EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLVSTKPMDKDGLKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPGAQ+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGAQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEA+GNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPEQWKRPEEFRPERFLEEEAKVEASGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILA+PILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILAMPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_002523952.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
 gb|EEF38439.1| cinnamate 4-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M+N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMNNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGNQITEPDTYKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLSGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ACZ06240.1| cinnamate 4-hydroxylase 2 [Gossypium hirsutum]
Length=505

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 227/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M+N+  KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMNNDGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P  QKKLR E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPETQKKLRHELDTVLGPGNQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AFY17065.1| cinnamate 4-hydroxylase 2 [Panicum virgatum]
Length=505

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 227/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+DA LGPG Q+TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRQELDAALGPGHQITEPDTHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAW+LANNP +W+ PEEFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWYLANNPDSWRRPEEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DTTEKGGQFSLHILK+STIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDTTEKGGQFSLHILKYSTIVC  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AEM63593.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   391 bits (1004),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTRTSSNGELKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTVLGPGHQVTEPDTHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPE+FRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEQFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPGHSK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGHSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>sp|P48522.1|TCMO_CATRO RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Catharanthus 
roseus]
 emb|CAA83552.1| cinnamate 4-hydroxylase (CYP73) [Catharanthus roseus]
Length=505

 Score =   390 bits (1001),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK  STK MDNNS KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKFGSTKSMDNNSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE++ VLGPG Q+TEPDT+KLPYLQAVIKETLRLRMAIPL +PHMNL
Sbjct  321  ELVNHPEIQKKLRDELETVLGPGVQITEPDTYKLPYLQAVIKETLRLRMAIPLFLPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAW+LANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWFLANNPEHWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>ref|XP_006432069.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
 gb|AAK57011.1|AF378333_1 cinnamate 4-hydroxylase [Citrus x paradisi]
 gb|ESR45309.1| hypothetical protein CICLE_v10000921mg [Citrus clementina]
Length=505

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N S KCAIDHI +AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYD+PAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDVPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AEM63594.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
 gb|AEX08610.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTRTSSNGELKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTVLGPGHQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPE+FRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEQFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AGX85600.1| coumarate 4-hydroxylase [Scoparia dulcis]
Length=505

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK++STK   N+S KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKIASTKPTSNDSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKK+RDEID VLGPG Q+TEP+ H+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKVRDEIDTVLGPGVQVTEPELHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AGJ84133.1| putative trans-cinnamate 4-hydroxylase [Hibiscus cannabinus]
Length=505

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST   DNN+ KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTTRSDNNALKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDEID VLGPG Q+TEPDTHKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPRIQQKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFFEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGR+VQNFELLPP G SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRMVQNFELLPPNGQSKIDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|AAG10197.1| cinnamate-4-hydroxylase [Gossypium arboreum]
 gb|ACZ06239.1| cinnamate 4-hydroxylase [Gossypium hirsutum]
Length=505

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 230/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK +DNN+ KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLATTKRIDNNALKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFFEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPKGQSKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>dbj|BAB71717.1| cinnamic acid 4-hydroxylase [Lithospermum erythrorhizon]
Length=505

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 227/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+S+K MDNN  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASSKRMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLG YDIPAESK LVNAWWLANNP+ WKNPEEFRPERF EEE  VEA+GNDFR+LPF
Sbjct  381  HDAKLGEYDIPAESKSLVNAWWLANNPTQWKNPEEFRPERFLEEEAKVEASGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LG LV+NFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGGLVKNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|KJB72975.1| hypothetical protein B456_011G207000 [Gossypium raimondii]
Length=505

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 216/244 (89%), Positives = 229/244 (94%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  DNN+ KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKRTDNNALKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFFEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPKGQSKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_007017089.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY34708.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 226/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK++STK M+N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKVASTKSMNNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D VLGPG Q+TEPDT+KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTVLGPGHQITEPDTYKLPYLQAVIKETLRFRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNP+EFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPDEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>pir||PC4237 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) C - Japanese 
aspen x large-toothed aspen (fragment)
 dbj|BAA11578.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=454

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  210  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  269

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  270  ELVNHPEIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  329

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  330  HDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  389

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  390  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  449

Query  279  KPRC  268
            KPR 
Sbjct  450  KPRS  453



>ref|XP_012078176.1| PREDICTED: trans-cinnamate 4-monooxygenase [Jatropha curcas]
 gb|KDP45711.1| hypothetical protein JCGZ_17318 [Jatropha curcas]
Length=505

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK M+N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKSMNNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLGPG Q+TEPDTHKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HEAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHIL HSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILNHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>emb|CDP04040.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   381 bits (979),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST  MD++S KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  76   RKKLASTTSMDSHSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  135

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLR EID VLGPG Q+TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  136  ELVNHPQVQRKLRQEIDTVLGPGVQVTEPDTLKLPYLQAVVKETLRLRMAIPLLVPHMNL  195

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            ++AKLGGYDIPAESKILVNAWWLANNP  W+ PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  196  NEAKLGGYDIPAESKILVNAWWLANNPENWRKPEEFRPERFLEEESKVDANGNDFRYLPF  255

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV+
Sbjct  256  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVL  315

Query  279  KPRC  268
            KPR 
Sbjct  316  KPRS  319



>ref|XP_008657127.1| PREDICTED: trans-cinnamate 4-monooxygenase [Zea mays]
 gb|AFW84752.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=505

 Score =   387 bits (995),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  D+N  KCAIDHI EAQQKGEINEDNVL+IVENINVAAIETTLWSIEW +A
Sbjct  261  RKKLASTKATDSNGLKCAIDHILEAQQKGEINEDNVLFIVENINVAAIETTLWSIEWAVA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPDTH LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRQELDTVLGPGHQITEPDTHNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAW+LANNP +W+ PEEFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWYLANNPDSWRRPEEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  KVDTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKVDTTEKGGQFSLHILKHSTIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|ABF69100.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   387 bits (995),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|NP_001275824.1| cinnamate 4-hydroxylase CYP73 [Citrus sinensis]
 gb|AAF66066.2|AF255014_1 cinnamate 4-hydroxylase CYP73 [Citrus sinensis]
Length=519

 Score =   388 bits (996),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 225/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N S KCAIDHI +AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  275  RKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  334

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  335  ELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  394

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYD+PAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  395  HDAKLGGYDVPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  454

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  455  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVA  514

Query  279  KPR  271
            KPR
Sbjct  515  KPR  517



>gb|ABF69099.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AGE10592.1| cinnamate 4-hydroxylase [Lonicera japonica]
Length=505

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK MDNN+ KCAIDHI EAQ+KGEINEDNVLYIVENINVAAIETTLWS+EWGIA
Sbjct  261  RKKLGSTKSMDNNTLKCAIDHILEAQEKGEINEDNVLYIVENINVAAIETTLWSVEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHQEIQNKLRHELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLG YDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGSYDIPAESKILVNAWWLANNPAKWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQNKIDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AJT59581.1| cinnamate-4-hydroxylase [Boehmeria nivea]
Length=505

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  DNN  KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKATDNNGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+E+D VLGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRNELDTVLGPGVQITEPDMHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DT+EKGGQFSLHI KHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQAKLDTSEKGGQFSLHISKHSTIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|ACZ54906.1| cinnamate 4-hydroxylase [Leucaena leucocephala]
Length=505

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTRTSSNGELKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDEID VLGPG Q+TE DTHKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDEIDTVLGPGHQVTESDTHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDA+LGGYDIPAESKILVNAWWLANNP+ WKNPE+FRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  HDAQLGGYDIPAESKILVNAWWLANNPAHWKNPEQFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPGHSK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGHSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_011015228.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGHQVTEPDTNKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAQWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_011041784.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Populus euphratica]
Length=505

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGHQVTEPDTNKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAQWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_003564495.1| PREDICTED: trans-cinnamate 4-monooxygenase [Brachypodium distachyon]
Length=505

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EAQQKGEINEDNVLYI+ENINVAAIETTLWSIEW IA
Sbjct  261  RKKLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIIENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D VLG G Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRDELDTVLGAGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGGY+IPAESKILVNAW+LANNP  W+ P+EFRPERF EEEKHVEANGNDFRFLPF
Sbjct  381  QDAKLGGYNIPAESKILVNAWFLANNPEEWRRPDEFRPERFLEEEKHVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DTTEKGGQFSLHILKHS IV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDTTEKGGQFSLHILKHSNIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_002325638.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ACC63871.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
 gb|EEF00020.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGHQITEPDTNKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>emb|CDP19477.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST  MD+NS KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTTSMDSNSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLR EID VLGPG Q+TEPDTHKLPYLQAV+KETLRLRMA+PLLVPHMNL
Sbjct  321  ELVNHPQVQRKLRQEIDTVLGPGVQVTEPDTHKLPYLQAVVKETLRLRMAVPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            ++AKLGGYDIPAESKILVNAWWLANNP  W+ PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  NEAKLGGYDIPAESKILVNAWWLANNPENWRKPEEFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I LG LVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILAITLGSLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_007205045.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
 gb|EMJ06244.1| hypothetical protein PRUPE_ppa004544mg [Prunus persica]
Length=504

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKTTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D+VLGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDSVLGPGVQITEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AGJ71350.1| cinnamate 4-hydroxylase 1 [Eucalyptus urophylla]
Length=505

 Score =   385 bits (989),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+S K MDN   KCA+DHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASVKRMDNEGLKCAMDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EIDAVLGPG  +TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPQIQRKLREEIDAVLGPGVPVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILG+ +G+LVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGVTIGQLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_007011365.1| Cinnamate-4-hydroxylase [Theobroma cacao]
 gb|EOY20175.1| Cinnamate-4-hydroxylase [Theobroma cacao]
Length=505

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK L+ST   DNN+ KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKNLASTTISDNNALKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EID VLGPG  +TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRNEIDTVLGPGVPVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESK+LVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKVLVNAWWLANNPAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQAKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_008240713.1| PREDICTED: trans-cinnamate 4-monooxygenase [Prunus mume]
Length=504

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 213/244 (87%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKTTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D+VLGPG Q+TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDSVLGPGVQITEPDTQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AID16078.1| cinnamate 4-hydroxylase [Morus alba]
Length=505

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSS K  DN   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSPKSTDNEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRDELDTVLGQGVQITEPDMLKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF +EE  VEANGNDFR+LPF
Sbjct  381  HEAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLQEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_002458683.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
 gb|EES03803.1| hypothetical protein SORBIDRAFT_03g038160 [Sorghum bicolor]
Length=505

 Score =   385 bits (988),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK +D+N  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLASTKAVDSNGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VL PG Q+TEPDTH LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRQELDTVLAPGQQITEPDTHNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAW+LANNP +WK PEEFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWYLANNPESWKRPEEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DTTEKGGQFSLHILKHS IV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDTTEKGGQFSLHILKHSNIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|ADZ54778.1| trans-cinnamate 4-monooxygenase [Prunus avium]
Length=505

 Score =   385 bits (988),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 214/242 (88%), Positives = 225/242 (93%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKTTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D+VLGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDSVLGPGVQITEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>ref|XP_008456253.1| PREDICTED: trans-cinnamate 4-monooxygenase [Cucumis melo]
Length=505

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLANTKSTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+E+D VLGPG  +TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRNELDTVLGPGVPITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_010685980.1| PREDICTED: trans-cinnamate 4-monooxygenase [Beta vulgaris subsp. 
vulgaris]
Length=504

 Score =   384 bits (987),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 225/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK   NN  KCAIDHI EAQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKAPSNNELKCAIDHILEAQEKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLG G Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQNKLREEIDTVLGKGHQITEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFRFLPF
Sbjct  381  HNAKLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEESKVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFEL+PPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELMPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AGG55322.1| cinnamate 4-hydroxylase [Paeonia lactiflora]
Length=505

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST G+ NN  KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTTGVTNNGLKCAIDHIMEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+EID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN+
Sbjct  321  ELVNHPEIQKKLRNEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNI  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGG+DIPAESK+LVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGGFDIPAESKVLVNAWWLANNPAHWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQAKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
             P+ 
Sbjct  501  NPKI  504



>gb|AHL83550.1| C4H [Morus alba var. multicaulis]
Length=505

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSS K  DN   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSPKSTDNEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRDELDTVLGQGVQITEPDMLKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLAN+P+ WKNPEEFRPERF +EE  VEANGNDFR+LPF
Sbjct  381  HEAKLGGYDIPAESKILVNAWWLANDPANWKNPEEFRPERFLQEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_010032943.1| PREDICTED: trans-cinnamate 4-monooxygenase [Eucalyptus grandis]
 gb|KCW52446.1| hypothetical protein EUGRSUZ_J01844 [Eucalyptus grandis]
Length=505

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+S K MDN   KCA+DHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASVKRMDNEGLKCAMDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EIDAVLGPG  +TEP+ +KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPQIQRKLREEIDAVLGPGVPVTEPELYKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILG+ +G+LVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGVTIGQLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_010094425.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB56006.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   383 bits (984),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSS K  DN   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSPKSTDNEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRDELDTVLGRGVQITEPDMLKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF +EE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLQEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPP G SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPAGQSKIDTSEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AEM63672.1| cinnamate 4-hydroxylase [Platycodon grandiflorus]
Length=505

 Score =   383 bits (984),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 214/244 (88%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK MDNNS KCA+DHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLESTKRMDNNSLKCAMDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR EID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN 
Sbjct  321  ELVNHPEIQLKLRHEIDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNP  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLG YDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGSYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFMEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHIL HSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILNHSTIVA  500

Query  279  KPRC  268
            K R 
Sbjct  501  KGRS  504



>gb|AID51447.1| cinnamate 4-hydroxylase 2 [Astragalus membranaceus]
Length=505

 Score =   383 bits (984),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK + STK  DN   KCAIDHI +AQ+KGEI+EDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKNIGSTKRTDNEGLKCAIDHILDAQKKGEISEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKK+R+EID VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKVREEIDRVLGPGHQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPE+FRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEQFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AGN70893.1| cinammate 4-hydroxylase [Dendrobium catenatum]
Length=505

 Score =   383 bits (983),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/243 (86%), Positives = 225/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK MDN   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKPMDNAGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLRDE+D VLG G Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEVQRKLRDELDTVLGRGNQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGY+IPAESKILVNAWWLANNP+ WKNP++FRPERF EEE  VEANGNDFRF+PF
Sbjct  381  HDAKLGGYEIPAESKILVNAWWLANNPAQWKNPDQFRPERFLEEESKVEANGNDFRFIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT+EKGGQFSLHILKH T+V 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGMEKLDTSEKGGQFSLHILKHYTVVA  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>ref|XP_010938024.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+S KG  N   KCAIDHI EA++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASIKGATNVELKCAIDHILEAERKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRHELDTVLGPGVQITEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP  WKNPEEFRPERF +EE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPDNWKNPEEFRPERFLDEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>dbj|BAJ95120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EA+QKGEINEDNVLYI+ENINVAAIETTLWSIEWG+A
Sbjct  261  RKKLASTKAMDNNGLKCAIDHILEAEQKGEINEDNVLYIIENINVAAIETTLWSIEWGLA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+DAVLG G Q+TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GY+IPAESKILVNAW+LANNP  WK P+EFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLAGYNIPAESKILVNAWFLANNPEQWKRPDEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFVLSPPPGQDKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|AEV93475.1| 4-coumarate:CoA ligase [Caragana korshinskii]
Length=505

