BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8342

Length=1003
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796936.1|  PREDICTED: eukaryotic translation initiation...    256   2e-74   Nicotiana sylvestris
ref|XP_009796935.1|  PREDICTED: eukaryotic translation initiation...    256   2e-74   Nicotiana sylvestris
ref|XP_009597543.1|  PREDICTED: eukaryotic translation initiation...    251   1e-72   Nicotiana tomentosiformis
ref|XP_009614239.1|  PREDICTED: eukaryotic translation initiation...    248   1e-71   Nicotiana tomentosiformis
ref|XP_009614240.1|  PREDICTED: eukaryotic translation initiation...    248   1e-71   Nicotiana tomentosiformis
ref|XP_006350109.1|  PREDICTED: eukaryotic translation initiation...    248   2e-71   Solanum tuberosum [potatoes]
ref|XP_006350110.1|  PREDICTED: eukaryotic translation initiation...    247   2e-71   Solanum tuberosum [potatoes]
ref|XP_009798535.1|  PREDICTED: eukaryotic translation initiation...    244   2e-70   Nicotiana sylvestris
ref|XP_009798534.1|  PREDICTED: eukaryotic translation initiation...    244   2e-70   Nicotiana sylvestris
ref|XP_006343626.1|  PREDICTED: eukaryotic translation initiation...    244   4e-70   Solanum tuberosum [potatoes]
ref|XP_006343625.1|  PREDICTED: eukaryotic translation initiation...    244   4e-70   Solanum tuberosum [potatoes]
ref|XP_004251742.1|  PREDICTED: eukaryotic translation initiation...    243   1e-69   Solanum lycopersicum
ref|XP_010313817.1|  PREDICTED: eukaryotic translation initiation...    242   1e-69   Solanum lycopersicum
ref|NP_001265910.1|  eukaryotic translation initiation factor iso...    241   3e-69   Solanum lycopersicum
ref|XP_010323154.1|  PREDICTED: eukaryotic translation initiation...    241   3e-69   Solanum lycopersicum
ref|XP_011083941.1|  PREDICTED: eukaryotic translation initiation...    238   5e-68   Sesamum indicum [beniseed]
ref|XP_011079385.1|  PREDICTED: eukaryotic translation initiation...    238   6e-68   Sesamum indicum [beniseed]
gb|KJB53886.1|  hypothetical protein B456_009G009800                    233   3e-66   Gossypium raimondii
gb|KJB53885.1|  hypothetical protein B456_009G009800                    234   3e-66   Gossypium raimondii
emb|CAN70546.1|  hypothetical protein VITISV_013807                     232   8e-66   Vitis vinifera
ref|XP_002277218.2|  PREDICTED: eukaryotic translation initiation...    232   1e-65   Vitis vinifera
ref|XP_012071533.1|  PREDICTED: eukaryotic translation initiation...    232   1e-65   Jatropha curcas
ref|XP_012071534.1|  PREDICTED: eukaryotic translation initiation...    232   2e-65   Jatropha curcas
gb|KJB80592.1|  hypothetical protein B456_013G105700                    230   4e-65   Gossypium raimondii
gb|KJB80591.1|  hypothetical protein B456_013G105700                    230   5e-65   Gossypium raimondii
gb|KJB83330.1|  hypothetical protein B456_013G241300                    229   2e-64   Gossypium raimondii
ref|XP_004507752.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    228   2e-64   Cicer arietinum [garbanzo]
ref|XP_003549535.1|  PREDICTED: eukaryotic translation initiation...    228   3e-64   Glycine max [soybeans]
gb|KHN17504.1|  Eukaryotic initiation factor iso-4F subunit p82-34      228   3e-64   Glycine soja [wild soybean]
ref|XP_002534061.1|  Eukaryotic initiation factor iso-4F subunit ...    224   5e-64   
ref|XP_006575314.1|  PREDICTED: eukaryotic translation initiation...    228   5e-64   Glycine max [soybeans]
gb|KHN14133.1|  Eukaryotic initiation factor iso-4F subunit p82-34      227   5e-64   Glycine soja [wild soybean]
ref|XP_003610290.1|  Eukaryotic initiation factor iso-4F subunit ...    227   7e-64   Medicago truncatula
gb|KHG16321.1|  Eukaryotic initiation factor iso-4F subunit p82-34      226   1e-63   Gossypium arboreum [tree cotton]
gb|KHG01242.1|  Eukaryotic initiation factor iso-4F subunit p82-34      226   1e-63   Gossypium arboreum [tree cotton]
gb|KHG05617.1|  Eukaryotic initiation factor iso-4F subunit p82-34      224   5e-63   Gossypium arboreum [tree cotton]
gb|KJB27041.1|  hypothetical protein B456_004G273900                    224   5e-63   Gossypium raimondii
gb|KDO62267.1|  hypothetical protein CISIN_1g0453992mg                  219   3e-62   Citrus sinensis [apfelsine]
ref|XP_007154871.1|  hypothetical protein PHAVU_003G154900g             222   4e-62   Phaseolus vulgaris [French bean]
ref|XP_007013853.1|  MIF4G domain-containing protein / MA3 domain...    222   5e-62   
ref|XP_006474025.1|  PREDICTED: eukaryotic translation initiation...    221   6e-62   Citrus sinensis [apfelsine]
ref|XP_002324526.1|  MIF4G domain-containing family protein             221   7e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006474024.1|  PREDICTED: eukaryotic translation initiation...    221   1e-61   Citrus sinensis [apfelsine]
ref|XP_011018056.1|  PREDICTED: eukaryotic translation initiation...    220   2e-61   Populus euphratica
gb|KCW45237.1|  hypothetical protein EUGRSUZ_L01123                     213   6e-61   Eucalyptus grandis [rose gum]
ref|XP_010040415.1|  PREDICTED: eukaryotic translation initiation...    213   7e-61   
ref|XP_010525785.1|  PREDICTED: eukaryotic translation initiation...    218   8e-61   Tarenaya hassleriana [spider flower]
ref|XP_010525784.1|  PREDICTED: eukaryotic translation initiation...    218   9e-61   Tarenaya hassleriana [spider flower]
emb|CDP02830.1|  unnamed protein product                                217   3e-60   Coffea canephora [robusta coffee]
ref|XP_008384281.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    215   1e-59   
ref|XP_002309358.1|  MIF4G domain-containing family protein             215   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009366204.1|  PREDICTED: eukaryotic translation initiation...    215   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_009366203.1|  PREDICTED: eukaryotic translation initiation...    215   2e-59   
ref|XP_010047063.1|  PREDICTED: eukaryotic translation initiation...    214   4e-59   Eucalyptus grandis [rose gum]
ref|XP_004287143.1|  PREDICTED: eukaryotic translation initiation...    213   5e-59   Fragaria vesca subsp. vesca
ref|XP_008220656.1|  PREDICTED: eukaryotic translation initiation...    213   6e-59   Prunus mume [ume]
ref|XP_007138423.1|  hypothetical protein PHAVU_009G207600g             212   2e-58   Phaseolus vulgaris [French bean]
ref|XP_007204278.1|  hypothetical protein PRUPE_ppa001554mg             212   2e-58   Prunus persica
ref|XP_006453585.1|  hypothetical protein CICLE_v10007494mg             209   2e-58   
ref|XP_002285559.2|  PREDICTED: eukaryotic translation initiation...    211   4e-58   Vitis vinifera
ref|XP_010047062.1|  PREDICTED: eukaryotic translation initiation...    211   4e-58   Eucalyptus grandis [rose gum]
emb|CBI21151.3|  unnamed protein product                                211   6e-58   Vitis vinifera
ref|XP_008243017.1|  PREDICTED: eukaryotic translation initiation...    210   7e-58   Prunus mume [ume]
ref|XP_008384241.1|  PREDICTED: eukaryotic translation initiation...    210   1e-57   
ref|XP_004976117.1|  PREDICTED: eukaryotic translation initiation...    209   2e-57   Setaria italica
gb|KFK41363.1|  hypothetical protein AALP_AA2G120200                    208   2e-57   Arabis alpina [alpine rockcress]
ref|XP_011033390.1|  PREDICTED: eukaryotic translation initiation...    209   2e-57   Populus euphratica
ref|XP_002309681.1|  hypothetical protein POPTR_0006s28110g             208   3e-57   Populus trichocarpa [western balsam poplar]
gb|KDO67424.1|  hypothetical protein CISIN_1g003543mg                   205   3e-57   Citrus sinensis [apfelsine]
ref|XP_006453584.1|  hypothetical protein CICLE_v10007494mg             208   3e-57   Citrus clementina [clementine]
ref|XP_004513079.1|  PREDICTED: eukaryotic translation initiation...    194   6e-57   Cicer arietinum [garbanzo]
ref|XP_010929170.1|  PREDICTED: eukaryotic translation initiation...    207   7e-57   Elaeis guineensis
ref|XP_010905020.1|  PREDICTED: eukaryotic translation initiation...    207   8e-57   Elaeis guineensis
ref|XP_002448124.1|  hypothetical protein SORBIDRAFT_06g021600          207   8e-57   Sorghum bicolor [broomcorn]
ref|XP_003522928.1|  PREDICTED: eukaryotic translation initiation...    207   1e-56   Glycine max [soybeans]
ref|XP_009396249.1|  PREDICTED: eukaryotic translation initiation...    207   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011031436.1|  PREDICTED: eukaryotic translation initiation...    206   1e-56   Populus euphratica
gb|KDO67422.1|  hypothetical protein CISIN_1g003543mg                   204   2e-56   Citrus sinensis [apfelsine]
ref|XP_006404902.1|  hypothetical protein EUTSA_v10000058mg             206   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010927940.1|  PREDICTED: eukaryotic translation initiation...    206   2e-56   
ref|XP_008443845.1|  PREDICTED: eukaryotic translation initiation...    206   2e-56   Cucumis melo [Oriental melon]
ref|XP_010687620.1|  PREDICTED: eukaryotic translation initiation...    206   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004146671.1|  PREDICTED: eukaryotic translation initiation...    205   5e-56   Cucumis sativus [cucumbers]
gb|KDO67421.1|  hypothetical protein CISIN_1g003543mg                   205   5e-56   Citrus sinensis [apfelsine]
gb|KDO67419.1|  hypothetical protein CISIN_1g003543mg                   205   5e-56   Citrus sinensis [apfelsine]
ref|XP_006483537.1|  PREDICTED: eukaryotic translation initiation...    205   5e-56   Citrus sinensis [apfelsine]
ref|XP_010904622.1|  PREDICTED: eukaryotic translation initiation...    205   5e-56   Elaeis guineensis
ref|XP_010927939.1|  PREDICTED: eukaryotic translation initiation...    205   5e-56   Elaeis guineensis
ref|XP_002324920.2|  hypothetical protein POPTR_0018s02700g             204   7e-56   