 Score =   382 bits (982),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLESTKSTSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKK+RDEID+VLGPG Q+TEPD   LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKVRDEIDSVLGPGHQVTEPDIQNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEESHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AHG06398.1| cinnamic acid 4-hydroxylase [Ornithogalum saundersiae]
Length=505

 Score =   382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  DN S KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKAADNASLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLR+E+D VLGPG Q+TEPD H+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPKVQQKLRNELDTVLGPGVQITEPDMHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDF+++PF
Sbjct  381  HEAKLGGYDIPAESKILVNAWWLANNPEHWKNPEEFRPERFLEEEAKVEANGNDFKYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_010103664.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
 gb|EXB96547.1| Trans-cinnamate 4-monooxygenase [Morus notabilis]
Length=505

 Score =   382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST   DNN+ KCAIDHI +AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTTRSDNNALKCAIDHILDAQHKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPDT+KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRHELDTVLGPGEQITEPDTYKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDF++LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERFLEEEAKVEANGNDFKYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQDKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|AAT39513.1| cinnamate-4-hydroxylase [Camptotheca acuminata]
Length=505

 Score =   382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 223/242 (92%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKGMDN   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLTSTKGMDNYGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR EI  VLGPG Q+TEP+  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRHEIQTVLGPGTQVTEPEVQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYD+PAESKILVNAWWLANNP+ W+ PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  HDAKLGGYDVPAESKILVNAWWLANNPAHWQKPEEFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>gb|AFP49808.1| cinnamate 4-hydroxylase 4 [Coffea arabica]
Length=505

 Score =   382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST  MD++S KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTTSMDSHSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLR EID VLGPG Q+TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPQVQRKLRQEIDTVLGPGVQVTEPDTLKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            ++AKLGGYDIPAESKILVNAWWLANNP  W+ PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  NEAKLGGYDIPAESKILVNAWWLANNPENWRKPEEFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AAC35857.1| cinnamic acid 4-hydroxylase [Capsicum chinense]
Length=469

 Score =   381 bits (978),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 226/244 (93%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK MD+N+  CAI HI +AQQKGEINEDNVLYIVENINVAAI+TTLWSIEWGIA
Sbjct  225  RKKLANTKSMDSNALTCAIHHILDAQQKGEINEDNVLYIVENINVAAIQTTLWSIEWGIA  284

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+EID VLGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHM+L
Sbjct  285  ELVNHPHIQQKLREEIDTVLGPGVQVTEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMSL  344

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL  YDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEEKHV+ANGNDFRFLPF
Sbjct  345  HDAKLAVYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEEKHVDANGNDFRFLPF  404

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFE+ PPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  405  GVGRRSCPGIILALPILGITLGRLVQNFEMFPPPGQSKLDTSEKGGQFSLHILKHSTIVM  464

Query  279  KPRC  268
            KPR 
Sbjct  465  KPRS  468



>gb|ABF69101.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ABF69102.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>sp|Q43054.1|TCMO_POPKI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
sieboldii x Populus grandidentata]
 pir||JC5129 trans-cinnamate 4-monooxygenase (EC 1.14.13.11) A - Japanese 
aspen x large-toothed aspen
 dbj|BAA11579.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
 dbj|BAA11576.1| cinnamic acid 4-hydroxylase [Populus kitakamiensis]
Length=505

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EE   VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEGAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AEA02458.1| cinnamate 4-hydroxylase [Prunus armeniaca]
Length=504

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKTTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D+VLGPG Q+TEP+  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDSVLGPGVQITEPEIQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_002319974.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 ref|XP_002319975.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
 gb|ABK93900.1| unknown [Populus trichocarpa]
 gb|EEE95897.1| hypothetical protein POPTR_0013s15380g [Populus trichocarpa]
 gb|EEE95898.1| trans-cinnamate 4-monooxygenase family protein [Populus trichocarpa]
Length=505

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M+N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMNNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AEA02459.1| cinnamate 4-hydroxylase [Prunus cerasifera x Prunus munsoniana]
Length=504

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKTTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D+VLGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDSVLGPGVQITEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLG YDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGSYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQLDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ADD54647.1| cinnamate 4-hydroxylase [Bruguiera gymnorhiza]
Length=261

 Score =   372 bits (956),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK       KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWS EW IA
Sbjct  17   RKKLASTKSPSKEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSTEWVIA  76

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D VLGP   +TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  77   ELVNHPEIQKKLRIELDTVLGPDHPITEPDTHQLPYLQAVIKETLRLRMAIPLLVPHMNL  136

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE +VEANGNDFR+LPF
Sbjct  137  HDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESNVEANGNDFRYLPF  196

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  197  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  256

Query  279  KPRC  268
            KPR 
Sbjct  257  KPRS  260



>sp|Q96423.1|TCMO_GLYEC RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycyrrhiza 
echinata]
 dbj|BAA13414.1| cytochrome P450 (CYP73A14) [Glycyrrhiza echinata]
Length=505

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            R KL STK   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RMKLESTKSTSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKK+RDEID VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKVRDEIDRVLGPGHQVTEPDMQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPANWKRPEEFRPERFLEEESHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AAU09021.1| Cinnamic acid 4-hydroxylase [Agastache rugosa]
Length=502

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/242 (87%), Positives = 224/242 (93%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDN+  KCAIDHI +AQQKGEI+EDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKPMDNDGLKCAIDHILDAQQKGEISEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP VQ+K+R+E+D VLG G  +TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNNPEVQRKVREEMDRVLGVGVPVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESK+LVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKVLVNAWWLANNPEQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGKSKIDTTEKGGQFSLHILNHSTIVM  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>gb|ACZ73612.1| cinnamate 4-hydroxylase [Bambusa oldhamii]
Length=507

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+S+K MD++  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEW I 
Sbjct  261  RKKLASSKPMDSSGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWAIG  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+DAVLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRHELDAVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAW+LANNP  WK PEE RPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLSGYDIPAESKILVNAWYLANNPDQWKRPEELRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT EKGGQFSLHILKHS IV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDTAEKGGQFSLHILKHSNIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AAG50231.1|AF302495_1 cinnamate 4-hydroxylase [Populus trichocarpa x Populus deltoides]
Length=505

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>dbj|BAE72875.1| Cinnamic acid 4-hydroxylase [Verbena x hybrida]
Length=505

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  D+   +CAIDHI EAQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKSTDSEGLRCAIDHILEAQEKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLGPG Q+TEPD  KLPYL AV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGPGVQITEPDVPKLPYLNAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFE++PPPG +K+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFEMVPPPGQAKIDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_009354868.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=504

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTRATTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+DAVLG G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDAVLGRGVQITEPDVQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            K R 
Sbjct  501  KSRA  504



>gb|AFZ78542.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   380 bits (977),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 212/244 (87%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLGSTKSMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWEIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +QKKLRDE+D VLGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHSLIQKKLRDELDTVLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAKWKNPEEFRPERFFEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>sp|O24312.1|TCMO_POPTM RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Populus 
tremuloides]
 gb|AAB67874.1| trans-cinnamate 4-hydroxylase [Populus tremuloides]
Length=505

 Score =   380 bits (977),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMCNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ACM17896.1| cinnamate-4-hydroxylase [Rubus occidentalis]
Length=504

 Score =   380 bits (976),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTQATTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLG G Q+TEP+  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGRGVQITEPEIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +++DTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQTQLDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>ref|XP_010921158.1| PREDICTED: trans-cinnamate 4-monooxygenase [Elaeis guineensis]
Length=505

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG  N   KCAIDHI EA++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKGASNMELKCAIDHILEAERKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRHELDTVLGPGVQITEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL G DIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLRGCDIPAESKILVNAWWLANNPDNWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_011021057.1| PREDICTED: trans-cinnamate 4-monooxygenase [Populus euphratica]
Length=505

 Score =   380 bits (975),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST  M N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTNNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_008810838.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   379 bits (974),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 208/243 (86%), Positives = 220/243 (91%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG  N   KCAIDHI EA++KGEINEDNVLYIVENINVAAIETT WSIEWGIA
Sbjct  261  RKKLASTKGATNVELKCAIDHILEAERKGEINEDNVLYIVENINVAAIETTQWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPDT KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRRELDTVLGPGVQITEPDTQKLPYLQAVIKETLRRRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP  WKNP+EFRPERF  EE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPDNWKNPDEFRPERFLAEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVC  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|ADN32769.1| cinnamate 4-hydroxylase [Scutellaria baicalensis]
Length=507

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 225/246 (91%), Gaps = 2/246 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNN--SXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWG  826
            RKK++STK   NN    KCA+DHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWG
Sbjct  261  RKKVASTKSSSNNDGGLKCAMDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWG  320

Query  825  IAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHM  646
            IAELVN+P ++KK+R+E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHM
Sbjct  321  IAELVNHPEIRKKVREELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHM  380

Query  645  NLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFL  466
            NLHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+L
Sbjct  381  NLHDAKLNGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYL  440

Query  465  PFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTI  286
            PFGVGRRSCPGIILALPIL I +GRLVQNFELLPPPG +K+DTTEKGGQFSLHI+KHSTI
Sbjct  441  PFGVGRRSCPGIILALPILCITIGRLVQNFELLPPPGQAKLDTTEKGGQFSLHIMKHSTI  500

Query  285  VMKPRC  268
            V+KPR 
Sbjct  501  VLKPRS  506



>gb|EMT08179.1| Trans-cinnamate 4-monooxygenase [Aegilops tauschii]
Length=446

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 209/245 (85%), Positives = 224/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNS-XKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK MDNN   KCAIDHI EA+QKGEINEDNVLYI+ENINVAAIETTLWSIEWG+
Sbjct  201  RKKLVSTKAMDNNGGLKCAIDHILEAEQKGEINEDNVLYIIENINVAAIETTLWSIEWGL  260

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +Q+KLRDE+DAVLG G Q+TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  261  AELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHRLPYLQAVIKETLRLRMAIPLLVPHMN  320

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GY+IPAESKILVNAW+LANNP  WK P+EFRPERF EEEKHVEANGNDFR+LP
Sbjct  321  LHDAKLAGYNIPAESKILVNAWFLANNPEQWKRPDEFRPERFLEEEKHVEANGNDFRYLP  380

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DTTEKGGQFSLHILKHSTIV
Sbjct  381  FGVGRRSCPGIILALPILGITIGRLVQNFVLSPPPGQDKLDTTEKGGQFSLHILKHSTIV  440

Query  282  MKPRC  268
             KPR 
Sbjct  441  AKPRV  445



>gb|AHJ61295.1| cinnamate-4-hydroxylase [Hordeum vulgare]
Length=505

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EA+QKGEINEDNVLYI+ENINVAAIETTLWSIEWG+A
Sbjct  261  RKKLASTKAMDNNGLKCAIDHILEAEQKGEINEDNVLYIIENINVAAIETTLWSIEWGLA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+DAVLG G Q+TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL  Y+IPAESKILVNAW+LA+NP  WK P+EFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLAAYNIPAESKILVNAWFLADNPEQWKRPDEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNF L PPPG  K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFVLSPPPGQDKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|ACC63873.1| trans-cinnamate 4-hydroxylase [Populus trichocarpa]
Length=505

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M+N   KCAIDHI + Q+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKNMNNEGLKCAIDHILDDQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ACM69364.1| cinnamic acid 4-hydroxylase [Humulus lupulus]
Length=505

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK  DN   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKSSDNEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D VLGPG Q+TEPD HKLPYL AVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRIELDTVLGPGVQITEPDMHKLPYLNAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            + AKLGGYDIPAESKILVNAWWLAN+P+ WK PEEFRPERFFEEE  VEANGNDFRFLPF
Sbjct  381  NQAKLGGYDIPAESKILVNAWWLANDPAHWKKPEEFRPERFFEEESKVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPP G +K+DT EKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPAGQTKIDTAEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ABA59555.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
 gb|ACA25599.1| cinnamate-4-hydroxylase [Parthenocissus henryana]
Length=505

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 224/242 (93%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  D+NS KCA+DHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKSTDHNSLKCAVDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE++ VLGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDELNTVLGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLG YDIPAESKILVNAWWLANNPS WKNPEEFRPERF EEE  VE NGNDFR+LPF
Sbjct  381  NDAKLGSYDIPAESKILVNAWWLANNPSKWKNPEEFRPERFLEEESKVEPNGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG +K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQNKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>gb|ACJ37399.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK MDNN  KCAIDHI +A+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSMDNNQLKCAIDHILDAKDKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQVTEPDLDKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP  WK PE FRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPDQWKEPEVFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKV TTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVGTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_004294725.1| PREDICTED: trans-cinnamate 4-monooxygenase [Fragaria vesca subsp. 
vesca]
Length=504

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST+   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTQVTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLG G Q+TEP+ HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGHGVQVTEPELHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILG+ LGRLVQNFE+LPPPG +++DTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGVTLGRLVQNFEMLPPPGQTQLDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AIB06733.1| cinnamate 4-mono-oxygenase [Mangifera indica]
Length=505

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST+ M N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTQSMTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q +LR E+D VLG G Q+TEPDT+KLP+LQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTRLRHELDTVLGRGVQITEPDTYKLPFLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDA LGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDANLGGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            +PR 
Sbjct  501  RPRT  504



>ref|XP_002881114.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57373.1| cinnamate-4-hydroxylase [Arabidopsis lyrata subsp. lyrata]
Length=505

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 208/243 (86%), Positives = 225/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFRF+PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRFVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>sp|Q43240.1|TCMO_ZINVI RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Zinnia 
violacea]
 gb|AAB42024.1| cinnamic acid 4-hydroxylase [Zinnia violacea]
Length=505

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK MDNN  KCAIDHI +A+ KGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLGSTKSMDNNQLKCAIDHILDAKDKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+ + LGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELVSQLGPGVQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  KVDTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKVDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|AHB52741.1| cinnamate 4-hydroxylase [Pyrus x bretschneideri]
Length=504

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 222/242 (92%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKPTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLG G Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRNELDTVLGRGVQITEPDVHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>gb|KHN30609.1| Trans-cinnamate 4-monooxygenase [Glycine soja]
Length=433

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S K  +NN  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  189  RKKLGSIKSSNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  248

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+K+RDEID VL  G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  249  ELVNHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  308

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  309  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEELHVEANGNDFRYLPF  368

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I LGRLVQNFELLPPPG S++DT+EKGGQFSLHILKHSTIV 
Sbjct  369  GVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIVA  428

Query  279  KPRC  268
            KPR 
Sbjct  429  KPRS  432



>gb|AEK94316.1| cinnamic acid 4-hydroxylase-like protein [Pyrus x bretschneideri]
Length=504

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKPTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLG G Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRNELDTVLGRGVQITEPDVHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            K R 
Sbjct  501  KSRA  504



>gb|ADG43134.1| cinnamate 4-hydroxylase [Isatis tinctoria]
Length=509

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK  EEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKLEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILTHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|ADT63059.1| cinnamate 4-hydroxylase [Fagopyrum esculentum]
Length=388

 Score =   374 bits (959),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 205/242 (85%), Positives = 222/242 (92%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL ST+   NN  KCAIDHI EAQQKGEI+EDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  145  RKKLGSTRPSSNNELKCAIDHILEAQQKGEISEDNVLYIVENINVAAIETTLWSIEWGIA  204

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  205  ELVNHPEIQRKLRDELDTVLGKGVQITEPDLPKLPYLQAVVKETLRLRMAIPLLVPHMNL  264

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  265  HDAKLGGFDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEESKVDANGNDFRYLPF  324

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFE+LPPPG +K+DT+EKGGQFSLHILKHSTIVM
Sbjct  325  GVGRRSCPGIILALPILGITIGRLVQNFEMLPPPGENKLDTSEKGGQFSLHILKHSTIVM  384

Query  279  KP  274
            KP
Sbjct  385  KP  386



>ref|NP_001292707.1| trans-cinnamate 4-monooxygenase [Cucumis sativus]
 emb|CAK95273.1| cinnamate-4-hydroxylase [Cucumis sativus]
Length=505

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL++TK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLANTKSTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+E+D VLGPG  +TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRNELDTVLGPGVPITEPDTQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDF++LPF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEANGNDFKYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  441  GAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVV  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>gb|ABX74779.1| cinnamate-4-hydroxylase [Rubus coreanus]
Length=504

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIET LWSIEWGIA
Sbjct  261  RKKLSSTQATTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETALWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLG G Q+TEP+  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGHGVQVTEPEIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +++DTTEKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQTQLDTTEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|AFD29887.1| cinnamate 4-hydroxylase [Bambusa emeiensis]
Length=507

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST+ MD++  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEW I 
Sbjct  261  RKKLASTRPMDSSGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWAIG  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRHELDEVLGPGHQITEPDAHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAW+LANNP  WK PEEFRPERF EEEKHVEANGNDFR+LPF
Sbjct  381  HDAKLSGYDIPAESKILVNAWYLANNPDQWKRPEEFRPERFLEEEKHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT EKGGQFSLHILKHS IV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKLDTAEKGGQFSLHILKHSNIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AJD25173.1| cytochrome P450 CYP73A120 [Salvia miltiorrhiza]
Length=504

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 223/244 (91%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STKG DN   KCAIDH+ EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLVSTKGGDN-GLKCAIDHMLEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D VLGPG Q+TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  320  ELVNHPEIQNKLRHELDTVLGPGVQITEPDTTKLPYLQAVVKETLRLRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  380  HDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERFLEEEAKVDANGNDFRYLPF  439

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  440  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  499

Query  279  KPRC  268
            KPR 
Sbjct  500  KPRS  503



>emb|CDX84829.1| BnaA03g14010D [Brassica napus]
Length=505

 Score =   377 bits (969),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHIIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AIT52342.1| cinammate 4-hydroxylase 1 [Daucus carota]
Length=506

 Score =   377 bits (969),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK  S K +DNNS KCA+ HI EAQQKGE+NED+VLYIVENINVAAIETTLWSIEWGIA
Sbjct  262  RKKFESIKRVDNNSLKCAMYHILEAQQKGEVNEDSVLYIVENINVAAIETTLWSIEWGIA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D+VLG G Q+ EPD HKLPYL+AVIKETLRLRMAIPLLVPHMNL
Sbjct  322  ELVNHPEIQEKLRDEMDSVLGVGVQICEPDIHKLPYLEAVIKETLRLRMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE+ VEANG+DFR+LPF
Sbjct  382  HEAKLGGYDIPAESKILVNAWWLANNPAQWKNPEEFRPERFLEEERKVEANGDDFRYLPF  441

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  442  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVC  501

Query  279  KPR  271
            KPR
Sbjct  502  KPR  504



>gb|ABN48717.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   377 bits (969),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 223/244 (91%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STKG DN   KCAIDH+ EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLVSTKGGDN-GLKCAIDHMLEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D VLGPG Q+TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  320  ELVNHPEIQNKLRHELDTVLGPGVQITEPDTTKLPYLQAVVKETLRLRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  380  HDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERFLEEEAKVDANGNDFRYLPF  439

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  440  GVGRRSCPGIILALPILGIAIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  499

Query  279  KPRC  268
            KPR 
Sbjct  500  KPRS  503



>gb|EPS68507.1| cinnamate-4-hydroxylase 1, partial [Genlisea aurea]
Length=421

 Score =   374 bits (961),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL +TK +DNN  KCA+D+I EA+QKGEINEDNVLYIVENINVAAIETTLWS+EWGIA
Sbjct  177  RKKLVTTKPVDNNGVKCAMDYILEAEQKGEINEDNVLYIVENINVAAIETTLWSVEWGIA  236

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQKKLRDEIDAVLG G  +TEPDTHKLPYLQAVIKETLRLRM IPLLVPHMNL
Sbjct  237  ELVNHPNVQKKLRDEIDAVLGRGVPVTEPDTHKLPYLQAVIKETLRLRMPIPLLVPHMNL  296

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKI VNAWWL NNP  WK PEEFRPERF EEE +VEANGN+F+++PF
Sbjct  297  HDAKLSGYDIPAESKIFVNAWWLGNNPELWKKPEEFRPERFLEEEANVEANGNEFKYVPF  356

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHST+V+
Sbjct  357  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTVVL  416

Query  279  KPRC  268
            KPR 
Sbjct  417  KPRA  420



>gb|ACE95171.1| cinnamate-4-hydroxylase [Populus tomentosa]
 gb|AFZ78541.1| cinnamate 4-hydroxylase [Populus tomentosa]
Length=505

 Score =   377 bits (969),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            R+KL+STK M N   KCAIDHI +AQ++GEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  REKLASTKNMSNEGLKCAIDHILDAQKEGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR E+D +LGPG Q+TEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEA+GNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEASGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ABF17875.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 gb|ABF17876.1| cinnamate 4-hydroxylase isoform 2 [Brassica napus]
 emb|CDY29670.1| BnaA04g17570D [Brassica napus]
Length=505

 Score =   377 bits (968),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 225/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWG+A
Sbjct  261  RKQIASSKATGSEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGVA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|ABX74781.1| cinnamate-4-hydroxylase [Rubus sp. SSL-2007]
Length=504

 Score =   377 bits (968),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST+   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTQATTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE+D VLG G Q+TEP+  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRDELDTVLGRGVQITEPEIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +++DTTEKGGQFSLHILKHS IVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQTQLDTTEKGGQFSLHILKHSPIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>emb|CDY23995.1| BnaC03g16960D [Brassica napus]
Length=505

 Score =   377 bits (968),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHIVEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AAS48416.1| cinammate 4-hydroxylase [Allium cepa]
Length=505

 Score =   377 bits (968),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK  DN   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKPTDNAGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KL+ E+D VLGPG Q+TEPDTH+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPKIQRKLQHELDTVLGPGTQITEPDTHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK+PEEFRPERF EEE  VEANGNDFR++PF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKDPEEFRPERFLEEEAKVEANGNDFRYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNF+L+PPPG  K+DTTEKGGQFSLHIL HSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFDLMPPPGMDKIDTTEKGGQFSLHILNHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|NP_001281035.1| trans-cinnamate 4-monooxygenase [Malus domestica]
 gb|AAY87450.1| cinnamic acid hydroxylase [Malus domestica]
Length=504

 Score =   377 bits (968),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKPTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRNELDTVLGRGVQITEPDVPKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AAT68775.2| trans-cinnamate 4-hydroxylase [Camellia sinensis]
Length=390

 Score =   373 bits (957),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 207/245 (84%), Positives = 222/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSS-TKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL+   + MD  + KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  145  RKKLAKPRRAMDTVTLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  204

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +QKKLR E+D +LG G Q+TEPDT+KLPYLQAV+KETLRLRMAIPLLVPHMN
Sbjct  205  AELVNHPQIQKKLRHELDTMLGLGVQITEPDTYKLPYLQAVVKETLRLRMAIPLLVPHMN  264

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDFR+LP
Sbjct  265  LHDAKLSGYDIPAESKILVNAWWLANNPDNWKNPEEFRPERFLEEEAKVEANGNDFRYLP  324

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG +K+DT EKGGQFSLHILKHSTIV
Sbjct  325  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQAKIDTAEKGGQFSLHILKHSTIV  384

Query  282  MKPRC  268
            +KPR 
Sbjct  385  LKPRS  389



>ref|XP_008792249.1| PREDICTED: trans-cinnamate 4-monooxygenase [Phoenix dactylifera]
Length=505

 Score =   377 bits (967),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK +DN   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKPVDNAGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQ+KLR+E+D VLGPG  +TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEVQQKLRNELDTVLGPGVAVTEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQKKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRM  504



>gb|KHN40993.1| Trans-cinnamate 4-monooxygenase [Glycine soja]
Length=434

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 225/244 (92%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSX-KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK  +NN+  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  189  RKKLGSTKSTNNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGI  248

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +Q+KLRDEID VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMN
Sbjct  249  AELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMN  308

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEE  VEANGNDFR+LP
Sbjct  309  LHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEESLVEANGNDFRYLP  368

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT+EKGGQFSLHILKHSTIV
Sbjct  369  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIV  428

Query  282  MKPR  271
             KPR
Sbjct  429  AKPR  432



>sp|Q04468.1|TCMO_HELTU RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Helianthus 
tuberosus]
 emb|CAA78982.1| trans-cinnamate 4-monooxygenase [Helianthus tuberosus]
Length=505

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK+ STK MDNN  KCAIDHI EA++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKIGSTKKMDNNQLKCAIDHILEAKEKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTDEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|ABC75596.1| cinnamate 4-hydroxylase [Salvia miltiorrhiza]
Length=504

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 209/244 (86%), Positives = 223/244 (91%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STKG DN   KCAIDH+ EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLVSTKGGDN-GLKCAIDHMLEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D VLGPG Q+TEPDT KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  320  ELVNHPEIQNKLRHELDTVLGPGVQITEPDTTKLPYLQAVVKETLRLRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  380  HDAKLGGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERFLEEEAKVDANGNDFRYLPF  439

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFE+LPPPG SK+DT+EKGGQFSLHILKHSTIV+
Sbjct  440  GVGRRSCPGIILALPILGITIGRLVQNFEMLPPPGQSKIDTSEKGGQFSLHILKHSTIVL  499

Query  279  KPRC  268
            KPR 
Sbjct  500  KPRS  503



>ref|XP_006410152.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
 dbj|BAJ33716.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51605.1| hypothetical protein EUTSA_v10016545mg [Eutrema salsugineum]
Length=505

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASAKPTGSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>ref|NP_180607.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 sp|P92994.1|TCMO_ARATH RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Arabidopsis 
thaliana]
 gb|AAB58356.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAB63088.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAL38321.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AAP68314.1| At2g30490 [Arabidopsis thaliana]
 emb|CAP08840.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08841.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 gb|AEC08397.1| trans-cinnamate 4-monooxygenase [Arabidopsis thaliana]
 gb|AGA15806.1| C4H [Expression vector pUDE172]
Length=505

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AAC99993.1| cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>emb|CBI15809.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   375 bits (963),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/242 (86%), Positives = 223/242 (92%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  D+NS KCA+DHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  235  RKKLASTKSTDHNSLKCAVDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  294

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE++ VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  295  ELVNHPHIQKKLRDELNTVLGPGVQVTEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNL  354

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGGYDIPAESKILVNAWWLAN+ S WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  355  NDAKLGGYDIPAESKILVNAWWLANDSSKWKKPEEFRPERFLEEESKVEANGNDFRYLPF  414

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +K+DTT KGGQFSLHILKHSTIV 
Sbjct  415  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQAKLDTTGKGGQFSLHILKHSTIVA  474

Query  279  KP  274
            +P
Sbjct  475  RP  476



>emb|CAP08828.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>emb|CAP08829.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   376 bits (966),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AAB58355.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08830.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08831.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08832.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08833.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08838.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08839.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08842.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08843.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08844.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08845.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>emb|CAP08846.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=488

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  244  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  303

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  304  ELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  363

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  364  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  423

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  424  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  483

Query  279  KPR  271
            KPR
Sbjct  484  KPR  486



>ref|XP_009132739.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHIIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQITEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLAN+P +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANSPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AFG30055.1| cinnamate-4-hydroxylase [Malus hybrid cultivar]
Length=504

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLSSTKPTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLRNELDTVLGRGVQITEPDVPKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRIVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|ACY78690.1| trans-cinnamate 4-monooxygenase [Cynara cardunculus var. scolymus]
Length=505

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK+ STK MDNN  KCAIDHI EAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKIGSTKSMDNNQIKCAIDHILEAQDKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLG YDIPAESKILVNAWWLANNP  WK PEEFRPERFFEEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGSYDIPAESKILVNAWWLANNPEQWKKPEEFRPERFFEEESHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+D  EKGGQFSLHI  HSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGMSKIDVKEKGGQFSLHIXNHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AGU91429.1| trans-cinnamate 4-monooxygenase [Chrysanthemum boreale]
Length=505

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK +DNN  KCAIDHI EA+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSLDNNQIKCAIDHILEAKDKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGVSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|KHG02507.1| Cytochrome P450 protein [Gossypium arboreum]
Length=532

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 217/271 (80%), Positives = 229/271 (85%), Gaps = 27/271 (10%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVA--------------  862
            RKKL+STK  DNN+ KCAIDHI +AQQKGEINEDNVLYIVENINVA              
Sbjct  261  RKKLASTKRTDNNALKCAIDHILDAQQKGEINEDNVLYIVENINVAGKIVRFFSSLLPLD  320

Query  861  -------------AIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHK  721
                         AIETTLWSIEWGIAELVN+P +Q+KLR+EID VLGPG Q+TEPDTHK
Sbjct  321  LKISSELKVNLVKAIETTLWSIEWGIAELVNHPEIQQKLRNEIDTVLGPGVQVTEPDTHK  380

Query  720  LPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNp  541
            LPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP+ WKNP
Sbjct  381  LPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKNP  440

Query  540  eefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPP  361
            EEFRPERFFEEE  VEANGNDFR+LPFGVGRRSCPGIILALPILGI LGRLVQNFELLPP
Sbjct  441  EEFRPERFFEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPP  500

Query  360  PGHSKVDTTEKGGQFSLHILKHSTIVMKPRC  268
             G SK+DT+EKGGQFSLHILKHSTIV KPR 
Sbjct  501  KGQSKLDTSEKGGQFSLHILKHSTIVAKPRM  531



>ref|XP_003544934.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Glycine max]
Length=505

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S K  +NN  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSIKSSNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+K+RDEID VL  G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKVRDEIDRVLEAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEELHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I LGRLVQNFELLPPPG S++DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>emb|CAP08827.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08834.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08835.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08836.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
 emb|CAP08837.1| cinnamate-4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 224/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS I+M
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIILM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>ref|XP_002266238.1| PREDICTED: trans-cinnamate 4-monooxygenase [Vitis vinifera]
 emb|CAN77208.1| hypothetical protein VITISV_026676 [Vitis vinifera]
Length=505

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 207/242 (86%), Positives = 223/242 (92%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  D+NS KCA+DHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKSTDHNSLKCAVDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLRDE++ VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPHIQKKLRDELNTVLGPGVQVTEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGGYDIPAESKILVNAWWLAN+ S WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLGGYDIPAESKILVNAWWLANDSSKWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +K+DTT KGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQAKLDTTGKGGQFSLHILKHSTIVA  500

Query  279  KP  274
            +P
Sbjct  501  RP  502



>ref|XP_010510361.1| PREDICTED: trans-cinnamate 4-monooxygenase [Camelina sativa]
Length=505

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 225/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HEAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AAC49187.2| trans-cinnamic acid hydroxylase [Pisum sativum]
Length=503

 Score =   375 bits (963),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  259  RKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIA  318