gb|EYU35354.1|  hypothetical protein MIMGU_mgv1a001641mg                204   9e-56   Erythranthe guttata [common monkey flower]
ref|XP_008790156.1|  PREDICTED: eukaryotic translation initiation...    204   1e-55   
ref|XP_004145494.1|  PREDICTED: eukaryotic translation initiation...    203   2e-55   Cucumis sativus [cucumbers]
ref|XP_003527199.1|  PREDICTED: eukaryotic translation initiation...    203   2e-55   Glycine max [soybeans]
ref|XP_010545451.1|  PREDICTED: eukaryotic translation initiation...    203   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_008810701.1|  PREDICTED: eukaryotic translation initiation...    203   3e-55   Phoenix dactylifera
ref|NP_194797.1|  Initiation factor eIF-4 gamma, MA3                    192   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011459622.1|  PREDICTED: eukaryotic translation initiation...    202   3e-55   Fragaria vesca subsp. vesca
ref|XP_008379294.1|  PREDICTED: eukaryotic translation initiation...    202   4e-55   Malus domestica [apple tree]
ref|XP_008379300.1|  PREDICTED: eukaryotic translation initiation...    202   4e-55   Malus domestica [apple tree]
ref|XP_009386818.1|  PREDICTED: eukaryotic translation initiation...    202   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386817.1|  PREDICTED: eukaryotic translation initiation...    202   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008452837.1|  PREDICTED: eukaryotic translation initiation...    202   6e-55   Cucumis melo [Oriental melon]
ref|XP_009363516.1|  PREDICTED: eukaryotic translation initiation...    202   6e-55   Pyrus x bretschneideri [bai li]
gb|KCW78816.1|  hypothetical protein EUGRSUZ_C00247                     202   1e-54   Eucalyptus grandis [rose gum]
ref|XP_011036701.1|  PREDICTED: eukaryotic translation initiation...    201   2e-54   Populus euphratica
gb|AAL32572.1|  putative eukaryotic initiation factor 4, eIF4           200   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AFW58747.1|  hypothetical protein ZEAMMB73_485485                    197   2e-54   
ref|NP_179983.1|  eukaryotic translation initiation factor isofor...    200   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011701.1|  MIF4G domain-containing protein / MA3 domain...    200   3e-54   
gb|EYU34333.1|  hypothetical protein MIMGU_mgv1a0025261mg               194   3e-54   Erythranthe guttata [common monkey flower]
ref|NP_001168275.1|  uncharacterized protein LOC100382039               197   3e-54   
ref|XP_007011702.1|  MIF4G domain-containing protein / MA3 domain...    200   3e-54   
gb|ERM94906.1|  hypothetical protein AMTR_s00009p00164690               198   5e-54   Amborella trichopoda
gb|ADO64264.1|  eukaryotic initiation factor iso4G                      199   8e-54   Carica papaya [mamon]
ref|XP_009137959.1|  PREDICTED: eukaryotic translation initiation...    198   1e-53   Brassica rapa
ref|XP_008662121.1|  PREDICTED: uncharacterized protein LOC100382...    198   1e-53   
ref|XP_011624611.1|  PREDICTED: eukaryotic translation initiation...    198   1e-53   Amborella trichopoda
ref|XP_010438142.1|  PREDICTED: eukaryotic translation initiation...    198   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010240075.1|  PREDICTED: eukaryotic translation initiation...    197   2e-53   Brachypodium distachyon [annual false brome]
ref|XP_010483339.1|  PREDICTED: eukaryotic translation initiation...    188   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_002880542.1|  MIF4G domain-containing protein                    197   3e-53   
ref|XP_009358420.1|  PREDICTED: eukaryotic translation initiation...    197   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_009400372.1|  PREDICTED: eukaryotic translation initiation...    197   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY39236.1|  BnaA03g50480D                                          196   5e-53   Brassica napus [oilseed rape]
gb|AHA84160.1|  eukaryotic initiation factor iso-4F subunit p82-3...    195   2e-52   Phaseolus vulgaris [French bean]
ref|XP_010447683.1|  PREDICTED: eukaryotic translation initiation...    194   2e-52   Camelina sativa [gold-of-pleasure]
emb|CDX72262.1|  BnaC07g42840D                                          194   3e-52   
ref|XP_009359130.1|  PREDICTED: eukaryotic translation initiation...    194   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_010265526.1|  PREDICTED: eukaryotic translation initiation...    194   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008377631.1|  PREDICTED: eukaryotic translation initiation...    193   9e-52   
ref|XP_009359111.1|  PREDICTED: eukaryotic translation initiation...    193   9e-52   Pyrus x bretschneideri [bai li]
ref|XP_008377630.1|  PREDICTED: eukaryotic translation initiation...    193   1e-51   
ref|XP_010091165.1|  Eukaryotic initiation factor iso-4F subunit ...    192   2e-51   Morus notabilis
gb|AIZ68195.1|  eukaryotic translation initiation factor isoform ...    191   4e-51   Ornithogalum longebracteatum [sea-onion]
gb|KFK27326.1|  hypothetical protein AALP_AA8G368600                    190   7e-51   Arabis alpina [alpine rockcress]
ref|XP_002867334.1|  hypothetical protein ARALYDRAFT_353746             190   1e-50   Arabidopsis lyrata subsp. lyrata
gb|EAY86656.1|  hypothetical protein OsI_08037                          190   1e-50   Oryza sativa Indica Group [Indian rice]
emb|CDY28203.1|  BnaA01g06460D                                          186   1e-50   Brassica napus [oilseed rape]
ref|XP_010432953.1|  PREDICTED: eukaryotic translation initiation...    189   2e-50   Camelina sativa [gold-of-pleasure]
emb|CDX68687.1|  BnaC01g07660D                                          188   3e-50   
gb|EPS69198.1|  hypothetical protein M569_05568                         188   3e-50   Genlisea aurea
ref|XP_009127643.1|  PREDICTED: eukaryotic translation initiation...    188   4e-50   Brassica rapa
dbj|BAB08857.1|  eukaryotic initiation factor 4, eIF4-like protein      188   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283106.1|  hypothetical protein CARUB_v10004122mg             189   4e-50   
gb|AAN72067.1|  eukaryotic initiation factor 4, eIF4-like protein       188   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200595.2|  putative translation initiation factor                188   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452883.1|  PREDICTED: eukaryotic translation initiation...    188   5e-50   Camelina sativa [gold-of-pleasure]
ref|NP_851207.1|  putative translation initiation factor                188   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130188.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    187   6e-50   
sp|Q41583.1|IF4G2_WHEAT  RecName: Full=Eukaryotic translation ini...    187   7e-50   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001047407.1|  Os02g0611500                                       187   7e-50   
gb|EMS68053.1|  Eukaryotic initiation factor iso-4F subunit p82-34      187   9e-50   Triticum urartu
gb|AAN17444.1|  eukaryotic initiation factor 4, eIF4-like protein       187   9e-50   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK00069.1|  predicted protein                                      187   1e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001053219.2|  Os04g0499300                                       183   2e-49   
ref|XP_006648829.1|  PREDICTED: eukaryotic translation initiation...    186   2e-49   
ref|XP_007226996.1|  hypothetical protein PRUPE_ppa001769mg             186   2e-49   
ref|XP_010443497.1|  PREDICTED: eukaryotic translation initiation...    186   2e-49   Camelina sativa [gold-of-pleasure]
sp|Q03387.2|IF4G1_WHEAT  RecName: Full=Eukaryotic translation ini...    186   2e-49   Triticum aestivum [Canadian hard winter wheat]
gb|EMT29623.1|  Eukaryotic initiation factor iso-4F subunit p82-34      186   3e-49   
ref|XP_010273660.1|  PREDICTED: eukaryotic translation initiation...    186   3e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006401158.1|  hypothetical protein EUTSA_v10012738mg             186   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006280039.1|  hypothetical protein CARUB_v10025916mg             185   4e-49   Capsella rubella
emb|CAN70487.1|  hypothetical protein VITISV_008663                     187   7e-49   Vitis vinifera
ref|XP_008794367.1|  PREDICTED: eukaryotic translation initiation...    184   1e-48   
ref|XP_006293720.1|  hypothetical protein CARUB_v10022680mg             184   1e-48   
ref|XP_010539464.1|  PREDICTED: eukaryotic translation initiation...    184   1e-48   Tarenaya hassleriana [spider flower]
emb|CAJ42901.1|  putative eukaryotic translation initiation facto...    183   2e-48   Oryza glaberrima
emb|CAJ42900.1|  putative eukaryotic translation initiation facto...    183   2e-48   Oryza glaberrima
emb|CAJ42899.1|  putative eukaryotic translation initiation facto...    183   2e-48   Oryza glaberrima
emb|CBA10132.1|  putative eukaryotic translation initiation facto...    183   2e-48   Oryza glaberrima
sp|Q84PB3.2|IF4G1_ORYSJ  RecName: Full=Eukaryotic translation ini...    183   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669212.1|  PREDICTED: eukaryotic translation initiation...    182   5e-48   Zea mays [maize]
ref|XP_002864533.1|  hypothetical protein ARALYDRAFT_495887             181   8e-48   
ref|XP_009126808.1|  PREDICTED: eukaryotic translation initiation...    181   1e-47   Brassica rapa
emb|CDY32742.1|  BnaA02g08040D                                          181   1e-47   Brassica napus [oilseed rape]
gb|EEC77567.1|  hypothetical protein OsI_16505                          181   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_006653567.1|  PREDICTED: eukaryotic translation initiation...    181   1e-47   
emb|CAJ42898.1|  putative eukaryotic translation initiation facto...    181   2e-47   Oryza sativa Indica Group [Indian rice]