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  319  ELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNL  378

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  379  HDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  438

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  439  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  498

Query  279  KPRC  268
            KPR 
Sbjct  499  KPRA  502



>gb|ADO16181.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=505

 Score =   375 bits (963),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK +DNN  KCAIDHI EA+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSLDNNQIKCAIDHILEAKDKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGVSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>sp|Q43067.2|TCMO_PEA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Pisum 
sativum]
Length=505

 Score =   375 bits (963),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AEH68208.1| cinnamate 4-hydroxylase [Astragalus mongholicus]
Length=505

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKTTSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            EL N+P +Q K+RDEID+VLGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELANHPEIQNKVRDEIDSVLGPGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL G+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLAGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERFLEEESHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AAN63028.1| cinnamate 4-hydroxylase [Ruta graveolens]
Length=506

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M   + KCAIDH+ +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLTSTKSMTEENFKCAIDHVLDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR EID VLGP  Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPDIQKKLRAEIDRVLGPDHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP+ WK+P+ FRPERF EEE  VEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPAHWKDPQVFRPERFLEEESGVEANGNDFRYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSL IL HSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLFILNHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>sp|Q9AR74.1|TCMO_RUTGR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Ruta 
graveolens]
 emb|CAC35977.1| putative cinnamate 4-hydroxylase [Ruta graveolens]
Length=506

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M   + KCAIDH+ +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLTSTKSMTEENFKCAIDHVLDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR EID VLGP  Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPDIQKKLRAEIDRVLGPDHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP+ WK+P+ FRPERF EEE  VEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPAHWKDPQVFRPERFLEEESGVEANGNDFRYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSL IL HSTIV+
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLFILNHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AGC29944.1| CYP73A107 [Sinopodophyllum hexandrum]
 gb|AGV76060.1| cinnamate-4-hydroxylase [Sinopodophyllum hexandrum]
Length=504

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 225/244 (92%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG  N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLTSTKG-SNVGLKCAIDHIVDAQEKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  320  ELVNHPEIQQKLRHELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAW+LANNP  WKNPEEFRPERF EEE +VEANGNDFR+LPF
Sbjct  380  HDAKLGGFDIPAESKILVNAWFLANNPEHWKNPEEFRPERFLEEEANVEANGNDFRYLPF  439

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DTTEKGGQFS+ ILKHSTIV+
Sbjct  440  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQDKLDTTEKGGQFSMFILKHSTIVV  499

Query  279  KPRC  268
            KPR 
Sbjct  500  KPRV  503



>gb|EYU36901.1| hypothetical protein MIMGU_mgv1a004876mg [Erythranthe guttata]
Length=506

 Score =   375 bits (962),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG D+   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  262  RKKLTSTKGTDSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            EL+N+P +QKKLRDEID ++GPG Q+TEPDT++LPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  322  ELINHPEIQKKLRDEIDTLVGPGVQITEPDTYRLPYLQAVVKETLRLRMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAW+LAN+ + WK PEEFRPERF EEE +VEANGNDFR+LPF
Sbjct  382  HDAKLAGYDIPAESKILVNAWFLANDEAHWKKPEEFRPERFLEEESNVEANGNDFRYLPF  441

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFE+LPPPG SK+DTT K GQFSL ILKHSTIV+
Sbjct  442  GVGRRSCPGIILALPILGITLGRLVQNFEMLPPPGESKIDTTGKAGQFSLQILKHSTIVL  501

Query  279  KPRC  268
            KPR 
Sbjct  502  KPRS  505



>dbj|BAI77480.1| cinnamate-4-hydroxylase [Brassica rapa]
 emb|CDY10741.1| BnaA05g11950D [Brassica napus]
Length=505

 Score =   375 bits (962),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKLDTSEKGGQFSLHILHHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|NP_001237317.1| trans-cinnamate 4-monooxygenase [Glycine max]
 sp|Q42797.1|TCMO_SOYBN RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Glycine 
max]
 emb|CAA63172.1| cinnamic acid 4-hydroxylase [Glycine max]
 gb|ACN81819.1| coumarate 4-hydroxylase [Glycine max]
 gb|AEX32785.1| cinnamate-4-hydroxylase [Glycine max]
Length=506

 Score =   375 bits (962),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 211/245 (86%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSX-KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK  +NN+  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLGSTKSTNNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +Q+KLRDEID VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEE  VEANGNDFR+LP
Sbjct  381  LHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEESLVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT+EKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>gb|AFV47361.1| C4H [Helichrysum aureonitens]
Length=504

 Score =   374 bits (961),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 222/243 (91%), Gaps = 0/243 (0%)
 Frame = -2

Query  996  KKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAE  817
            ++L STK MDNN  KCAIDHI EA+ KGEINEDNV YIVENINVAAIETTLWSIEWGIAE
Sbjct  261  RRLGSTKSMDNNQLKCAIDHILEAKDKGEINEDNVPYIVENINVAAIETTLWSIEWGIAE  320

Query  816  LVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLH  637
            LVN+P +Q KLR+E+D +LGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNLH
Sbjct  321  LVNHPEIQAKLRNELDTILGPGVQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLH  380

Query  636  DAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFG  457
            DAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERFFEEE +VEANGNDFR+LPFG
Sbjct  381  DAKLGGFDIPAESKILVNAWWLANNPEQWKKPEEFRPERFFEEESNVEANGNDFRYLPFG  440

Query  456  VGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMK  277
            VGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHST+V K
Sbjct  441  VGRRSCPGIILALPILGITIGRLVQNFELLPPPGVSKIDTSEKGGQFSLHILKHSTVVAK  500

Query  276  PRC  268
            PR 
Sbjct  501  PRS  503



>ref|XP_010414263.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
 ref|XP_010469851.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Camelina sativa]
Length=505

 Score =   374 bits (961),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 204/243 (84%), Positives = 225/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ H+LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHRLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HEAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AFD36436.1| cinnamate 4-hydroxylase 1 [Astragalus membranaceus]
Length=505

 Score =   374 bits (961),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKTTSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q K+RDEID+VLGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQNKVRDEIDSVLGPGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL G+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLAGFDIPAESKILVNAWWLANNPDHWKKPEEFRPERFLEEESHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQFKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|KGN46762.1| hypothetical protein Csa_6G133710 [Cucumis sativus]
Length=391

 Score =   370 bits (951),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 203/242 (84%), Positives = 220/242 (91%), Gaps = 0/242 (0%)
 Frame = -2

Query  993  KLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAEL  814
            KL++TK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAEL
Sbjct  149  KLANTKSTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAEL  208

Query  813  VNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHD  634
            VN+P +Q+KLR+E+D VLGPG  +TEPDT KLPYLQAV+KETLRLRM IPLLVPHMNLHD
Sbjct  209  VNHPEIQRKLRNELDTVLGPGVPITEPDTQKLPYLQAVVKETLRLRMTIPLLVPHMNLHD  268

Query  633  AKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGV  454
            AKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDF++LPFG 
Sbjct  269  AKLAGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEANGNDFKYLPFGA  328

Query  453  GRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKP  274
            GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV+KP
Sbjct  329  GRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVVKP  388

Query  273  RC  268
            R 
Sbjct  389  RV  390



>gb|ACF74449.1| trans-cinnamate 4-monooxygenase [Echinacea angustifolia]
Length=505

 Score =   374 bits (961),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK MD+N  KCAIDHI EA+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKKMDDNQLKCAIDHILEAKDKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEEAKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT EKGGQFSLHILKHST+V 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTVVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_008782669.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG  N   KCAIDHI EA++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKGASNMELKCAIDHILEAERKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR E+D VLGPG Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRQELDTVLGPGVQITEPDIPKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL G DIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLAGCDIPAESKILVNAWWLANNPDNWKNPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I +G+LVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILNITIGQLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVC  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|NP_001266151.1| trans-cinnamate 4-monooxygenase [Cicer arietinum]
 sp|O81928.2|TCMO_CICAR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Cicer 
arietinum]
 emb|CAA07519.2| trans-cinnamic 4-monooxygenase [Cicer arietinum]
Length=505

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQQKGEIN+DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  260  RKKLGSTKSTTNEGLKCAIDHILDAQQKGEINDDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q K+R+EID VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  320  ELVNHQKIQNKVREEIDRVLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL G+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  380  HDAKLSGFDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEESHVEANGNDFRYLPF  439

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG SK+DT EKGGQFSLHILKHSTIV 
Sbjct  440  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVC  499

Query  279  KPRC  268
            KPR 
Sbjct  500  KPRS  503



>gb|ACR44227.1| C4H [Glycine max]
 gb|ADG63467.1| C4H [Glycine max]
Length=506

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 210/245 (86%), Positives = 225/245 (92%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSX-KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK  +NN+  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLGSTKSTNNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +Q+KLRDEID VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKLGGYDIPAES+ILVNAWWLANNP+ WK PEEFRPERFFEEE  VEANGNDFR+LP
Sbjct  381  LHDAKLGGYDIPAESRILVNAWWLANNPAHWKKPEEFRPERFFEEESLVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT+EKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>emb|CDX97826.1| BnaC04g41130D [Brassica napus]
Length=505

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 224/244 (92%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWG+A
Sbjct  261  RKQIASSKATGSEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGVA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            + AKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NVAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>sp|P37115.1|TCMO_VIGRR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Vigna 
radiata var. radiata]
 gb|AAA33755.1| cinnamate 4-hydroxylase [Vigna radiata var. radiata]
Length=505

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK + STK  +N   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKNIGSTKSTNNEGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+K+RDEID VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKVRDEIDRVLGVGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEESHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG S++DT+EKGGQFSLHILKHST+V 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTVVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>sp|Q43033.1|TCMO_PETCR RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Petroselinum 
crispum]
 gb|AAC41660.1| trans-cinnamate 4-monooxygenase [Petroselinum crispum]
Length=506

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 207/243 (85%), Positives = 218/243 (90%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S K +DNNS KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  262  RKKLESIKSVDNNSLKCAIDHIIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +QKKLR E+D VLG G Q+ EPD  KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  322  ELVNNPEIQKKLRHELDTVLGAGVQICEPDVQKLPYLQAVIKETLRYRMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ W  P+EFRPERF EEE  VEANGNDF+++PF
Sbjct  382  HDAKLAGYDIPAESKILVNAWWLANNPAHWNKPDEFRPERFLEEESKVEANGNDFKYIPF  441

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGIV+GRLVQNFELLPPPG SK+DT EKGGQFSL ILKHSTIV 
Sbjct  442  GVGRRSCPGIILALPILGIVIGRLVQNFELLPPPGQSKIDTAEKGGQFSLQILKHSTIVC  501

Query  279  KPR  271
            KPR
Sbjct  502  KPR  504



>gb|ABQ53544.1| cinnamic acid 4-hydroxylase [Arachis diogoi]
Length=226

 Score =   363 bits (932),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/226 (90%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -2

Query  945  IDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDEIDA  766
            IDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVN+P +QK +RDEID 
Sbjct  1    IDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKNVRDEIDT  60

Query  765  VLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILV  586
            VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILV
Sbjct  61   VLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILV  120

Query  585  NAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilg  406
            NAWWLANNP+ WKNPEEFRPERF EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILG
Sbjct  121  NAWWLANNPANWKNPEEFRPERFLEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILG  180

Query  405  ivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPRC  268
            I LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV KPR 
Sbjct  181  ITLGRLVQNFELLPPPGQSKLDTTEKGGQFSLHILKHSTIVAKPRS  226



>gb|KFK22945.1| hypothetical protein AALP_AAs47561U000100 [Arabis alpina]
Length=505

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S K + N   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASAKPIGNEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLG G Q+TEP+ HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGLGVQVTEPELHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDF+++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFKYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>ref|XP_007146898.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
 gb|ESW18892.1| hypothetical protein PHAVU_006G079700g [Phaseolus vulgaris]
Length=505

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK L STK  DN   KCAIDHI +AQ+KGEI+EDNVLYIVENINVAAIETTLW+IEWGIA
Sbjct  261  RKNLESTKRRDNGGLKCAIDHILDAQKKGEISEDNVLYIVENINVAAIETTLWTIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKK+R+EID V+GPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKVREEIDRVVGPGNQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
              AKLGGYDIPAESK+LVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFRFLPF
Sbjct  381  QHAKLGGYDIPAESKVLVNAWWLANNPAHWKKPEEFRPERFLEEESKVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQDKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_009374388.1| PREDICTED: trans-cinnamate 4-monooxygenase [Pyrus x bretschneideri]
Length=557

 Score =   375 bits (962),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 221/242 (91%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  314  RKKLSSTKPTTNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  373

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+D VLG G Q+TEPD HKLP LQAV+KETLRLRMAIPLLVPHMNL
Sbjct  374  ELVNHPEIQKKLRNELDTVLGRGVQITEPDVHKLPSLQAVVKETLRLRMAIPLLVPHMNL  433

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  434  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  493

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIVM
Sbjct  494  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKLDTSEKGGQFSLHILKHSTIVM  553

Query  279  KP  274
            KP
Sbjct  554  KP  555



>dbj|BAA24355.1| trans-cinnamate 4-hydroxylase [Arabidopsis thaliana]
Length=505

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/243 (84%), Positives = 223/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KL +E+D VLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLGNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEESHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HS IVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSIIVM  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|ABF17873.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 gb|ABF17874.1| cinnamate 4-hydroxylase isoform 1 [Brassica napus]
 emb|CDY02068.1| BnaC04g14330D [Brassica napus]
Length=505

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI  AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILVAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDF+++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFKYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILHHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_003616037.1| Trans-cinnamate 4-monooxygenase [Medicago truncatula]
 gb|ABC59087.1| cytochrome P450 monooxygenase CYP73A3 [Medicago truncatula]
 gb|ADK91846.1| coumarate 4-hydroxylase [Medicago truncatula]
 gb|AES98995.1| cytochrome P450 family cinnamate 4-hydroxylase [Medicago truncatula]
Length=506

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 207/245 (84%), Positives = 223/245 (91%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGM-DNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK    N+  KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLESTKSTTSNDGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+ G+Q K+R+E+D VLGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHQGIQNKVREEMDRVLGPGHQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL G+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LP
Sbjct  381  LHDAKLNGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFLEEESHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>ref|XP_010922761.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK L+STK  DN   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKNLASTKPTDNAGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRNELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDA+LGGYDIPAESKILVNAWWLANNP  WK PEEFRPERF +EE  VEA+GND R+LPF
Sbjct  381  HDARLGGYDIPAESKILVNAWWLANNPDNWKKPEEFRPERFLQEEAKVEASGNDSRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  K+DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQKKLDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>dbj|BAF81522.1| cinnamate-4-hydroxylase [Brassica rapa]
 dbj|BAI77479.1| cinnamate-4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASWKPTGSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKLDTSEKGGQFSLHILHHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_009141068.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   372 bits (955),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++ +K   +   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWG+A
Sbjct  261  RKQIARSKATGSEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGVA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP++WK PEEFRPERFFEEE HVEANGNDFR +PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRDVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRT  504



>gb|AIS92509.1| cinnamate 4-hydroxylase [Epimedium sagittatum]
Length=505

 Score =   372 bits (955),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 207/244 (85%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+L+ST    N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKRLTSTTTPSNAGLKCAIDHIIDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +Q++LR+E+DA LGPG  +TEPDT+KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNNPKIQQRLREELDANLGPGVPITEPDTYKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL G+DIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  NDAKLNGFDIPAESKILVNAWWLANNPEHWKNPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+DTTEKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQEKLDTTEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_008788521.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Phoenix dactylifera]
Length=505