emb|CAC09503.2|  H0711G06.9                                             181   2e-47   Oryza sativa [red rice]
gb|AAO72569.1|  eukaryotic initiation factor-like protein               181   2e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ42897.1|  putative eukaryotic translation initiation facto...    181   2e-47   Oryza sativa Indica Group [Indian rice]
emb|CDY02774.1|  BnaC02g11150D                                          179   5e-47   
gb|AGQ04568.1|  rice yellow mottle virus 1-like protein                 167   5e-47   Oryza longistaminata [long-staminate rice]
gb|AGQ04573.1|  rice yellow mottle virus 1-like protein                 167   6e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953072.1|  PREDICTED: eukaryotic translation initiation...    178   1e-46   Setaria italica
gb|AGQ04570.1|  rice yellow mottle virus 1-like protein                 166   1e-46   Oryza meridionalis [Australian wild rice]
gb|AGQ04567.1|  rice yellow mottle virus 1-like protein                 165   4e-46   Oryza glumipatula
ref|XP_009418536.1|  PREDICTED: eukaryotic translation initiation...    176   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGQ04566.1|  rice yellow mottle virus 1-like protein                 163   2e-45   Oryza rufipogon [common wild rice]
gb|AGQ04572.1|  rice yellow mottle virus 1-like protein                 161   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_010417143.1|  PREDICTED: eukaryotic translation initiation...    169   2e-43   
ref|XP_010472401.1|  PREDICTED: eukaryotic translation initiation...    168   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010429358.1|  PREDICTED: eukaryotic translation initiation...    167   5e-43   Camelina sativa [gold-of-pleasure]
gb|EEE61263.1|  hypothetical protein OsJ_15338                          166   5e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01628.3|  OSJNBa0029H02.9                                        166   6e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CBI36548.3|  unnamed protein product                                128   3e-29   Vitis vinifera
gb|EYU25308.1|  hypothetical protein MIMGU_mgv1a018093mg                121   5e-29   Erythranthe guttata [common monkey flower]
gb|EYU25307.1|  hypothetical protein MIMGU_mgv11b020545mg               101   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_002967145.1|  hypothetical protein SELMODRAFT_30927              102   2e-20   
gb|AAK62591.1|  AT5g57870/MTI20_13                                    94.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002960868.1|  hypothetical protein SELMODRAFT_437322             101   4e-20   Selaginella moellendorffii
ref|XP_001764043.1|  predicted protein                                96.7    2e-18   
ref|XP_001764039.1|  predicted protein                                96.3    2e-18   
ref|XP_001763974.1|  predicted protein                                95.5    4e-18   
ref|XP_001758887.1|  predicted protein                                90.5    1e-16   
ref|XP_001758889.1|  predicted protein                                90.5    1e-16   
ref|XP_006450271.1|  hypothetical protein CICLE_v10009981mg           82.0    7e-16   
ref|XP_008648420.1|  PREDICTED: uncharacterized protein LOC100501384  76.6    6e-12   Zea mays [maize]
dbj|BAJ94459.1|  predicted protein                                    75.9    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573315.1|  PREDICTED: uncharacterized protein LOC100842871  75.9    1e-11   Brachypodium distachyon [annual false brome]
gb|EMS50754.1|  Programmed cell death protein 4                       75.5    1e-11   Triticum urartu
gb|EMT22556.1|  hypothetical protein F775_27355                       73.9    4e-11   
ref|XP_004972984.1|  PREDICTED: uncharacterized protein LOC101773560  70.5    7e-10   Setaria italica
ref|XP_011464198.1|  PREDICTED: programmed cell death protein 4       70.1    8e-10   Fragaria vesca subsp. vesca
ref|XP_002444968.1|  hypothetical protein SORBIDRAFT_07g002090        69.7    1e-09   Sorghum bicolor [broomcorn]
ref|XP_002295291.1|  hypothetical protein THAPSDRAFT_264946           68.6    2e-09   Thalassiosira pseudonana CCMP1335
ref|NP_001060879.1|  Os08g0120500                                     68.9    2e-09   
ref|XP_006659779.1|  PREDICTED: programmed cell death protein 4-like  68.9    2e-09   
gb|ABK23995.1|  unknown                                               67.8    3e-09   Picea sitchensis
ref|XP_002899252.1|  programmed cell death protein, putative          67.8    3e-09   Phytophthora infestans T30-4
ref|XP_002902694.1|  eukaryotic translation initiation factor 4 g...  68.6    4e-09   Phytophthora infestans T30-4
gb|ETO77485.1|  hypothetical protein, variant                         67.8    4e-09   Phytophthora parasitica P1976
gb|ETO77484.1|  hypothetical protein F444_07332                       67.4    4e-09   Phytophthora parasitica P1976
gb|ETM48417.1|  hypothetical protein L914_07044                       67.4    4e-09   Phytophthora parasitica
ref|XP_009524165.1|  hypothetical protein PHYSODRAFT_491686           68.2    5e-09   Phytophthora sojae
gb|EJK59532.1|  hypothetical protein THAOC_20224                      67.4    5e-09   Thalassiosira oceanica
ref|XP_010534749.1|  PREDICTED: programmed cell death protein 4-like  67.4    6e-09   Tarenaya hassleriana [spider flower]
ref|NP_567708.1|  MA3 domain-containing protein                       67.4    6e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95421.1|  hypothetical protein                                 67.4    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555527.1|  PREDICTED: programmed cell death protein 4       67.4    7e-09   Tarenaya hassleriana [spider flower]
ref|XP_011452508.1|  PREDICTED: eukaryotic translation initiation...  67.4    7e-09   Crassostrea gigas
emb|CDY34313.1|  BnaA01g14160D                                        65.1    8e-09   Brassica napus [oilseed rape]
ref|XP_011452512.1|  PREDICTED: eukaryotic translation initiation...  67.4    8e-09   Crassostrea gigas
emb|CAB41120.1|  putative protein                                     67.4    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011452510.1|  PREDICTED: eukaryotic translation initiation...  67.4    8e-09   
ref|XP_009537690.1|  hypothetical protein PHYSODRAFT_356091           66.6    8e-09   Phytophthora sojae
ref|XP_011032678.1|  PREDICTED: eukaryotic translation initiation...  67.4    8e-09   Populus euphratica
ref|XP_011452515.1|  PREDICTED: eukaryotic translation initiation...  67.4    8e-09   Crassostrea gigas
ref|XP_004236309.1|  PREDICTED: programmed cell death protein 4-like  67.0    8e-09   Solanum lycopersicum
gb|EKC31981.1|  Eukaryotic translation initiation factor 4 gamma 3    67.0    9e-09   Crassostrea gigas
gb|AEX12248.1|  hypothetical protein 0_7685_01                        63.2    1e-08   Pinus taeda
ref|XP_002302506.2|  hypothetical protein POPTR_0002s14110g           67.0    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006351448.1|  PREDICTED: uncharacterized protein LOC102604...  66.2    1e-08   Solanum tuberosum [potatoes]
ref|XP_006351449.1|  PREDICTED: uncharacterized protein LOC102604...  66.2    1e-08   Solanum tuberosum [potatoes]
ref|XP_006413383.1|  hypothetical protein EUTSA_v10024556mg           66.2    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008239378.1|  PREDICTED: programmed cell death protein 4-like  65.9    2e-08   Prunus mume [ume]
ref|XP_002964316.1|  hypothetical protein SELMODRAFT_80912            65.9    2e-08   
ref|XP_002967718.1|  hypothetical protein SELMODRAFT_88306            65.9    2e-08   
ref|XP_009613162.1|  PREDICTED: uncharacterized protein LOC104106342  65.9    2e-08   
ref|XP_009138537.1|  PREDICTED: uncharacterized protein LOC103862587  65.9    2e-08   Brassica rapa
ref|XP_011017408.1|  PREDICTED: eukaryotic translation initiation...  66.2    2e-08   Populus euphratica
ref|XP_004975997.1|  PREDICTED: programmed cell death protein 4-like  65.5    2e-08   Setaria italica
emb|CCA24083.1|  programmed cell death protein putative               65.1    3e-08   Albugo laibachii Nc14
ref|XP_007210887.1|  hypothetical protein PRUPE_ppa002179mg           65.5    3e-08   Prunus persica
emb|CDY03416.1|  BnaC01g16660D                                        63.2    3e-08   
ref|XP_006282961.1|  hypothetical protein CARUB_v10007684mg           65.1    4e-08   Capsella rubella
gb|AEX12249.1|  hypothetical protein 0_7685_01                        61.6    4e-08   Pinus taeda
ref|XP_008374347.1|  PREDICTED: programmed cell death protein 4       64.7    4e-08   Malus domestica [apple tree]
ref|XP_010433723.1|  PREDICTED: programmed cell death protein 4-like  64.7    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008346726.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  64.7    5e-08   
gb|ABK95855.1|  unknown                                               64.7    5e-08   Populus trichocarpa [western balsam poplar]
dbj|BAB10561.1|  topoisomerase-like protein                           64.7    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375192.1|  hypothetical protein POPTR_0014s05150g           64.7    6e-08   
gb|ADE77150.1|  unknown                                               63.9    6e-08   Picea sitchensis
ref|NP_568968.1|  MA3 domain-containing protein                       64.3    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63106.1|  topoisomerase-like protein                            64.3    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AFK39205.1|  unknown                                               63.5    6e-08   Medicago truncatula
gb|ETP45043.1|  hypothetical protein F442_08483                       64.7    7e-08   Phytophthora parasitica P10297
gb|ETO75851.1|  hypothetical protein F444_08616                       64.7    7e-08   Phytophthora parasitica P1976
ref|XP_008905354.1|  hypothetical protein PPTG_11892                  64.7    7e-08   Phytophthora parasitica INRA-310
gb|ETM46920.1|  hypothetical protein L914_08269                       64.7    7e-08   Phytophthora parasitica
gb|ETL93682.1|  hypothetical protein L917_08212                       64.7    7e-08   Phytophthora parasitica
gb|ETK87123.1|  hypothetical protein L915_08378                       64.7    7e-08   Phytophthora parasitica
gb|ETO75852.1|  hypothetical protein, variant 1                       64.7    7e-08   Phytophthora parasitica P1976
gb|ETI47170.1|  hypothetical protein F443_08547                       64.7    7e-08   Phytophthora parasitica P1569
gb|ETP16947.1|  hypothetical protein F441_08525                       64.3    7e-08   Phytophthora parasitica CJ01A1
ref|XP_010438965.1|  PREDICTED: uncharacterized protein LOC104722499  64.3    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003608913.1|  Eukaryotic translation initiation factor 4 g...  64.3    7e-08   
gb|ETP16948.1|  hypothetical protein, variant 1                       64.3    8e-08   
ref|XP_008905355.1|  hypothetical protein, variant 1                  64.3    8e-08   
gb|ETI47171.1|  hypothetical protein, variant 1                       64.3    8e-08   
gb|ETP45044.1|  hypothetical protein, variant 1                       64.3    8e-08   
gb|ETM46921.1|  hypothetical protein, variant 1                       64.3    8e-08   
gb|ETL93683.1|  hypothetical protein, variant 1                       64.3    8e-08   
gb|ETK87124.1|  hypothetical protein, variant 1                       64.3    8e-08   
ref|XP_006653535.1|  PREDICTED: programmed cell death protein 4-like  63.9    8e-08   
ref|XP_006351447.1|  PREDICTED: uncharacterized protein LOC102604303  63.9    9e-08   
gb|ETO75853.1|  hypothetical protein, variant 2                       64.3    9e-08   
gb|ETP45045.1|  hypothetical protein, variant 2                       63.9    9e-08   
gb|ETP16949.1|  hypothetical protein, variant 2                       63.9    9e-08   
gb|ETM46922.1|  hypothetical protein, variant 2                       63.9    9e-08   
gb|ETL93684.1|  hypothetical protein, variant 2                       63.9    9e-08   
gb|ETK87125.1|  hypothetical protein, variant 2                       63.9    9e-08   
gb|ETI47172.1|  hypothetical protein, variant 2                       63.9    9e-08   
ref|XP_010448515.1|  PREDICTED: programmed cell death protein 4-like  63.9    9e-08   
ref|XP_008905356.1|  hypothetical protein, variant 2                  63.9    9e-08   
ref|XP_006394303.1|  hypothetical protein EUTSA_v10003735mg           63.9    9e-08   
ref|XP_006394304.1|  hypothetical protein EUTSA_v10003735mg           63.9    9e-08   
emb|CDY10225.1|  BnaC05g04680D                                        62.8    1e-07   
ref|XP_002875900.1|  MA3 domain-containing protein                    63.5    1e-07   
ref|XP_010932283.1|  PREDICTED: uncharacterized protein LOC105052991  63.5    1e-07   
gb|AES91110.2|  topoisomerase-like protein                            63.5    1e-07   
gb|EMT01901.1|  hypothetical protein F775_26392                       63.5    1e-07   
ref|XP_008663424.1|  PREDICTED: eukaryotic translation initiation...  63.9    1e-07   
ref|XP_008663425.1|  PREDICTED: eukaryotic translation initiation...  63.9    1e-07   
ref|XP_008663426.1|  PREDICTED: eukaryotic translation initiation...  63.9    1e-07   
gb|AFW59032.1|  hypothetical protein ZEAMMB73_346603                  63.9    1e-07   
ref|XP_008663428.1|  PREDICTED: eukaryotic translation initiation...  63.9    1e-07   
ref|XP_008663427.1|  PREDICTED: eukaryotic translation initiation...  63.9    1e-07   
gb|KHN34380.1|  Programmed cell death protein 4                       63.5    1e-07   
ref|XP_010692005.1|  PREDICTED: eukaryotic translation initiation...  63.5    1e-07   
gb|KHG06182.1|  Programmed cell death 4                               63.5    1e-07   
emb|CDY41507.1|  BnaA06g22600D                                        63.2    1e-07   
ref|XP_002869702.1|  hypothetical protein ARALYDRAFT_329184           63.5    1e-07   
ref|XP_006579589.1|  PREDICTED: programmed cell death protein 4-like  63.2    1e-07   
ref|XP_009150380.1|  PREDICTED: uncharacterized protein LOC103873741  63.2    1e-07   
gb|KJB19563.1|  hypothetical protein B456_003G108800                  63.2    2e-07   
gb|AFW59031.1|  hypothetical protein ZEAMMB73_346603                  63.5    2e-07   
gb|EMS58671.1|  Programmed cell death protein 4                       63.2    2e-07   
ref|XP_006439997.1|  hypothetical protein CICLE_v10019069mg           63.2    2e-07   
gb|KDO69396.1|  hypothetical protein CISIN_1g005187mg                 63.2    2e-07   
gb|KDO69394.1|  hypothetical protein CISIN_1g005187mg                 63.2    2e-07   
ref|XP_006476941.1|  PREDICTED: uncharacterized protein LOC102613560  63.2    2e-07   
ref|XP_002511272.1|  conserved hypothetical protein                   62.8    2e-07   
ref|XP_010250915.1|  PREDICTED: uncharacterized protein LOC104593008  62.8    2e-07   
tpg|DAA37282.1|  TPA: hypothetical protein ZEAMMB73_697824            62.8    2e-07   
ref|XP_010101947.1|  hypothetical protein L484_008195                 62.8    2e-07   
ref|NP_001147914.1|  LOC100281524                                     62.4    2e-07   
tpg|DAA37281.1|  TPA: topoisomerase-like protein                      62.4    2e-07   
ref|XP_011040433.1|  PREDICTED: uncharacterized protein LOC105136694  62.4    2e-07   
gb|EIE86990.1|  hypothetical protein RO3G_11701                       62.8    2e-07   
emb|CEP09178.1|  hypothetical protein                                 62.8    2e-07   
ref|NP_001053119.1|  Os04g0482800                                     62.4    3e-07   
emb|CAD41103.2|  OSJNBb0011N17.20                                     62.4    3e-07   
ref|XP_004236308.1|  PREDICTED: uncharacterized protein LOC101255979  62.4    3e-07   
emb|CAH66971.1|  H0525D09.11                                          62.4    3e-07   
ref|XP_008797204.1|  PREDICTED: uncharacterized protein LOC103712454  62.4    3e-07   
ref|XP_008439152.1|  PREDICTED: programmed cell death protein 4-like  62.0    3e-07   
ref|XP_002318100.1|  MA3 domain-containing family protein             62.0    3e-07   
ref|XP_010243352.1|  PREDICTED: uncharacterized protein LOC104587437  62.0    3e-07   
ref|XP_011044822.1|  PREDICTED: programmed cell death protein 4       62.0    3e-07   
ref|XP_010426328.1|  PREDICTED: programmed cell death protein 4-like  62.0    3e-07   
ref|XP_002321660.1|  MA3 domain-containing family protein             62.0    4e-07   
ref|XP_011651889.1|  PREDICTED: programmed cell death protein 4       62.0    4e-07   
ref|XP_009613164.1|  PREDICTED: programmed cell death protein 4-like  62.0    4e-07   
emb|CDP15074.1|  unnamed protein product                              62.0    4e-07   
ref|XP_009333903.1|  PREDICTED: programmed cell death protein 4-like  62.0    4e-07   
ref|XP_011024109.1|  PREDICTED: programmed cell death protein 4       62.0    4e-07   
ref|XP_012079926.1|  PREDICTED: programmed cell death protein 4-like  62.0    4e-07   
gb|KJB08064.1|  hypothetical protein B456_001G062000                  62.0    4e-07   
ref|XP_007037845.1|  MA3 domain-containing protein isoform 1          61.6    4e-07   
ref|NP_190411.1|  MA3 domain-containing protein                       61.6    4e-07   
ref|XP_011072011.1|  PREDICTED: uncharacterized protein LOC105157317  61.6    5e-07   
gb|EYU17776.1|  hypothetical protein MIMGU_mgv1a002110mg              61.6    5e-07   
ref|XP_009791078.1|  PREDICTED: programmed cell death protein 4-like  61.6    5e-07   
gb|KHF98374.1|  Programmed cell death 4                               61.6    5e-07   
gb|EYU22248.1|  hypothetical protein MIMGU_mgv1a002107mg              61.6    6e-07   
ref|XP_006842133.1|  PREDICTED: programmed cell death protein 4       61.2    6e-07   
ref|XP_002448072.1|  hypothetical protein SORBIDRAFT_06g020520        61.2    6e-07   
ref|XP_002446874.1|  hypothetical protein SORBIDRAFT_06g024070        61.2    6e-07   
ref|XP_004515845.1|  PREDICTED: uncharacterized protein LOC101495970  61.2    6e-07   
ref|XP_010545985.1|  PREDICTED: programmed cell death protein 4       61.2    6e-07   
ref|XP_006281666.1|  hypothetical protein CARUB_v10027802mg           61.2    6e-07   
ref|XP_009359514.1|  PREDICTED: uncharacterized protein LOC103950082  61.2    7e-07   
ref|XP_008392872.1|  PREDICTED: programmed cell death protein 4-like  61.2    7e-07   
ref|XP_010459953.1|  PREDICTED: uncharacterized protein LOC104740909  61.2    7e-07   
gb|KHN05799.1|  Programmed cell death protein 4                       61.2    7e-07   
ref|XP_003523123.1|  PREDICTED: uncharacterized protein LOC100815729  61.2    7e-07   
ref|XP_009420117.1|  PREDICTED: uncharacterized protein LOC103999938  61.2    7e-07   
emb|CBJ33138.1|  conserved unknown protein                            60.5    7e-07   
ref|XP_009791079.1|  PREDICTED: uncharacterized protein LOC104238430  61.2    7e-07   
ref|XP_010444202.1|  PREDICTED: uncharacterized protein LOC104726927  60.8    7e-07   
ref|XP_011430030.1|  PREDICTED: eukaryotic translation initiation...  61.2    8e-07   
ref|XP_011430029.1|  PREDICTED: eukaryotic translation initiation...  61.2    8e-07   
ref|XP_011430027.1|  PREDICTED: eukaryotic translation initiation...  61.2    8e-07   
ref|XP_011430026.1|  PREDICTED: eukaryotic translation initiation...  61.2    8e-07   
ref|XP_004290465.2|  PREDICTED: programmed cell death protein 4       60.8    9e-07   
gb|EPB91951.1|  hypothetical protein HMPREF1544_01245                 60.8    9e-07   
ref|XP_002307530.1|  hypothetical protein POPTR_0005s22110g           60.8    9e-07   