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSSTK  DN   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLSSTKPADNAELKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KL  E+D VLGPG Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLCKELDTVLGPGVQVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAW LANNP  WK PEEFRPERF +EE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWLLANNPDHWKKPEEFRPERFLQEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG  ++DT EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQKQLDTAEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|XP_006294053.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
 gb|EOA26951.1| hypothetical protein CARUB_v10023044mg [Capsella rubella]
Length=506

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 223/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  262  RKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLG G Q+TEP+ HKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  322  ELVNHPEIQSKLRNEMDTVLGLGVQVTEPELHKLPYLQAVVKETLRLRMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  382  HDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  441

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HSTIVM
Sbjct  442  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLHILNHSTIVM  501

Query  279  KPR  271
            KPR
Sbjct  502  KPR  504



>gb|AGP25594.1| cinnamate 4-hydroxylase [Aquilaria sinensis]
Length=504

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 216/243 (89%), Gaps = 0/243 (0%)
 Frame = -2

Query  996  KKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAE  817
            +KL+ST  + N   KCAIDHI +AQ KGEINEDNVLYIVENINVAAIETTLWSIEW IAE
Sbjct  261  RKLASTTSVSNEGLKCAIDHILDAQHKGEINEDNVLYIVENINVAAIETTLWSIEWAIAE  320

Query  816  LVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLH  637
            LVN+P +Q KLR E+D VLG G Q+TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLH
Sbjct  321  LVNHPEIQTKLRRELDTVLGVGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLH  380

Query  636  DAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFG  457
            DAKLGGYDIPAESKILVNAWWLANNP+ W   EEFRPERF EEE  VEANGNDFRFLPFG
Sbjct  381  DAKLGGYDIPAESKILVNAWWLANNPANWDRSEEFRPERFLEEESKVEANGNDFRFLPFG  440

Query  456  VGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMK  277
            VGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DTTEKGGQFSLHIL HSTIV K
Sbjct  441  VGRRSCPGIILALPILGITIGRLVQNFELLPPPGCSKLDTTEKGGQFSLHILNHSTIVAK  500

Query  276  PRC  268
            PR 
Sbjct  501  PRT  503



>prf||2209439A cytochrome P450 monooxygenase
Length=503

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 220/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  259  RKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIA  318

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  319  ELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNL  378

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAE+KILVNAWWL NNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  379  HDAKLGGFDIPAETKILVNAWWLRNNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  438

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  439  GVGRRSCPGIILALPILGIHIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVA  498

Query  279  KPRC  268
            KPR 
Sbjct  499  KPRA  502



>gb|AGO03798.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=505

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            R+KL STK +DNN  KCAIDHI EA+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RRKLGSTKSLDNNQIKCAIDHILEAKDKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQVTEPDIQNLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  V+ANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEESKVDANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGVSKIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_004500376.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cicer arietinum]
Length=505

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 219/244 (90%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S +  +N   KCA+DHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSIRRTENEGLKCAMDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLRDEID +LGP  Q+TE DTHKLPYLQA+IKETLRLRM+IPLLVPHMNL
Sbjct  321  ELVNHPSIQNKLRDEIDKILGPKHQVTEQDTHKLPYLQAIIKETLRLRMSIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLG YD  AESKILVNAWWLANNP  WKNPEEFRPERF EEE  VEANGNDFRFLPF
Sbjct  381  HDAKLGSYDXXAESKILVNAWWLANNPVHWKNPEEFRPERFLEEESKVEANGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPI+GI LGRLVQNFELLPPPG SK+DTTEKGGQFSLHILKHSTIV+
Sbjct  441  GVGRRSCPGIILALPIIGITLGRLVQNFELLPPPGESKIDTTEKGGQFSLHILKHSTIVL  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_007142041.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
 gb|ESW14035.1| hypothetical protein PHAVU_008G247400g [Phaseolus vulgaris]
Length=505

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 204/244 (84%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK + STK  +N   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKNIGSTKSTNNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+K R+E+D VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKAREEMDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEEAHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRL+QNFELLPPPG S++DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITLGRLIQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_010931381.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Elaeis guineensis]
Length=505

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK  DN   KCAIDHI +A++KGEINEDNVLYIVENINVAAIETTLWSIEW IA
Sbjct  261  RKKLASTKPTDNAGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWAIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLR+E+D  LGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQQKLRNELDTALGPGVQVTEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VE  GNDFRFLPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPEHWKKPEEFRPERFLEEEAKVEPTGNDFRFLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPP G  K+DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPAGQKKLDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRV  504



>ref|NP_001288861.1| trans-cinnamate 4-monooxygenase [Brassica rapa]
 dbj|BAI77481.1| cinnamate-4-hydroxylase [Brassica rapa]
Length=505

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 223/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASWKPTGSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVI+ETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIEETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKLDTSEKGGQFSLHILHHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AHG97392.1| C4H catalytic cinnamic acid-4-hydroxylase [Ageratina adenophora]
Length=505

 Score =   370 bits (951),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 217/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK M NN  KCAIDHI EA++KGEI EDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKKMGNNELKCAIDHILEAKEKGEITEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGPG Q+TEPD   LPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP  WK PEEFRPERF EEE  VEA+GNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPEQWKKPEEFRPERFLEEEAKVEASGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILA+PILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLH LKHST+V 
Sbjct  441  GVGRRSCPGIILAMPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHTLKHSTVVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>gb|AAG09206.1|AF175276_1 trans-cinnamic acid hydroxylase [Pisum sativum]
Length=332

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  96   RKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIA  155

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  156  ELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNL  215

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  216  HDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  275

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHST  289
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHST
Sbjct  276  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHST  332



>gb|ACB78015.1| cinnamic acid 4-hydroxylase, partial [Trifolium pratense]
Length=498

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 206/245 (84%), Positives = 221/245 (90%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGM-DNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK    N+  KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGI
Sbjct  253  RKKLESTKSTTSNDGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGI  312

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+  +Q K+R+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  313  AELVNHQEIQNKVREEMDRVLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMN  372

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LP
Sbjct  373  LHDAKLAGYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESHVEANGNDFRYLP  432

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV
Sbjct  433  FGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIV  492

Query  282  MKPRC  268
             KPR 
Sbjct  493  AKPRS  497



>dbj|BAJ17666.1| cinnamate 4-hydroxylase [Gynura bicolor]
Length=505

 Score =   370 bits (949),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 213/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK+ STK MD N  KCAIDHI EA++KGEINEDNVLYIVENINVAAIETTLWSIEWG+A
Sbjct  261  RKKIGSTKKMDKNELKCAIDHILEAKEKGEINEDNVLYIVENINVAAIETTLWSIEWGLA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D  LGP  Q+TEPD   LPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPKIQAKLRHELDTKLGPSVQITEPDVQNLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAWWLANNP  WKN  EFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGYDIPAESKILVNAWWLANNPDHWKNANEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I LGRLVQNFELLPPPG  K+D +EKGGQFSLHILKH T+V 
Sbjct  441  GVGRRSCPGIILALPILAITLGRLVQNFELLPPPGQDKIDMSEKGGQFSLHILKHYTVVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_010522015.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Tarenaya hassleriana]
Length=505

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 220/242 (91%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++STK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASTKATSNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q++LR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  321  ELVNHQEIQRRLRNELDTVLGPGVQVTEPDIPKLPYLQAVIKETLRYRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGGYDIPAESKILVNAW+LANNP+ WK P+EFRPERF EEE  VEANGNDFR++PF
Sbjct  381  HDAKLGGYDIPAESKILVNAWYLANNPNNWKKPDEFRPERFLEEESQVEANGNDFRYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG S+VDTTEKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSQVDTTEKGGQFSLHILNHSTIVM  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>gb|AHY94893.1| cinnamate-4-hydroxylase [Prunella vulgaris]
Length=505

 Score =   369 bits (948),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 204/242 (84%), Positives = 219/242 (90%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK  D +  KCAID + EAQQKGEINEDNVLYIVENINVAAIETTLWS+EWGIA
Sbjct  261  RKKLVSTKPADKDGLKCAIDLMIEAQQKGEINEDNVLYIVENINVAAIETTLWSVEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D VLGPG Q+TEPD +KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQNKLRHELDTVLGPGVQITEPDIYKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESK+LVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKVLVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI LGRLVQNFELLPPPG  K+ T+EKGGQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQKKIGTSEKGGQFSLHILKHSTIVM  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>ref|XP_010542699.1| PREDICTED: trans-cinnamate 4-monooxygenase [Tarenaya hassleriana]
Length=505

 Score =   369 bits (948),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++STK   N   KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASTKPTSNEGLKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLG G Q+TEPD HKLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNELDTVLGHGVQITEPDIHKLPYLQAVIKETLRYRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+ KLGGYD+PAESKILVNAW+LANNP+ WK P+EFRPERF EEE +VEANGNDFR++PF
Sbjct  381  HEGKLGGYDVPAESKILVNAWFLANNPNNWKKPDEFRPERFLEEESNVEANGNDFRYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG S+VDTTEKGGQFSLHIL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSQVDTTEKGGQFSLHILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_006842509.1| PREDICTED: trans-cinnamate 4-monooxygenase [Amborella trichopoda]
 gb|ERN04184.1| hypothetical protein AMTR_s00077p00107120 [Amborella trichopoda]
Length=504

 Score =   369 bits (948),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 218/244 (89%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG  +   KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLASTKG-SSGDLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR E+D+VLGPG  +TEPDT+KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  320  ELVNHPHIQAKLRAELDSVLGPGVPITEPDTYKLPYLQAVIKETLRFRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESK+LVNAWWLANNP  W  PEEFRPERF  EE  VEANGNDFR+LPF
Sbjct  380  HDAKLTGYDIPAESKVLVNAWWLANNPDNWVRPEEFRPERFLAEEARVEANGNDFRYLPF  439

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILG+ LGRLVQNFELLPPPG  KVDTTEKGGQFSLHILKHSTIV 
Sbjct  440  GVGRRSCPGIILALPILGLTLGRLVQNFELLPPPGQDKVDTTEKGGQFSLHILKHSTIVA  499

Query  279  KPRC  268
            KPR 
Sbjct  500  KPRV  503



>gb|ACB78016.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   369 bits (948),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 206/245 (84%), Positives = 221/245 (90%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGM-DNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK    N+  KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLESTKSTTSNDGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+  +Q K+R+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHQEIQNKVREEMDRVLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LP
Sbjct  381  LHDAKLAGYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>gb|AAG09205.1|AF175275_1 trans-cinnamic acid hydroxylase [Pisum sativum]
Length=497

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 217/237 (92%), Gaps = 0/237 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK  DN   KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKSTDNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHST  289
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHST
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHST  497



>gb|ACB78014.1| cinnamic acid 4-hydroxylase [Trifolium pratense]
Length=506

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 205/245 (84%), Positives = 221/245 (90%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGM-DNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK    N+  KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLESTKSTTSNDGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+  +Q K+R+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHQEIQNKVREEMDRVLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKL GYDIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+LP
Sbjct  381  LHDAKLAGYDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHST+V
Sbjct  441  FGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTVV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>emb|CAP08847.1| cinnamate-4-hydroxylase [Arabidopsis lyrata]
Length=226

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  942  DHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDEIDAV  763
            DHI EA+QKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVN+P +Q KLR+EID V
Sbjct  1    DHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQSKLRNEIDTV  60

Query  762  LGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVN  583
            LGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKL GYDIPAESKILVN
Sbjct  61   LGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVN  120

Query  582  AWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgi  403
            AWWLANNP++WK PEEFRPERFFEEE HVEANGNDFRF+PFGVGRRSCPGIILALPILGI
Sbjct  121  AWWLANNPNSWKKPEEFRPERFFEEEAHVEANGNDFRFVPFGVGRRSCPGIILALPILGI  180

Query  402  vlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPR  271
             +GR+VQNFELLPPPG SKVDT+EKGGQFSLHIL HSTIVMKPR
Sbjct  181  TIGRMVQNFELLPPPGQSKVDTSEKGGQFSLHILNHSTIVMKPR  224



>gb|ABE68874.1| cinnamate 4-hydroxylase [Brassica rapa subsp. pekinensis]
Length=505

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 221/244 (91%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S+K   +   KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKQIASSKPTGSEGLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+ HKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQTKLRNEIDTVLGPGVQVTEPELHKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERFFEEE HVEANGNDFR++PF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFFEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EK GQFSL IL  STIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKSGQFSLQILNQSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|AAO62904.1| cinnamate 4-hydroxylase [Ammi majus]
Length=506

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 204/243 (84%), Positives = 217/243 (89%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S K + NNS KCAIDHI EAQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  262  RKKLESIKSVGNNSLKCAIDHIIEAQEKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +QKKLR E+D VLG G Q+ EPD  KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  322  ELVNNPEIQKKLRHELDTVLGAGVQICEPDVQKLPYLQAVIKETLRYRMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H+AKL GYDIPAESKILVNAWWLANNP+ W  P+EFRPERF EEE  VEANGNDF+++PF
Sbjct  382  HEAKLAGYDIPAESKILVNAWWLANNPAHWNKPDEFRPERFLEEESKVEANGNDFKYIPF  441

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGIV+GRLVQNFELLPPPG SK+DT EKGGQFSL ILKHSTIV 
Sbjct  442  GVGRRSCPGIILALPILGIVIGRLVQNFELLPPPGQSKIDTAEKGGQFSLQILKHSTIVC  501

Query  279  KPR  271
            KPR
Sbjct  502  KPR  504



>gb|AEA72281.1| cinnamate 4-hydroxylase [Angelica gigas]
Length=505

 Score =   367 bits (942),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 202/243 (83%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S K +DNN  KCAIDHI EAQQKGEI+EDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLESIKSVDNNGLKCAIDHILEAQQKGEIHEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +QKKLR+E+D VLG G Q+ EPD  KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  321  ELVNNPEIQKKLRNEMDTVLGVGVQICEPDIQKLPYLQAVIKETLRYRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNP EFRPERF EEE  VEANGNDF+++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPAHWKNPNEFRPERFLEEESKVEANGNDFKYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT EK GQFSL I KH TIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGMSKIDTAEKAGQFSLQISKHYTIVC  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AJD22263.1| cinnamate 4-hydroxylase [Angelica dahurica]
Length=505

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 202/243 (83%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL S K +DNN  KCAIDHI EAQQKGEI+EDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLESIKSVDNNGLKCAIDHILEAQQKGEIHEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +QKKLR+E+D VLG G Q+ EPD  KLPYLQAVIKETLR RMAIPLLVPHMNL
Sbjct  321  ELVNNPEIQKKLRNEMDTVLGVGVQICEPDVQKLPYLQAVIKETLRYRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNP EFRPERF EEE  VEANGNDF+++PF
Sbjct  381  HDAKLAGYDIPAESKILVNAWWLANNPAHWKNPNEFRPERFLEEESKVEANGNDFKYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT EK GQFSL I KH TIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRMVQNFELLPPPGMSKIDTAEKAGQFSLQISKHYTIVC  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>gb|AFU54390.1| cinnamate 4-hydroxylase [Fagopyrum tataricum]
Length=504