gb|EKC32905.1|  Eukaryotic translation initiation factor 4 gamma 3    60.8    1e-06   
emb|CEI97983.1|  hypothetical protein RMCBS344292_12101               60.8    1e-06   
ref|XP_003579994.1|  PREDICTED: programmed cell death protein 4-l...  60.5    1e-06   
ref|XP_010240038.1|  PREDICTED: programmed cell death protein 4-l...  60.5    1e-06   
emb|CCI41862.1|  unnamed protein product                              60.8    1e-06   
ref|XP_010248756.1|  PREDICTED: uncharacterized protein LOC104591570  60.1    1e-06   
ref|XP_006811127.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  60.5    1e-06   
ref|XP_006852256.1|  PREDICTED: uncharacterized protein LOC18441970   60.1    1e-06   
ref|XP_009518403.1|  hypothetical protein PHYSODRAFT_540634           60.1    1e-06   
emb|CCA13992.1|  eukaryotic translation initiation factor 4 gamma...  60.5    1e-06   
ref|XP_002864841.1|  MA3 domain-containing protein                    60.1    2e-06   
ref|XP_010037475.1|  PREDICTED: programmed cell death protein 4-like  60.1    2e-06   
emb|CDY65627.1|  BnaC03g74850D                                        60.1    2e-06   
ref|XP_008799936.1|  PREDICTED: uncharacterized protein LOC103714460  60.1    2e-06   
gb|KHN32821.1|  Programmed cell death protein 4                       60.1    2e-06   
gb|KJB28930.1|  hypothetical protein B456_005G076400                  60.1    2e-06   
ref|XP_009335167.1|  PREDICTED: programmed cell death protein 4-l...  60.1    2e-06   
ref|XP_007155509.1|  hypothetical protein PHAVU_003G207600g           59.7    2e-06   
emb|CEG64917.1|  hypothetical protein RMATCC62417_01808               60.1    2e-06   
ref|XP_001777050.1|  predicted protein                                59.7    2e-06   
emb|CEG64916.1|  hypothetical protein RMATCC62417_01808               59.7    2e-06   
emb|CCV00611.1|  unnamed protein product                              59.7    2e-06   
emb|CBI14893.3|  unnamed protein product                              59.7    2e-06   
ref|XP_012084516.1|  PREDICTED: uncharacterized protein LOC105643885  59.3    2e-06   
ref|XP_002277813.1|  PREDICTED: programmed cell death protein 4       59.3    3e-06   
ref|XP_010695966.1|  PREDICTED: uncharacterized protein LOC104908546  59.3    3e-06   
ref|XP_011093493.1|  PREDICTED: eukaryotic translation initiation...  59.3    3e-06   
emb|CAN76898.1|  hypothetical protein VITISV_010607                   59.3    3e-06   
ref|XP_003074235.1|  putative calcium-dependent protein kinase (ISS)  59.3    3e-06   
ref|XP_006290693.1|  hypothetical protein CARUB_v10016789mg           58.9    3e-06   
ref|XP_006599457.1|  PREDICTED: uncharacterized protein LOC100806217  58.9    4e-06   
ref|XP_007670946.1|  PREDICTED: eukaryotic translation initiation...  59.3    4e-06   
gb|EPS73252.1|  hypothetical protein M569_01501                       58.9    4e-06   
emb|CDP01138.1|  unnamed protein product                              58.9    4e-06   
ref|XP_007014201.1|  MA3 domain-containing protein                    58.9    4e-06   
ref|XP_005496294.1|  PREDICTED: eukaryotic translation initiation...  58.5    4e-06   
ref|XP_011426940.1|  PREDICTED: eukaryotic translation initiation...  58.5    4e-06   
dbj|GAN03422.1|  eukaryotic initiation factor 4F subunit P130         58.9    5e-06   
ref|XP_010927576.1|  PREDICTED: uncharacterized protein LOC105049573  58.5    5e-06   
gb|KEH17960.1|  eukaryotic translation initiation factor 4G-like ...  58.9    5e-06   
gb|EKC22985.1|  Eukaryotic translation initiation factor 4 gamma 3    58.5    5e-06   
ref|XP_003626750.1|  Eukaryotic translation initiation factor 4G      58.9    5e-06   
ref|XP_008870215.1|  hypothetical protein H310_06806                  58.5    5e-06   
gb|KEH17961.1|  eukaryotic translation initiation factor 4G-like ...  58.5    5e-06   
gb|AET01226.2|  eukaryotic translation initiation factor 4G-like ...  58.5    5e-06   
gb|KEH17963.1|  eukaryotic translation initiation factor 4G-like ...  58.5    5e-06   
ref|XP_002613895.1|  hypothetical protein BRAFLDRAFT_277494           58.5    5e-06   
gb|KHG12994.1|  Programmed cell death 4                               58.2    6e-06   
ref|XP_007053878.1|  PREDICTED: eukaryotic translation initiation...  58.5    6e-06   
ref|XP_007053879.1|  PREDICTED: eukaryotic translation initiation...  58.5    6e-06   
gb|EMP41405.1|  Eukaryotic translation initiation factor 4 gamma 3    58.5    6e-06   
ref|XP_001767687.1|  predicted protein                                58.2    7e-06   
ref|XP_423296.4|  PREDICTED: eukaryotic translation initiation fa...  58.2    7e-06   
ref|NP_001159302.1|  uncharacterized protein LOC100304394             57.8    8e-06   
ref|XP_007151932.1|  hypothetical protein PHAVU_004G088100g           57.8    8e-06   
ref|XP_008343859.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  58.2    8e-06   
ref|XP_010686654.1|  PREDICTED: eukaryotic translation initiation...  58.2    8e-06   
ref|XP_004947597.1|  PREDICTED: eukaryotic translation initiation...  58.2    8e-06   
ref|XP_004947598.1|  PREDICTED: eukaryotic translation initiation...  58.2    8e-06   
ref|XP_003764960.1|  PREDICTED: eukaryotic translation initiation...  58.2    9e-06   
ref|XP_009420296.1|  PREDICTED: uncharacterized protein LOC104000077  57.8    9e-06   
ref|XP_007491295.1|  PREDICTED: eukaryotic translation initiation...  58.2    9e-06   
ref|XP_004492237.1|  PREDICTED: eukaryotic translation initiation...  57.8    9e-06   
ref|XP_010534116.1|  PREDICTED: uncharacterized protein LOC104809746  57.8    9e-06   
ref|XP_004657614.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...  57.8    9e-06   
ref|XP_002898351.1|  eukaryotic translation initiation factor, pu...  57.8    1e-05   
tpg|DAA63080.1|  TPA: hypothetical protein ZEAMMB73_949899            57.8    1e-05   
emb|CAA84397.1|  translation initiationfactor eIF-4gamma              57.4    1e-05   
ref|XP_008925579.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_008352248.1|  PREDICTED: uncharacterized protein LOC103415731  57.4    1e-05   
gb|KFQ31937.1|  Eukaryotic translation initiation factor 4 gamma 3    57.4    1e-05   
ref|XP_002527108.1|  conserved hypothetical protein                   57.4    1e-05   
ref|XP_009296606.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_009296603.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_009296622.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_009296621.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_005168470.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_009296609.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_010683479.1|  PREDICTED: uncharacterized protein LOC104898145  57.4    1e-05   
ref|NP_001073669.1|  eukaryotic translation initiation factor 4 g...  57.4    1e-05   
ref|XP_009296625.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_008940884.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_005665144.1|  PREDICTED: eukaryotic translation initiation...  57.0    1e-05   
ref|XP_009296612.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_001754785.1|  predicted protein                                57.0    1e-05   
ref|XP_009296636.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_009296632.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_009296629.1|  PREDICTED: eukaryotic translation initiation...  57.4    1e-05   
ref|XP_008836836.1|  PREDICTED: eukaryotic translation initiation...  57.4    2e-05   
ref|XP_008836833.1|  PREDICTED: eukaryotic translation initiation...  57.4    2e-05   
ref|XP_008836832.1|  PREDICTED: eukaryotic translation initiation...  57.4    2e-05   
ref|XP_008653211.1|  PREDICTED: eukaryotic translation initiation...  57.4    2e-05   
ref|XP_008836834.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
gb|KHN14073.1|  Programmed cell death protein 4                       57.0    2e-05   
ref|XP_010721308.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_005842849.1|  hypothetical protein CHLNCDRAFT_59437            56.2    2e-05   
ref|XP_002465627.1|  hypothetical protein SORBIDRAFT_01g042530        57.0    2e-05   
ref|XP_009508861.1|  PREDICTED: eukaryotic translation initiation...  56.6    2e-05   
ref|XP_005905283.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_009093985.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_009232422.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_006114422.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
gb|EYU36542.1|  hypothetical protein MIMGU_mgv1a019620mg              56.6    2e-05   
ref|XP_006114425.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_005428289.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_011085647.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_006114421.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_011085641.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_006114427.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_006114423.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_010117060.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_004985163.1|  PREDICTED: uncharacterized protein LOC101759469  56.6    2e-05   
ref|XP_009951142.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_010019672.1|  PREDICTED: eukaryotic translation initiation...  56.2    2e-05   
ref|XP_008836835.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
ref|XP_006114428.1|  PREDICTED: eukaryotic translation initiation...  57.0    2e-05   
gb|KFP41173.1|  Eukaryotic translation initiation factor 4 gamma 3    56.6    2e-05   
ref|XP_009909640.1|  PREDICTED: eukaryotic translation initiation...  56.6    2e-05   
ref|XP_006114424.1|  PREDICTED: eukaryotic translation initiation...  56.6    2e-05   
ref|XP_006114429.1|  PREDICTED: eukaryotic translation initiation...  56.6    2e-05   



>ref|XP_009796936.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Nicotiana sylvestris]
Length=777

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ELKRKTVALL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AIS+GLDKSPP V+PV 
Sbjct  609   PDELKRKTVALLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISIGLDKSPPRVEPVA  668

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
              LLEYLF KK+F +  LG+G   FASLLDDLAMDLPKAP NFG+II RLVLAG ++F +V
Sbjct  669   HLLEYLFVKKVFTAGDLGTGLLNFASLLDDLAMDLPKAPANFGEIIARLVLAGALDFKVV  728

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KDVF+A M  +SSSP+G A+LDSQA  VEAC++L Q
Sbjct  729   NEILKEVTDDLYQKDVFTATMGAISSSPTGQAVLDSQAPEVEACKTLFQ  777



>ref|XP_009796935.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Nicotiana sylvestris]
Length=779

 Score =   256 bits (653),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ELKRKTVALL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AIS+GLDKSPP V+PV 
Sbjct  611   PDELKRKTVALLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISIGLDKSPPRVEPVA  670

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
              LLEYLF KK+F +  LG+G   FASLLDDLAMDLPKAP NFG+II RLVLAG ++F +V
Sbjct  671   HLLEYLFVKKVFTAGDLGTGLLNFASLLDDLAMDLPKAPANFGEIIARLVLAGALDFKVV  730

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KDVF+A M  +SSSP+G A+LDSQA  VEAC++L Q
Sbjct  731   NEILKEVTDDLYQKDVFTATMGAISSSPTGQAVLDSQAPEVEACKTLFQ  779



>ref|XP_009597543.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Nicotiana tomentosiformis]
Length=779

 Score =   251 bits (640),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ELKRKT +LL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AIS+GLDKSPP V+PV 
Sbjct  611   PDELKRKTASLLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISIGLDKSPPRVEPVA  670

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYLF KK+F +  LG+G   FASLLDDLAMDLPKAP NFG+II RLVLAG ++F +V
Sbjct  671   QLLEYLFVKKVFTAGDLGTGLLNFASLLDDLAMDLPKAPANFGEIIARLVLAGALDFKVV  730

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KD+F+A M  +SSSP+G A+LDSQA +VE C++L Q
Sbjct  731   NEILKKVTDDLYQKDLFTATMGAISSSPTGQAVLDSQAPDVEVCKTLFQ  779



>ref|XP_009614239.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=776

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PE+LKRKTV+LL+EYF++RLLDEALQCIEELKSP YYPEVVK+ ISLGLDKSPP V+PV 
Sbjct  608   PEDLKRKTVSLLEEYFNVRLLDEALQCIEELKSPGYYPEVVKETISLGLDKSPPRVEPVT  667

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYLF KK+F +  L +GC  FASLLDDLAMDLPKAP NFG+I+ +LVL G I+F +V
Sbjct  668   QLLEYLFAKKVFTAMDLATGCVNFASLLDDLAMDLPKAPANFGEIVAKLVLTGAIDFKLV  727

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             +EILK + D  Y KD+F AI RV++SSP G  +LDSQA ++EAC++LLQ
Sbjct  728   HEILKKVTDYLYQKDLFVAITRVITSSPKGQGVLDSQAPDIEACKNLLQ  776



>ref|XP_009614240.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Nicotiana tomentosiformis]
Length=774

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PE+LKRKTV+LL+EYF++RLLDEALQCIEELKSP YYPEVVK+ ISLGLDKSPP V+PV 
Sbjct  606   PEDLKRKTVSLLEEYFNVRLLDEALQCIEELKSPGYYPEVVKETISLGLDKSPPRVEPVT  665

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYLF KK+F +  L +GC  FASLLDDLAMDLPKAP NFG+I+ +LVL G I+F +V
Sbjct  666   QLLEYLFAKKVFTAMDLATGCVNFASLLDDLAMDLPKAPANFGEIVAKLVLTGAIDFKLV  725

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             +EILK + D  Y KD+F AI RV++SSP G  +LDSQA ++EAC++LLQ
Sbjct  726   HEILKKVTDYLYQKDLFVAITRVITSSPKGQGVLDSQAPDIEACKNLLQ  774



>ref|XP_006350109.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Solanum tuberosum]
Length=773