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 204/242 (84%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   NN  KCAIDHI EAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKLGSTKPSSNNELKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDE+D VLG G  +TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQRKLRDELDTVLGKGVPITEPDLPKLPYLQAVVKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRP RFFEEE  VEANGNDFR+LPF
Sbjct  381  HDAKLGGFDIPAESKILVNAWWLANNPAQWKKPEEFRPGRFFEEEVKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI++GRLVQNFE+ PPPG  K+DT+EKGGQFSL ILKH TIVM
Sbjct  441  GVGRRSCPGIILALPILGIIIGRLVQNFEMFPPPGEDKLDTSEKGGQFSLPILKHFTIVM  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>ref|XP_009403855.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   361 bits (926),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 212/229 (93%), Gaps = 0/229 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            KCAIDHI +A+++GEIN DNVLYIVENINVAAIETTLWSIEWG+AELVN+PG+Q+KLR E
Sbjct  159  KCAIDHILDAERRGEINYDNVLYIVENINVAAIETTLWSIEWGVAELVNHPGIQRKLRQE  218

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            +DAVLGPG  +TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK
Sbjct  219  LDAVLGPGVPITEPDIPKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  278

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPFGVGRRSCPGIILALP
Sbjct  279  ILVNAWWLANNPANWKNPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALP  338

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPRC  268
            IL I LGRLVQNFELLPPPG  +VDTTEKGGQFSLHILKHSTIV KPR 
Sbjct  339  ILCITLGRLVQNFELLPPPGTDQVDTTEKGGQFSLHILKHSTIVCKPRA  387



>gb|AAG09207.1|AF175277_1 trans-cinnamic acid hydroxylase, partial [Pisum sativum]
Length=332

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N   KCAIDHI +AQ+KGEIN+DNVLYIVENINVAA+ETTLWSIEWGIA
Sbjct  96   RKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAMETTLWSIEWGIA  155

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q KLR+E+D VLGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHM+L
Sbjct  156  ELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMSL  215

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE HVEANGNDFR+L F
Sbjct  216  HDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLSF  275

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHST  289
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EKGGQFSLHILKHST
Sbjct  276  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHST  332



>gb|ABF58026.1| cinnamate-4-hydroxylate-like [Hibiscus cannabinus]
 gb|ACR08417.1| cinnamate 4-hydroxylase [Hibiscus cannabinus]
 gb|ACU86960.1| cinnamate 4-hydroxylase 2 [Hibiscus cannabinus]
Length=444

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST   DNN+ KCAIDHI +AQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  217  RKKLASTTRSDNNALKCAIDHILDAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  276

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q+KLRDEID VLGPG Q+TEPDTHKLPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  277  ELVNHPRIQQKLRDEIDTVLGPGVQVTEPDTHKLPYLQAVVKETLRLRMAIPLLVPHMNL  336

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL GYDIPAESKILVNAWWLANNP+ WKNPEEFRPERFFEEE  VEANGNDFR+LPF
Sbjct  337  HDAKLAGYDIPAESKILVNAWWLANNPAHWKNPEEFRPERFFEEESKVEANGNDFRYLPF  396

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQF  316
            GVGRRSCPGIILALPILGI LGR+VQNFELLPP G SK+DTTEKGGQF
Sbjct  397  GVGRRSCPGIILALPILGITLGRMVQNFELLPPNGQSKIDTTEKGGQF  444



>ref|XP_008363432.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Malus domestica]
Length=266

 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 215/242 (89%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            R+K +ST+   +   KCAIDHI EA+QKGEINEDN+ +IV+N+N AAIETT+WS+EWGIA
Sbjct  23   RRKHTSTQATTDEGLKCAIDHILEAKQKGEINEDNIYHIVDNVNAAAIETTMWSMEWGIA  82

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+DAVLG G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  83   ELVNHPEIQKKLREELDAVLGRGVQITEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNL  142

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK P EFRPERF EEE  VE NGNDFR+LPF
Sbjct  143  QDAKLGGFDIPAESKILVNAWWLANNPTLWKKPXEFRPERFLEEESKVETNGNDFRYLPF  202

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EK GQFSLH LKHSTIVM
Sbjct  203  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKXGQFSLHJLKHSTIVM  262

Query  279  KP  274
            KP
Sbjct  263  KP  264



>sp|P37114.1|TCMO_MEDSA RecName: Full=Trans-cinnamate 4-monooxygenase; AltName: Full=Cinnamic 
acid 4-hydroxylase; Short=C4H; Short=CA4H; AltName: 
Full=Cytochrome P450 73; AltName: Full=Cytochrome P450C4H [Medicago 
sativa]
Length=506

 Score =   362 bits (930),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 219/245 (89%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGM-DNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STK    N+  KCAIDHI +AQ+KGEIN+DNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLESTKSTTSNDGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+  +Q K+R+E+D VLGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHQDIQNKVREEMDRVLGPGHQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHD KL G+DIPAESKILVNAWWL NNP+ WK PEEFRPERF EEE HVEANGNDFR+LP
Sbjct  381  LHDPKLNGFDIPAESKILVNAWWLPNNPAHWKKPEEFRPERFLEEESHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI +GRLVQN ELLPPPG SK+DT+EKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITIGRLVQNVELLPPPGQSKIDTSEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>gb|ACY06865.2| cinnamate 4-hydroxylase [Astragalus chrysochlorus]
Length=506

 Score =   362 bits (928),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 215/246 (87%), Gaps = 2/246 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL STK   N+  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  260  RKKLGSTKTTSNDGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+  +Q K+RDEID++LGPG Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  320  ELVNHQEIQNKVRDEIDSILGPGHQVTEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNL  379

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            HDAKL G+DIPAESKILVNAWWLANNP  WKNPEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  380  HDAKLAGFDIPAESKILVNAWWLANNPDHWKNPEEFRPERFLEEESHVEANGNDFRYLPF  439

Query  459  GVGRRSCPgiilal--pilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTI  286
            GVGRRSCPGIILAL    + +V+ +   NFELL PPG SK+DT+EKGGQFSLHILKHSTI
Sbjct  440  GVGRRSCPGIILALPILGITLVVCKFGSNFELLSPPGQSKLDTSEKGGQFSLHILKHSTI  499

Query  285  VMKPRC  268
            V KPR 
Sbjct  500  VAKPRS  505



>gb|EMS54616.1| Trans-cinnamate 4-monooxygenase [Triticum urartu]
Length=436

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 208/267 (78%), Positives = 223/267 (84%), Gaps = 23/267 (9%)
 Frame = -2

Query  999  RKKLSSTKGM-DNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVA-------------  862
            RKKL STK + DN   KCAIDHI EA+QKGEINEDNVLYI+ENINVA             
Sbjct  169  RKKLVSTKAVEDNGGLKCAIDHILEAEQKGEINEDNVLYIIENINVAVVFDWPSWIWPHP  228

Query  861  ---------AIETTLWSIEWGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYL  709
                     AIETTLWSIEWG+AELVN+P +Q+KLRDE+DAVLG G Q+TEPDTHKLPYL
Sbjct  229  FQGAALVEDAIETTLWSIEWGLAELVNHPEIQQKLRDEMDAVLGVGHQITEPDTHKLPYL  288

Query  708  QAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefr  529
            QAVIKETLRLRMAIPLLVPHMNLHDAKL GY+IPAESKILVNAW+LANNP  WK P+EFR
Sbjct  289  QAVIKETLRLRMAIPLLVPHMNLHDAKLAGYNIPAESKILVNAWFLANNPEQWKRPDEFR  348

Query  528  perffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHS  349
            PERF EEEKHVEANGNDFR+LPFGVGRRSCPGIILALPILGI +GRLVQNF L PPPG  
Sbjct  349  PERFLEEEKHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFVLTPPPGQD  408

Query  348  KVDTTEKGGQFSLHILKHSTIVMKPRC  268
            K+DTTEKGGQFSLHILKHSTIV KPR 
Sbjct  409  KLDTTEKGGQFSLHILKHSTIVAKPRV  435



>gb|AHA84274.1| trans-cinnamate 4-monooxygenase [Phaseolus vulgaris]
Length=506

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 220/245 (90%), Gaps = 1/245 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNN-SXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RK + ST+        KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKNIGSTESTQTKEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P +Q+K R+E+D VLG G Q+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEIQQKAREEMDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLP  463
            LHDAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERFFEEE HVEANGNDFR+LP
Sbjct  381  LHDAKLGGFDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEEAHVEANGNDFRYLP  440

Query  462  FGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIV  283
            FGVGRRSCPGIILALPILGI LGRL+QNFELLPPPG S++DT+EKGGQFSLHILKHSTIV
Sbjct  441  FGVGRRSCPGIILALPILGITLGRLIQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIV  500

Query  282  MKPRC  268
             KPR 
Sbjct  501  AKPRS  505



>gb|ABX75854.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 199/250 (80%), Positives = 212/250 (85%), Gaps = 12/250 (5%)
 Frame = -2

Query  999  RKKLSSTKG-MDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGI  823
            RKKL STKG   NN  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGI
Sbjct  261  RKKLESTKGSTGNNGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGI  320

Query  822  AELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  643
            AELVN+P VQKKLR E+D VLG G  +TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN
Sbjct  321  AELVNHPEVQKKLRHEMDTVLGVGHLVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMN  380

Query  642  LHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANG-----ND  478
            LHDAKLGGY+IPAESKILVNAWWLANNP+ WKN         F  E+ +E  G     ND
Sbjct  381  LHDAKLGGYEIPAESKILVNAWWLANNPAQWKN------PEEFRPERFLEEGGKSGGRND  434

Query  477  FRFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILK  298
            FRFLPFG GRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHILK
Sbjct  435  FRFLPFGSGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLHILK  494

Query  297  HSTIVMKPRC  268
            HSTIV KPR 
Sbjct  495  HSTIVAKPRS  504



>gb|AEN19718.1| cinnamate 4-hydroxylase [Acacia auriculiformis x Acacia mangium]
Length=505

 Score =   359 bits (922),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 211/249 (85%), Gaps = 12/249 (5%)
 Frame = -2

Query  996  KKLSSTKG-MDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            KKL STKG   NN  KCAIDHI +AQ+KGEINEDNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  262  KKLESTKGSTGNNGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P VQKKLR E+D VLG G  +TEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  322  ELVNHPEVQKKLRHEMDTVLGVGHLVTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANG-----NDF  475
            HDAKLGGY+IPAESKILVNAWWLANNP+ WKN         F  E+ +E  G     NDF
Sbjct  382  HDAKLGGYEIPAESKILVNAWWLANNPAQWKN------PEEFRPERFLEEGGKSGGRNDF  435

Query  474  RFLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKH  295
            RFLPFG GRRSCPGIILALPILGI +GR+VQNFELLPPPG SK+DT+EKGGQFSLHILKH
Sbjct  436  RFLPFGSGRRSCPGIILALPILGITIGRMVQNFELLPPPGQSKIDTSEKGGQFSLHILKH  495

Query  294  STIVMKPRC  268
            STIV KPR 
Sbjct  496  STIVAKPRS  504



>gb|AID69233.1| cinnamate 4-hydroxylase [Garcinia mangostana]
Length=505

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 218/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK M N S KCAIDHI +AQQKGEINEDNVLY ++   +  + +TLWSIEWGIA
Sbjct  261  RKKLASTKSMSNESLKCAIDHILDAQQKGEINEDNVLYSLKISTLLQLRSTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKL  E+D +LGPG Q+TEPDT KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLHHELDTILGPGNQITEPDTQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGGYDIPAESKILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGND+++LPF
Sbjct  381  NDAKLGGYDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEANGNDYKYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG S++DT+EKGGQFSLHILKHSTIV 
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSRIDTSEKGGQFSLHILKHSTIVA  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRS  504



>ref|XP_006410151.1| hypothetical protein EUTSA_v10016544mg [Eutrema salsugineum]
 gb|ESQ51604.1| hypothetical protein EUTSA_v10016544mg [Eutrema salsugineum]
Length=505

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 216/244 (89%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+  S K   +   KCAIDHI EAQQ GEINEDNVLYIVENINVAA+ETTLWSIEWGIA
Sbjct  261  RKRTVSGKPSGSEGLKCAIDHILEAQQNGEINEDNVLYIVENINVAALETTLWSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEP+  KLPYLQAV+KETLRLRM +PLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPELQKLPYLQAVLKETLRLRMGVPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKL GYDIPAESKILVNAWWLANNPS+WK PEEFRPERFFEEE HVE +GNDFR+LPF
Sbjct  381  NDAKLAGYDIPAESKILVNAWWLANNPSSWKKPEEFRPERFFEEESHVETSGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG +KVD +EKGGQFSL IL HSTIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQTKVDNSEKGGQFSLQILNHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>emb|CDX84830.1| BnaA03g14000D [Brassica napus]
Length=503

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 215/244 (88%), Gaps = 2/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK++ S K     S K AIDHI EA++KGEIN DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKEIPSAK--PTGSVKYAIDHILEAEEKGEINADNVLYIVENINVAAIETTLWSIEWGIA  318

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KL++EID VLGPG Q+TEPD HKLPYLQAV+KETLRLRM +PLLVPHMNL
Sbjct  319  ELVNHPEIQSKLKNEIDTVLGPGVQVTEPDLHKLPYLQAVLKETLRLRMGVPLLVPHMNL  378

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKL GYDIPAESKILVNAWWLANNP +WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  379  KDAKLAGYDIPAESKILVNAWWLANNPESWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  438

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGI+LALPILGI +GRLVQNFELLPPPG SKVDTTE GGQFSL IL HSTIVM
Sbjct  439  GVGRRSCPGIVLALPILGITIGRLVQNFELLPPPGQSKVDTTEIGGQFSLKILNHSTIVM  498

Query  279  KPRC  268
            KPR 
Sbjct  499  KPRA  502



>ref|XP_009354880.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 195/244 (80%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLS T+   N   KCAIDH+ + QQKGEIN+DN+ +I++NINVAAIETTLWS+EWGIA
Sbjct  261  RKKLSDTQATTNEVLKCAIDHMLDEQQKGEINDDNIYHILDNINVAAIETTLWSMEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +QKKLR+E+DAVLG G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNL
Sbjct  321  ELVNHPEIQKKLREELDAVLGRGVQITEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKLGG+DIPAESKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  QDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I +GRLV N ELLPP G SK+DT+EK GQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILAITIGRLVHNLELLPPLGQSKIDTSEKSGQFSLHILKHSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>gb|ACN40359.1| unknown [Picea sitchensis]
Length=506

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 215/244 (88%), Gaps = 1/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL ST G +    KCAIDHIFEAQ KGEINEDNVLYIVENINVAAIETTLWS+EWGIA
Sbjct  264  RKKLGSTMGSNVTGDKCAIDHIFEAQDKGEINEDNVLYIVENINVAAIETTLWSMEWGIA  323

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            E+VN+P +Q+K+RDE+DAV+G G  LTEPDT +LPYLQAV+KETLRL MAIPLLVPHMNL
Sbjct  324  EIVNHPEIQQKIRDELDAVVGRGVPLTEPDTVRLPYLQAVVKETLRLHMAIPLLVPHMNL  383

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H AKLGGYDIPAESKILVNAW+LANNP  WKNPEEF PERF E+EK +EA+GNDFRFLPF
Sbjct  384  HQAKLGGYDIPAESKILVNAWFLANNPEWWKNPEEFIPERFLEDEK-IEASGNDFRFLPF  442

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL + +GRLVQNFELLPPPG S VD +EKGGQFSLHIL HS +V 
Sbjct  443  GVGRRSCPGIILALPILSLAIGRLVQNFELLPPPGQSNVDVSEKGGQFSLHILNHSVVVA  502

Query  279  KPRC  268
            KPR 
Sbjct  503  KPRA  506



>gb|AAW70021.1| cinnamic acid 4-hydroxylase [Ginkgo biloba]
Length=505

 Score =   355 bits (910),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 214/244 (88%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STKG  +   KCAIDHI +A  KGEINEDNVLYIVENINVAAIETTLWS+EWG+A
Sbjct  262  RKKLASTKGSSSLGEKCAIDHILDALDKGEINEDNVLYIVENINVAAIETTLWSMEWGLA  321

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            E+VN+P +Q+K+R E+D VLGPG ++TEPDT +LPYLQAV+KETLRL MAIPLLVPHMNL
Sbjct  322  EIVNHPDIQQKIRKELDTVLGPGVEITEPDTTRLPYLQAVVKETLRLHMAIPLLVPHMNL  381

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            + AKLGGYDIPAESKILVNAWWLANNP  W  PEEF PERF E+E+ +EANGNDFRFLPF
Sbjct  382  NQAKLGGYDIPAESKILVNAWWLANNPEWWNKPEEFIPERFLEDEQKIEANGNDFRFLPF  441

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL + LGRLVQNF+L PPPGHSKVD +EKGGQFSLHIL HS +V 
Sbjct  442  GVGRRSCPGIILALPILALSLGRLVQNFDLSPPPGHSKVDVSEKGGQFSLHILNHSVVVA  501

Query  279  KPRC  268
            KPR 
Sbjct  502  KPRV  505



>ref|XP_009421412.1| PREDICTED: trans-cinnamate 4-monooxygenase-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=503

 Score =   354 bits (909),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 196/229 (86%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            KCAIDHI +A+++GEIN DNVLYIVENINVAAIETTLWSIEWG+AELVN+P +Q+KLR E
Sbjct  275  KCAIDHILDAERRGEINYDNVLYIVENINVAAIETTLWSIEWGVAELVNHPEIQRKLRHE  334

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            +D+VLG G  +TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK
Sbjct  335  LDSVLGRGVPITEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  394

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAWWLANNP+ W+NPEEF PERF EEE  VEANGNDFR+LPFGVGRRSCPGIILALP
Sbjct  395  ILVNAWWLANNPAHWRNPEEFHPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALP  454

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPRC  268
            ILGI LGRLVQ+FELLPPPG SKVDTTEKGGQFSLHILKHSTIV KPR 
Sbjct  455  ILGITLGRLVQDFELLPPPGVSKVDTTEKGGQFSLHILKHSTIVCKPRA  503



>ref|XP_009421411.1| PREDICTED: trans-cinnamate 4-monooxygenase-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=513

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/229 (86%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            KCAIDHI +A+++GEIN DNVLYIVENINVAAIETTLWSIEWG+AELVN+P +Q+KLR E
Sbjct  285  KCAIDHILDAERRGEINYDNVLYIVENINVAAIETTLWSIEWGVAELVNHPEIQRKLRHE  344

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            +D+VLG G  +TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK
Sbjct  345  LDSVLGRGVPITEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  404

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAWWLANNP+ W+NPEEF PERF EEE  VEANGNDFR+LPFGVGRRSCPGIILALP
Sbjct  405  ILVNAWWLANNPAHWRNPEEFHPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALP  464

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPRC  268
            ILGI LGRLVQ+FELLPPPG SKVDTTEKGGQFSLHILKHSTIV KPR 
Sbjct  465  ILGITLGRLVQDFELLPPPGVSKVDTTEKGGQFSLHILKHSTIVCKPRA  513



>ref|XP_009410039.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/229 (86%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            KCAIDHI +A+++GEIN DNVLYIVENINVAAIETTLWSIEWG+AELVN+P +Q+KLR E
Sbjct  275  KCAIDHILDAERRGEINYDNVLYIVENINVAAIETTLWSIEWGVAELVNHPEIQRKLRQE  334

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            +D VLGPG  +TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGG+DIPAESK
Sbjct  335  LDTVLGPGVPITEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESK  394

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAWWLANNP+ WKNPEEFRPERF EEE  VEANGNDFR+LPFGVGRRSCPGIILALP
Sbjct  395  ILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALP  454

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPRC  268
            ILGI LG LVQ+FELLPPPG +KVDTTEKGGQFSLHILKHSTIV KPR 
Sbjct  455  ILGITLGSLVQSFELLPPPGANKVDTTEKGGQFSLHILKHSTIVCKPRA  503



>ref|XP_009132738.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=503

 Score =   351 bits (901),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 212/244 (87%), Gaps = 2/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK+++S K     S K AIDHI EA++KGEIN DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKEIASAK--PTGSVKYAIDHILEAEEKGEINADNVLYIVENINVAAIETTLWSIEWGIA  318

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG Q+TEPD HKLPYLQ V+KETLRLRM +PLLVPHMNL
Sbjct  319  ELVNHPEIQSKLRNEIDTVLGPGVQVTEPDLHKLPYLQVVLKETLRLRMGVPLLVPHMNL  378

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKL GYDIPAESKILVNAWWL NN  +WK PEEFRPERF EEE HVEANGNDFR+LPF
Sbjct  379  KDAKLAGYDIPAESKILVNAWWLGNNSESWKKPEEFRPERFLEEEAHVEANGNDFRYLPF  438

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G+GRRSCPGI+LALPILGI +GRLVQNFEL PPPG SKVDTTE GGQFSL IL HSTIVM
Sbjct  439  GLGRRSCPGIVLALPILGITIGRLVQNFELFPPPGQSKVDTTEIGGQFSLKILNHSTIVM  498

Query  279  KPRC  268
            KPR 
Sbjct  499  KPRA  502



>gb|AAD23378.1|AF096998_1 trans-cinnamate 4-hydroxylase [Pinus taeda]
Length=506

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 213/242 (88%), Gaps = 1/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+ST G      KCAIDHIFEA++KGEINEDNVLYIVENINVAAIETTLWS+EWG+A
Sbjct  264  RKKLASTTGSKVTGDKCAIDHIFEAEEKGEINEDNVLYIVENINVAAIETTLWSMEWGLA  323

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            E+VN+P +Q+K+R E+DAV+G G  LTEPDT KLPYLQAV+KETLRL MAIPLLVPHMNL
Sbjct  324  EIVNHPEIQQKIRAELDAVIGRGVPLTEPDTTKLPYLQAVVKETLRLHMAIPLLVPHMNL  383

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            H AKLGGYDIPAESKILVNAW+LANNP  W+ PEEF PERF  EEK +EA+GNDFRFLPF
Sbjct  384  HQAKLGGYDIPAESKILVNAWFLANNPEWWEKPEEFIPERFLGEEK-IEASGNDFRFLPF  442

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL + LGRLVQNFELLPPPG SKVD TEKGGQFSLHIL HS +V 
Sbjct  443  GVGRRSCPGIILALPILALALGRLVQNFELLPPPGQSKVDVTEKGGQFSLHILNHSVVVA  502

Query  279  KP  274
            KP
Sbjct  503  KP  504



>emb|CDP18607.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   340 bits (872),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 205/234 (88%), Gaps = 0/234 (0%)
 Frame = -2

Query  972  MDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQ  793
            MDNNS KCAIDH+ EAQQ GEINED++LYIVEN+N   +ET LW++EWGIAELVN+P +Q
Sbjct  1    MDNNSPKCAIDHLLEAQQNGEINEDHLLYIVENMNFMVMETPLWTLEWGIAELVNHPQIQ  60

Query  792  KKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYD  613
             KLRDEIDAVLGPG Q+TEPD  KLPYLQAVIKETL+ R+ +P LVPHMNL+DAKLGGYD
Sbjct  61   SKLRDEIDAVLGPGVQITEPDIDKLPYLQAVIKETLQFRVPVPFLVPHMNLNDAKLGGYD  120

Query  612  IPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPg  433
            +PAESKILVN WWLANNP  WK PEEFRP+RF EEE  VEANGNDFR+LPFGVGRRSCPG
Sbjct  121  VPAESKILVNTWWLANNPENWKRPEEFRPQRFLEEESKVEANGNDFRYLPFGVGRRSCPG  180

Query  432  iilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKPR  271
            I+LA+PIL + LG LVQNFELLPPPG SK+DTTEK GQFS H+L HSTIV+KPR
Sbjct  181  IVLAMPILSLTLGCLVQNFELLPPPGQSKIDTTEKSGQFSSHLLNHSTIVLKPR  234



>ref|XP_009141067.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Brassica rapa]
Length=505

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK++ S K       KCAIDHI EAQ+KGEINEDNVLYIVENINVAAIETTL S+EWGIA
Sbjct  261  RKQVPSAKPTGGGGLKCAIDHILEAQKKGEINEDNVLYIVENINVAAIETTLTSMEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG  +TEP  HKLPYLQAVIKET+R RMA+PLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVHVTEPALHKLPYLQAVIKETIRRRMAVPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKL GYDIPAES+IL+NAWWLANNP +W +PEEFRPERF EEE HVEANGNDFR++PF
Sbjct  381  KDAKLAGYDIPAESRILINAWWLANNPDSWNSPEEFRPERFLEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EK GQFSL IL  STIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKSGQFSLQILNQSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>emb|CDY29671.1| BnaA04g17560D [Brassica napus]
Length=505

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 191/244 (78%), Positives = 212/244 (87%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK++++ K       KCAIDHI EAQ KGEIN+DNVLYIVENINVAAIETTL S+EWGIA
Sbjct  261  RKQVATAKPTGGGGLKCAIDHILEAQNKGEINDDNVLYIVENINVAAIETTLTSMEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLGPG  +TEP  HKLPYLQAVIKET+R RMA+PLLVPHMNL
Sbjct  321  ELVNHPEIQSKLRNEIDTVLGPGVHVTEPALHKLPYLQAVIKETIRRRMAVPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKL GYDIPAES+IL+NAWWLANNP +W +PEEFRPERF EEE HVEANGNDFR++PF
Sbjct  381  KDAKLAGYDIPAESRILINAWWLANNPDSWNSPEEFRPERFLEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EK GQFSL IL  STIVM
Sbjct  441  GVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKSGQFSLQILNQSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>ref|XP_009354901.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Pyrus x bretschneideri]
Length=504

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKLSST    N   KCAIDHI +AQQKGEINE N+ ++V+NIN AAIE+TL SIEWGIA
Sbjct  261  RKKLSSTHATTNEGLKCAIDHILKAQQKGEINETNIYHVVDNINAAAIESTLLSIEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P  QKKLR+E+D VLG G Q+TEPD  KLPYLQAVIKETLRLRM IPLL+PHMNL
Sbjct  321  ELVNHPDSQKKLREELDTVLGRGVQITEPDIQKLPYLQAVIKETLRLRMTIPLLLPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKL G+DIPA SKILVNAWWLANNP+ WK PEEFRPERF EEE  VEANGNDFR+LPF
Sbjct  381  KDAKLSGFDIPAGSKILVNAWWLANNPAMWKKPEEFRPERFLEEESKVEANGNDFRYLPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPIL I +GRLVQNFELLPPPG SK+DT EK GQFSLHILKHSTIVM
Sbjct  441  GVGRRSCPGIILALPILCITIGRLVQNFELLPPPGQSKLDTLEKCGQFSLHILKHSTIVM  500

Query  279  KP  274
            KP
Sbjct  501  KP  502



>gb|ABR18390.1| unknown [Picea sitchensis]
Length=228

 Score =   335 bits (858),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 185/224 (83%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = -2

Query  945  IDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDEIDA  766
            +DHI +AQ KGEINEDNVLYIVENINVAAIETTLWS+EW IAELVN+  +Q K+R E++A
Sbjct  1    MDHILDAQSKGEINEDNVLYIVENINVAAIETTLWSMEWAIAELVNHQDIQNKVRAELEA  60

Query  765  VLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILV  586
            VLG G Q+TEPDT +LPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILV
Sbjct  61   VLGHGVQITEPDTTRLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILV  120

Query  585  NAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalpilg  406
            NAWWLANNP  WKNP+EFRPERFFEEEK+ EANGNDF+FLPFGVGRRSCPGIILALP+L 
Sbjct  121  NAWWLANNPENWKNPQEFRPERFFEEEKNTEANGNDFKFLPFGVGRRSCPGIILALPLLA  180

Query  405  ivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKP  274
            + +GRLVQNF LLPPPG SKVD TEKGGQFSLHI+ HS IV KP
Sbjct  181  LSIGRLVQNFHLLPPPGQSKVDVTEKGGQFSLHIVNHSLIVAKP  224



>gb|AFX98061.1| cinnamate 4-hydroxylase [Cunninghamia lanceolata]
Length=508

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 214/244 (88%), Gaps = 3/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+S K ++    KC +D+I +AQ KGEI+EDNVLYIVENIN AAIETTLWSIEWGIA
Sbjct  267  RKKLASVKTVE---LKCGMDYILDAQIKGEISEDNVLYIVENINAAAIETTLWSIEWGIA  323

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D VLG G Q+TEPD  +LPYLQAV+KETLRLRMA PLLVPHMNL
Sbjct  324  ELVNHPHIQNKLREELDIVLGRGVQITEPDIIRLPYLQAVVKETLRLRMATPLLVPHMNL  383

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +DAKLGGYDIPAESKILVN+W+LANNP+ W NP++FRPERF EEEK  EANGNDFR+LPF
Sbjct  384  YDAKLGGYDIPAESKILVNSWYLANNPAEWDNPQQFRPERFLEEEKKTEANGNDFRYLPF  443

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPG+ILALPILG+ LGRLVQNFELLPPPGH+++DTTEK GQFSL IL HS IV 
Sbjct  444  GVGRRSCPGVILALPILGLSLGRLVQNFELLPPPGHTRLDTTEKAGQFSLKILNHSLIVA  503

Query  279  KPRC  268
            KPR 
Sbjct  504  KPRV  507



>emb|CDX97827.1| BnaC04g41120D [Brassica napus]
Length=505

 Score =   341 bits (875),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 189/244 (77%), Positives = 211/244 (86%), Gaps = 0/244 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RK++++ K       KCAIDHI EAQ KGEINEDNVLYIVENINVAAIETTL S+EWGIA
Sbjct  261  RKQVATPKPTGVGGLKCAIDHILEAQNKGEINEDNVLYIVENINVAAIETTLTSMEWGIA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+EID VLG G Q+TEP+ H+LPYLQAVIKET+R RMA+PLLVPHMNL
Sbjct  321  ELVNHPDIQSKLRNEIDTVLGLGVQVTEPELHRLPYLQAVIKETIRRRMAVPLLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DAKL GYDIP ES+IL+NAWWLANNP +W +PEEFRPERF EEE HVEANGNDFR++PF
Sbjct  381  KDAKLAGYDIPEESRILINAWWLANNPDSWNSPEEFRPERFLEEEAHVEANGNDFRYVPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGIILALPILGI +GRLVQNFELLPPPG SK+DT+EK GQFSL IL  STIVM
Sbjct  441  GAGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKRGQFSLQILNQSTIVM  500

Query  279  KPRC  268
            KPR 
Sbjct  501  KPRA  504



>ref|XP_004151467.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis sativus]
Length=507

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 210/248 (85%), Gaps = 6/248 (2%)
 Frame = -2