 Score =   248 bits (632),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKTV+LL+EYFS+R+LDEALQCIEELKSPA+YPEVV++AISLGLDKSPP V+PV 
Sbjct  605   PEELKRKTVSLLEEYFSVRILDEALQCIEELKSPAFYPEVVEKAISLGLDKSPPRVEPVA  664

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+F ++ L +GC  FAS L+DLAMDLPKAP NFG+II +LVL G ++F +V
Sbjct  665   QLLEHLFAKKVFTASDLATGCLNFASQLEDLAMDLPKAPANFGEIISKLVLTGAMDFKLV  724

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEIL+ + D+ Y KD+F+AIM+ +SSSP+G  +LDSQA +VEAC++L Q
Sbjct  725   NEILQKVTDDLYEKDLFAAIMKAISSSPTGQGVLDSQAPDVEACKNLFQ  773



>ref|XP_006350110.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Solanum tuberosum]
Length=771

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKTV+LL+EYFS+R+LDEALQCIEELKSPA+YPEVV++AISLGLDKSPP V+PV 
Sbjct  603   PEELKRKTVSLLEEYFSVRILDEALQCIEELKSPAFYPEVVEKAISLGLDKSPPRVEPVA  662

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+F ++ L +GC  FAS L+DLAMDLPKAP NFG+II +LVL G ++F +V
Sbjct  663   QLLEHLFAKKVFTASDLATGCLNFASQLEDLAMDLPKAPANFGEIISKLVLTGAMDFKLV  722

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEIL+ + D+ Y KD+F+AIM+ +SSSP+G  +LDSQA +VEAC++L Q
Sbjct  723   NEILQKVTDDLYEKDLFAAIMKAISSSPTGQGVLDSQAPDVEACKNLFQ  771



>ref|XP_009798535.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Nicotiana sylvestris]
Length=775

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKTV+LL+EYF++RLLDEALQCI ELKSP +YPEVVK+ ISLGLDKSPP V+PV 
Sbjct  607   PEELKRKTVSLLEEYFNVRLLDEALQCIVELKSPDFYPEVVKETISLGLDKSPPRVEPVA  666

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYLF KK+F +  L +GC  FASLLDDLAMDLPKAP NFG+I+ +LVL G ++F +V
Sbjct  667   QLLEYLFAKKVFTAIDLATGCVNFASLLDDLAMDLPKAPANFGEIVAKLVLTGAVDFKLV  726

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             +EILK + D+ Y KD+F AI RV++SSP+G  +LDSQA ++EAC++LLQ
Sbjct  727   HEILKKVTDDLYQKDLFVAITRVITSSPTGQGVLDSQAPDIEACKNLLQ  775



>ref|XP_009798534.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Nicotiana sylvestris]
Length=777

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKTV+LL+EYF++RLLDEALQCI ELKSP +YPEVVK+ ISLGLDKSPP V+PV 
Sbjct  609   PEELKRKTVSLLEEYFNVRLLDEALQCIVELKSPDFYPEVVKETISLGLDKSPPRVEPVA  668

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYLF KK+F +  L +GC  FASLLDDLAMDLPKAP NFG+I+ +LVL G ++F +V
Sbjct  669   QLLEYLFAKKVFTAIDLATGCVNFASLLDDLAMDLPKAPANFGEIVAKLVLTGAVDFKLV  728

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             +EILK + D+ Y KD+F AI RV++SSP+G  +LDSQA ++EAC++LLQ
Sbjct  729   HEILKKVTDDLYQKDLFVAITRVITSSPTGQGVLDSQAPDIEACKNLLQ  777



>ref|XP_006343626.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Solanum tuberosum]
Length=778

 Score =   244 bits (623),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ LKRKT +LL+EYFS+RLL+EALQC+EELKSPAY+ EVVK+AIS+GLDKSPPCV+PV 
Sbjct  610   PDVLKRKTASLLEEYFSVRLLEEALQCVEELKSPAYHSEVVKEAISIGLDKSPPCVEPVA  669

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+F +  L +G   F+SLLDDLAMDLPKAP NFGDII RLVLAG  +F +V
Sbjct  670   QLLEHLFAKKVFTAGDLVTGFLNFSSLLDDLAMDLPKAPVNFGDIISRLVLAGAFDFKVV  729

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KDVF+A M  +SSSP+G A+LDSQA++VEAC++L Q
Sbjct  730   NEILKKVTDDLYQKDVFTATMGSISSSPTGQAVLDSQASDVEACKALFQ  778



>ref|XP_006343625.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Solanum tuberosum]
Length=780

 Score =   244 bits (623),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ LKRKT +LL+EYFS+RLL+EALQC+EELKSPAY+ EVVK+AIS+GLDKSPPCV+PV 
Sbjct  612   PDVLKRKTASLLEEYFSVRLLEEALQCVEELKSPAYHSEVVKEAISIGLDKSPPCVEPVA  671

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+F +  L +G   F+SLLDDLAMDLPKAP NFGDII RLVLAG  +F +V
Sbjct  672   QLLEHLFAKKVFTAGDLVTGFLNFSSLLDDLAMDLPKAPVNFGDIISRLVLAGAFDFKVV  731

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KDVF+A M  +SSSP+G A+LDSQA++VEAC++L Q
Sbjct  732   NEILKKVTDDLYQKDVFTATMGSISSSPTGQAVLDSQASDVEACKALFQ  780



>ref|XP_004251742.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Solanum lycopersicum]
Length=773

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKTV+LL+EYFS+R+LDEALQCIEELKSPA+YPEVV++AISLGLDKSPP V+PV 
Sbjct  605   PEELKRKTVSLLEEYFSVRILDEALQCIEELKSPAFYPEVVEKAISLGLDKSPPRVEPVA  664

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  +K+F +  L +GC  FAS L+DLAMDLPKAP NFG+II RLVL G ++F +V
Sbjct  665   QLLEHLSAEKVFTATDLATGCLNFASQLEDLAMDLPKAPANFGEIISRLVLTGAMDFKLV  724

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEIL+ + D+ Y KD+F+AIM+ +SSSP+G  +LDSQA +V+AC++L Q
Sbjct  725   NEILQKVTDDLYQKDLFAAIMKAISSSPTGQGVLDSQAPDVKACKNLFQ  773



>ref|XP_010313817.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Solanum lycopersicum]
Length=771

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKTV+LL+EYFS+R+LDEALQCIEELKSPA+YPEVV++AISLGLDKSPP V+PV 
Sbjct  603   PEELKRKTVSLLEEYFSVRILDEALQCIEELKSPAFYPEVVEKAISLGLDKSPPRVEPVA  662

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  +K+F +  L +GC  FAS L+DLAMDLPKAP NFG+II RLVL G ++F +V
Sbjct  663   QLLEHLSAEKVFTATDLATGCLNFASQLEDLAMDLPKAPANFGEIISRLVLTGAMDFKLV  722

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEIL+ + D+ Y KD+F+AIM+ +SSSP+G  +LDSQA +V+AC++L Q
Sbjct  723   NEILQKVTDDLYQKDLFAAIMKAISSSPTGQGVLDSQAPDVKACKNLFQ  771



>ref|NP_001265910.1| eukaryotic translation initiation factor isoform 4G-1-like [Solanum 
lycopersicum]
 gb|AFW15815.1| eukaryotic translation initiation factor iso4G [Solanum lycopersicum]
Length=775

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ LKRKT +LL+EYFS+RLL+EALQC+EELKSPAY+PEVVK+AIS+GLDKSPP V+PV 
Sbjct  607   PDVLKRKTASLLEEYFSVRLLEEALQCVEELKSPAYHPEVVKEAISIGLDKSPPRVEPVA  666

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+F +  L +G   F+SLLDDLAMDLPKAP NFGDII RLVLAG  +F +V
Sbjct  667   QLLEHLFVKKVFTARDLVTGFLNFSSLLDDLAMDLPKAPVNFGDIIARLVLAGAFDFKVV  726

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KDVF+A M  +SSSP+G A+LDSQ+++VEAC++L Q
Sbjct  727   NEILKKVTDDLYQKDVFTATMGSISSSPTGQAVLDSQSSDVEACKALFQ  775



>ref|XP_010323154.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Solanum lycopersicum]
Length=773

 Score =   241 bits (616),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 143/169 (85%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ LKRKT +LL+EYFS+RLL+EALQC+EELKSPAY+PEVVK+AIS+GLDKSPP V+PV 
Sbjct  605   PDVLKRKTASLLEEYFSVRLLEEALQCVEELKSPAYHPEVVKEAISIGLDKSPPRVEPVA  664

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+F +  L +G   F+SLLDDLAMDLPKAP NFGDII RLVLAG  +F +V
Sbjct  665   QLLEHLFVKKVFTARDLVTGFLNFSSLLDDLAMDLPKAPVNFGDIIARLVLAGAFDFKVV  724

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             NEILK + D+ Y KDVF+A M  +SSSP+G A+LDSQ+++VEAC++L Q
Sbjct  725   NEILKKVTDDLYQKDVFTATMGSISSSPTGQAVLDSQSSDVEACKALFQ  773



>ref|XP_011083941.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Sesamum indicum]
Length=796