Query  999  RKKLSSTKGMDNNS----XKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIE  832
            R++L+ST  M NN      KCAIDHI EAQ+ GEI E+NVL+IVENINVAAIETTLWS+E
Sbjct  261  RRRLTST--MSNNELVGGVKCAIDHIVEAQENGEITEENVLFIVENINVAAIETTLWSME  318

Query  831  WGIAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVP  652
            W IAELVN+P +Q K+RDE+D+VL  G Q+TEPD  KLPYLQAVIKETLRLRMAIPLLVP
Sbjct  319  WAIAELVNHPNIQSKVRDELDSVLKDGVQITEPDIRKLPYLQAVIKETLRLRMAIPLLVP  378

Query  651  HMNLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFR  472
            HMNL DAKLGGYDIPAESKILVNAWWLANNP  W  P+EFRPERF EEE +VE +GNDFR
Sbjct  379  HMNLQDAKLGGYDIPAESKILVNAWWLANNPDHWNKPQEFRPERFLEEEGNVEPSGNDFR  438

Query  471  FLPFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHS  292
            +LPFG GRRSCPGIILALPIL I LGRL+QNFEL+PPPG SK+DTTEK GQFSL I  HS
Sbjct  439  YLPFGAGRRSCPGIILALPILAITLGRLLQNFELMPPPGQSKIDTTEKPGQFSLQIFNHS  498

Query  291  TIVMKPRC  268
            TIV KPR 
Sbjct  499  TIVAKPRS  506



>ref|XP_008457287.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Cucumis melo]
Length=507

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 186/246 (76%), Positives = 206/246 (84%), Gaps = 2/246 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDN--NSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWG  826
            R++L+ T          KCAIDHI EAQ+ GEI EDNVL+IVENINVAAIETTLWS+EW 
Sbjct  261  RRRLTGTMSKKKLVGGVKCAIDHIVEAQENGEITEDNVLFIVENINVAAIETTLWSMEWA  320

Query  825  IAELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHM  646
            IAELVN+P +Q K+RDE+D+VL  G Q+TEPD   LPYLQAVIKETLRLRMAIPLLVPHM
Sbjct  321  IAELVNHPNIQSKVRDELDSVLKDGVQITEPDIRNLPYLQAVIKETLRLRMAIPLLVPHM  380

Query  645  NLHDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFL  466
            NL DAKLGGYDIPAESKILVNAWWLANNP  W  P+EFRPERF EEE++VE +GNDFR+L
Sbjct  381  NLQDAKLGGYDIPAESKILVNAWWLANNPDHWNKPQEFRPERFLEEEENVEPSGNDFRYL  440

Query  465  PFGVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTI  286
            PFG GRRSCPGIILALPIL I LGRL+QNFEL+PPPG SK+DTTEK GQFSL I  HSTI
Sbjct  441  PFGAGRRSCPGIILALPILAITLGRLLQNFELMPPPGQSKIDTTEKPGQFSLQIFNHSTI  500

Query  285  VMKPRC  268
            V KPR 
Sbjct  501  VAKPRS  506



>gb|AHF20175.1| cinnamate 4-hydroxylase, partial [Musa acuminata AAA Group]
Length=393

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 209/244 (86%), Gaps = 2/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK+   KG      +CAIDHI +A++KGEIN DNVLYIVENINVAA+ETTLWSIEWGIA
Sbjct  151  RKKMMEEKG-SKMELECAIDHILDAERKGEINYDNVLYIVENINVAALETTLWSIEWGIA  209

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +Q+KL  E+D VLG   Q+TEPD  +LPYLQAV+KETLR RMAIPLLVPHMNL
Sbjct  210  ELVNNPEIQRKLGAELDVVLGRD-QITEPDLQRLPYLQAVVKETLRYRMAIPLLVPHMNL  268

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            + AKLGG+DIP ESKILVNAWWLANNP+ W+ PEEFRPERF EEE  VEA+GNDFR+LPF
Sbjct  269  NHAKLGGFDIPGESKILVNAWWLANNPAHWRKPEEFRPERFLEEEAKVEASGNDFRYLPF  328

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGIILALPI+GI LGRLVQNFELLPPPG +K+DTTEK GQFSL I+KHST+V 
Sbjct  329  GAGRRSCPGIILALPIIGITLGRLVQNFELLPPPGQAKIDTTEKAGQFSLQIMKHSTVVC  388

Query  279  KPRC  268
            KPR 
Sbjct  389  KPRV  392



>ref|XP_009416323.1| PREDICTED: trans-cinnamate 4-monooxygenase-like [Musa acuminata 
subsp. malaccensis]
Length=503

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 210/244 (86%), Gaps = 2/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK+   KG      +CAIDHI +A++KGEIN DNVLYIVENINVAA+ETTLWSIEWGIA
Sbjct  261  RKKMMEEKG-SKMELECAIDHILDAERKGEINYDNVLYIVENINVAALETTLWSIEWGIA  319

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVNNP +Q+KL  E+DAVLG   Q+TEPD  +LPYLQAV+KETLR RMAIPLLVPHMNL
Sbjct  320  ELVNNPEIQRKLGAELDAVLGRD-QITEPDLQRLPYLQAVVKETLRYRMAIPLLVPHMNL  378

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            + AKLGGYDIP ESKILVNAWWLANNP+ W+ PEEFRPERF EEE  VEA+GNDFR+LPF
Sbjct  379  NHAKLGGYDIPGESKILVNAWWLANNPAHWRKPEEFRPERFLEEEAKVEASGNDFRYLPF  438

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGIILALPI+GI LGRLVQNFELLPPPG +K+DTTEK GQFSL I+KHST+V 
Sbjct  439  GAGRRSCPGIILALPIIGITLGRLVQNFELLPPPGQAKIDTTEKAGQFSLQIMKHSTVVC  498

Query  279  KPRC  268
            KPR 
Sbjct  499  KPRV  502



>gb|EAY76296.1| hypothetical protein OsI_04230 [Oryza sativa Indica Group]
Length=481

 Score =   330 bits (846),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 207/244 (85%), Gaps = 2/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EAQQKGEINEDNVLYIVENINVA         + G  
Sbjct  239  RKKLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVADDAVVDGVGDRGAR  298

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
              VN+  +Q+KLR E+D VLGPG Q+TEPDTH+LPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  299  --VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLRMAIPLLVPHMNL  356

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DA+L GY IPAESK+LVNAW+LAN+P  W+ PEEFRPERF EEE+HVEANGNDFR+LP 
Sbjct  357  RDAELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERHVEANGNDFRYLPS  416

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGI+LALPILG+ +GRLVQNFELLPPPG  +VDTTEKGGQFSLHILKHSTIV 
Sbjct  417  GAGRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQFSLHILKHSTIVA  476

Query  279  KPRC  268
            KPR 
Sbjct  477  KPRA  480



>dbj|BAJ96982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            KCA+DHI EA++KGEIN DNVLYIVENINVAAIETTLWSIEWG+AELVN+P +Q+KLR+E
Sbjct  272  KCAMDHILEAERKGEINHDNVLYIVENINVAAIETTLWSIEWGLAELVNHPEIQQKLREE  331

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            I AVLGPG  +TEPD  +LPYLQ+V+KETLRLRMAIPLLVPHMNL DAKL GYDIPAESK
Sbjct  332  IVAVLGPGTPVTEPDLERLPYLQSVVKETLRLRMAIPLLVPHMNLSDAKLAGYDIPAESK  391

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAW+LAN+P  W   +EFRPERF EEEK VEA+GNDFRF+PFGVGRRSCPGIILALP
Sbjct  392  ILVNAWFLANDPKRWVRADEFRPERFLEEEKSVEAHGNDFRFVPFGVGRRSCPGIILALP  451

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKP  274
            I+GI LGRLVQNFELLPPPG  K+DTTEK GQFS  ILKH+TIV KP
Sbjct  452  IIGITLGRLVQNFELLPPPGQDKIDTTEKPGQFSNQILKHATIVCKP  498



>gb|EMT32263.1| Trans-cinnamate 4-monooxygenase [Aegilops tauschii]
Length=502

 Score =   328 bits (841),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            +CA+DHI EA++KGEIN DNVLYIVENINVAAIETTLWSIEWGIAELVN+P +Q+KLR+E
Sbjct  273  RCAMDHILEAERKGEINHDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKLREE  332

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            I AVLG GA +TEPD  +LPYLQ+V+KETLRLRMAIPLLVPHMNL DAKL GYDIPAESK
Sbjct  333  IVAVLGAGAAVTEPDLERLPYLQSVVKETLRLRMAIPLLVPHMNLSDAKLAGYDIPAESK  392

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAW+LAN+P  W   +EFRPERF EEEK VEA+GNDFRF+PFGVGRRSCPGIILALP
Sbjct  393  ILVNAWFLANDPKRWVRADEFRPERFLEEEKAVEAHGNDFRFVPFGVGRRSCPGIILALP  452

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKP  274
            I+GI LGRLVQNF+LLPPPG  K+DTTEK GQFS  ILKH+TIV KP
Sbjct  453  IIGITLGRLVQNFQLLPPPGQDKIDTTEKPGQFSNQILKHATIVCKP  499



>gb|EAZ35606.1| hypothetical protein OsJ_19896 [Oryza sativa Japonica Group]
Length=481

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 207/244 (85%), Gaps = 2/244 (1%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKKL+STK MDNN  KCAIDHI EAQQKGEINEDNVLYIVENINVA         + G  
Sbjct  239  RKKLASTKAMDNNGLKCAIDHILEAQQKGEINEDNVLYIVENINVADDAVVDGVGDRGAR  298

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
              VN+  +Q+KLR E+D VLGPG Q+TEPDTH+LPYLQAV+KETLRLRMAIPLLVPHMNL
Sbjct  299  --VNHGEIQEKLRRELDTVLGPGRQITEPDTHRLPYLQAVVKETLRLRMAIPLLVPHMNL  356

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
             DA+L GY IPAESK+LVNAW+LAN+P  W+ PEEFRPERF EEE++VEANGNDFR+LP 
Sbjct  357  RDAELAGYGIPAESKVLVNAWYLANDPGRWRRPEEFRPERFLEEERNVEANGNDFRYLPS  416

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            G GRRSCPGI+LALPILG+ +GRLVQNFELLPPPG  +VDTTEKGGQFSLHILKHSTIV 
Sbjct  417  GAGRRSCPGIVLALPILGVTIGRLVQNFELLPPPGKDRVDTTEKGGQFSLHILKHSTIVA  476

Query  279  KPRC  268
            KPR 
Sbjct  477  KPRA  480



>gb|EYU36905.1| hypothetical protein MIMGU_mgv1a004883mg [Erythranthe guttata]
Length=506

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 202/243 (83%), Gaps = 0/243 (0%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK++ST+  D N  KC IDH  E Q  GEINEDNVLYIVEN+NVAAIET +W++EW +A
Sbjct  261  RKKIASTEAFDKNRLKCGIDHFLECQANGEINEDNVLYIVENMNVAAIETVIWTLEWAVA  320

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            EL+NNP +Q KLR E+DAVLGP  Q+TEPDTHKLPYLQAVIKETLRLRM +P LVPHMNL
Sbjct  321  ELINNPEIQNKLRAELDAVLGPNKQVTEPDTHKLPYLQAVIKETLRLRMVVPCLVPHMNL  380

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
              A LGGY+IPAES+I VNAWWLAN+P+ WK PEEFRPERF EEE  VE NGND +++PF
Sbjct  381  DKANLGGYEIPAESRIFVNAWWLANDPALWKKPEEFRPERFLEEESSVEVNGNDIKYIPF  440

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGI++A+P+LGI LGRLVQNFEL PP G SK+DT E  GQF+  + KHSTIV+
Sbjct  441  GVGRRSCPGIMMAMPVLGITLGRLVQNFELFPPLGQSKIDTAENNGQFATRMSKHSTIVL  500

Query  279  KPR  271
            KPR
Sbjct  501  KPR  503



>ref|XP_002461939.1| hypothetical protein SORBIDRAFT_02g010910 [Sorghum bicolor]
 gb|AAK54447.1| cinnamic acid 4-hydroxylase [Sorghum bicolor]
 gb|EER98460.1| hypothetical protein SORBIDRAFT_02g010910 [Sorghum bicolor]
Length=501

 Score =   326 bits (835),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 208/242 (86%), Gaps = 4/242 (2%)
 Frame = -2

Query  999  RKKLSSTKGMDNNSXKCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIA  820
            RKK+ +  G      +CA+DHI EA++KGEIN DNVLYIVENINVAAIETTLWSIEWGIA
Sbjct  261  RKKVMAQTG----EIRCAMDHILEAERKGEINHDNVLYIVENINVAAIETTLWSIEWGIA  316

Query  819  ELVNNPGVQKKLRDEIDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNL  640
            ELVN+P +Q KLR+E+D+VLG G  +TEPD  +LPYLQA++KETLRLRMAIPLLVPHMNL
Sbjct  317  ELVNHPAIQSKLREEMDSVLGAGVPVTEPDLERLPYLQAIVKETLRLRMAIPLLVPHMNL  376

Query  639  HDAKLGGYDIPAESKILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPF  460
            +D KL GYDIPAESKILVNAW+LAN+P  W  P+EFRPERF EEEK VEA+GNDFRF+PF
Sbjct  377  NDGKLAGYDIPAESKILVNAWFLANDPKRWVRPDEFRPERFLEEEKTVEAHGNDFRFVPF  436

Query  459  GVGRRSCPgiilalpilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVM  280
            GVGRRSCPGIILALPI+GI LGRLVQNF+LLPPPG  K+DTTEK GQFS  I KH+TIV 
Sbjct  437  GVGRRSCPGIILALPIIGITLGRLVQNFQLLPPPGQDKIDTTEKPGQFSNQIAKHATIVC  496

Query  279  KP  274
            KP
Sbjct  497  KP  498



>emb|CDM82046.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   325 bits (834),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  954  KCAIDHIFEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPGVQKKLRDE  775
            +CA+DHI EA++KGEIN DNVLYIVENINVAAIETTLWSIEWG+AELVN+P +Q+KLR+E
Sbjct  272  RCAMDHILEAERKGEINHDNVLYIVENINVAAIETTLWSIEWGLAELVNHPEIQQKLREE  331

Query  774  IDAVLGPGAQLTEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESK  595
            I AVLG G  +TEPD  +LPYLQ+V+KETLRLRMAIPLLVPHMNL DAKL GYDIPAESK
Sbjct  332  IVAVLGAGVAVTEPDLERLPYLQSVVKETLRLRMAIPLLVPHMNLSDAKLAGYDIPAESK  391

Query  594  ILVNAWWLANNPSTWKNpeefrperffeeEKHVEANGNDFRFLPFGVGRRSCPgiilalp  415
            ILVNAW+LAN+P  W   +EFRPERF EEEK VEA+GNDFRF+PFGVGRRSCPGIILALP
Sbjct  392  ILVNAWFLANDPKRWVRADEFRPERFLEEEKAVEAHGNDFRFVPFGVGRRSCPGIILALP  451

Query  414  ilgivlGRLVQNFELLPPPGHSKVDTTEKGGQFSLHILKHSTIVMKP  274
            I+GI LGRLVQNF+LLPPPG  K+DTTEK GQFS  ILKH+TIV KP
Sbjct  452  IIGITLGRLVQNFQLLPPPGQDKIDTTEKPGQFSNQILKHATIVCKP  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2488971634053