 Score =   238 bits (608),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ELKRKT +LL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AISLGL+KSPPCV+PV 
Sbjct  628   PDELKRKTTSLLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISLGLEKSPPCVEPVG  687

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS-I  646
             KLLEYLF+KK+ ++  + +GC  +A+LLDDLA+DLPKAPT+FG+IIG+LVLAG ++F+ +
Sbjct  688   KLLEYLFDKKVINAKDIAAGCIFYAALLDDLAIDLPKAPTHFGEIIGKLVLAGALDFNKV  747

Query  645   VNEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
               +IL  +GD++Y K +F+A ++VVSS PSG A+LDSQA++V AC SL 
Sbjct  748   ARDILAKVGDDYYQKAIFTAALKVVSSDPSGKALLDSQASDVAACESLF  796



>ref|XP_011079385.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Sesamum indicum]
Length=794

 Score =   238 bits (608),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ELKRKT++LL+EYFS+RLLDEA QC+EELKSPAY+PE+VK+AISLGLDKSPPCV+PV 
Sbjct  627   PDELKRKTISLLEEYFSVRLLDEASQCVEELKSPAYHPELVKEAISLGLDKSPPCVEPVA  686

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+LF +K+     +G+GC  +A+LL+DLA+DLPKAP NFG+IIG+LVLA G++F +V
Sbjct  687   KLLEHLFAQKLLSEKDIGTGCLLYAALLEDLAIDLPKAPANFGEIIGKLVLAKGLDFKVV  746

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EIL+ +GD+++   VFS+ M+++SS+P G A+LDSQA+++ AC SL 
Sbjct  747   REILEKVGDDYFQNAVFSSAMKIISSAPGGKAVLDSQASDIAACESLF  794



>gb|KJB53886.1| hypothetical protein B456_009G009800 [Gossypium raimondii]
Length=766

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKT ALL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AIS+ L+KSPPCV+PV K
Sbjct  600  DDLQRKTRALLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISIALEKSPPCVEPVSK  659

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF K++  +  +G+GC  + +LLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  660  LLEYLFIKEVLTARDIGTGCLLYGALLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVK  719

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ Y K VF A MR++SS PSG A+LD+QA N++AC SL 
Sbjct  720  EILKKMEDDMYQKAVFDATMRIISSDPSGKALLDAQAINIDACTSLF  766



>gb|KJB53885.1| hypothetical protein B456_009G009800 [Gossypium raimondii]
Length=789

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKT ALL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AIS+ L+KSPPCV+PV K
Sbjct  623  DDLQRKTRALLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISIALEKSPPCVEPVSK  682

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF K++  +  +G+GC  + +LLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  683  LLEYLFIKEVLTARDIGTGCLLYGALLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVK  742

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ Y K VF A MR++SS PSG A+LD+QA N++AC SL 
Sbjct  743  EILKKMEDDMYQKAVFDATMRIISSDPSGKALLDAQAINIDACTSLF  789



>emb|CAN70546.1| hypothetical protein VITISV_013807 [Vitis vinifera]
Length=794

 Score =   232 bits (592),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKTV+LL+EYF +R+LDEALQC+EELKSPAY+PEVVK+AISL L+KSPPCVDPV K
Sbjct  628  DDLRRKTVSLLEEYFGVRILDEALQCVEELKSPAYHPEVVKEAISLALEKSPPCVDPVAK  687

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLE+LF KK+  +  +G+GC  + S+LDD+ +DLPKAP +FG++IG LVLAG ++F +V 
Sbjct  688  LLEFLFSKKVLTTMDIGTGCLMYGSMLDDIGIDLPKAPNSFGEVIGNLVLAGALDFKVVT  747

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EI+K + D+ + K +F A+MR+VSSSPSG  +LDSQA ++ AC+SLL
Sbjct  748  EIMKKVEDDRFQKMIFDAVMRIVSSSPSGQGVLDSQAADIAACQSLL  794



>ref|XP_002277218.2| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Vitis vinifera]
Length=794

 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKTV+LL+EYF +R+LDEALQC+EELKSPAY+PEVVK+AISL L+KSPPCVDPV K
Sbjct  628  DDLRRKTVSLLEEYFGVRILDEALQCVEELKSPAYHPEVVKEAISLALEKSPPCVDPVAK  687

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLE+LF KK+  +  +G+GC  + S+LDD+ +DLPKAP +FG++IG LVLAG ++F +V 
Sbjct  688  LLEFLFSKKVLTTMDIGTGCLMYGSMLDDIGIDLPKAPNSFGEVIGNLVLAGALDFKVVT  747

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EI+K + D+ + K +F A+MR+VSSSPSG  +LDSQA ++ AC+SLL
Sbjct  748  EIMKKVEDDRFQKMIFDAVMRIVSSSPSGQGVLDSQAADIAACQSLL  794



>ref|XP_012071533.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
isoform X1 [Jatropha curcas]
 gb|KDP38701.1| hypothetical protein JCGZ_04054 [Jatropha curcas]
Length=800

 Score =   232 bits (591),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++LL EYF+IRLLDEALQC+EELKSPAY+PEVVK+AISLGL+++PPCV+PV 
Sbjct  633   PDELQRKTISLLKEYFNIRLLDEALQCVEELKSPAYHPEVVKEAISLGLEENPPCVEPVA  692

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  +  +G+GC  + SLLDD+ +DLPKAP NFG+IIG+LVLAG ++F +V
Sbjct  693   KLLEYLFAKKVITAKDVGTGCLLYGSLLDDIGIDLPKAPHNFGEIIGKLVLAGALDFKVV  752

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ Y K V  A +R +  SP+G  +LDSQA+++EAC+SLL
Sbjct  753   REVLKKMEDDMYQKAVLDAAIRTIGCSPNGQGLLDSQASDIEACQSLL  800



>ref|XP_012071534.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
isoform X2 [Jatropha curcas]
Length=806

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++LL EYF+IRLLDEALQC+EELKSPAY+PEVVK+AISLGL+++PPCV+PV 
Sbjct  639   PDELQRKTISLLKEYFNIRLLDEALQCVEELKSPAYHPEVVKEAISLGLEENPPCVEPVA  698

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  +  +G+GC  + SLLDD+ +DLPKAP NFG+IIG+LVLAG ++F +V
Sbjct  699   KLLEYLFAKKVITAKDVGTGCLLYGSLLDDIGIDLPKAPHNFGEIIGKLVLAGALDFKVV  758

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ Y K V  A +R +  SP+G  +LDSQA+++EAC+SLL
Sbjct  759   REVLKKMEDDMYQKAVLDAAIRTIGCSPNGQGLLDSQASDIEACQSLL  806



>gb|KJB80592.1| hypothetical protein B456_013G105700 [Gossypium raimondii]
Length=775

 Score =   230 bits (587),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT ALL+EYFS+RLLDEALQC+EELKSP YYPEVVK+AIS+ L+K PPCV+PV K
Sbjct  609  DELSRKTKALLEEYFSVRLLDEALQCVEELKSPGYYPEVVKEAISIALEKIPPCVEPVSK  668

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYLF KK+  +  +G+GC  + +LLDD+ +DLPKAP NFG+IIG+L LAGG++F++V 
Sbjct  669  LIEYLFIKKVLTARDIGTGCLLYGALLDDIGIDLPKAPNNFGEIIGKLALAGGLDFNVVR  728

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ Y K VF A MR+VSSSPSG A+L++QA+ V+ C+SL 
Sbjct  729  EILKKMEDDLYQKAVFDAAMRIVSSSPSGQAVLEAQASEVKVCQSLF  775



>gb|KJB80591.1| hypothetical protein B456_013G105700 [Gossypium raimondii]
Length=784

 Score =   230 bits (587),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT ALL+EYFS+RLLDEALQC+EELKSP YYPEVVK+AIS+ L+K PPCV+PV K
Sbjct  618  DELSRKTKALLEEYFSVRLLDEALQCVEELKSPGYYPEVVKEAISIALEKIPPCVEPVSK  677

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYLF KK+  +  +G+GC  + +LLDD+ +DLPKAP NFG+IIG+L LAGG++F++V 
Sbjct  678  LIEYLFIKKVLTARDIGTGCLLYGALLDDIGIDLPKAPNNFGEIIGKLALAGGLDFNVVR  737

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ Y K VF A MR+VSSSPSG A+L++QA+ V+ C+SL 
Sbjct  738  EILKKMEDDLYQKAVFDAAMRIVSSSPSGQAVLEAQASEVKVCQSLF  784



>gb|KJB83330.1| hypothetical protein B456_013G241300 [Gossypium raimondii]
Length=800

 Score =   229 bits (583),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P++L+RK  ALLDEYF++RLLDEAL C+EELKSP+++PEVVK+AIS+ LDKSPPCV+PV 
Sbjct  633   PDDLQRKIRALLDEYFNVRLLDEALLCVEELKSPSHHPEVVKEAISIALDKSPPCVEPVW  692

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+F +  +G+GC  + +LLDD+A+DLPKAP NFG+IIGRL+LAGG++F +V
Sbjct  693   KLLEYLFTKKVFTARDIGTGCLLYGALLDDIAIDLPKAPNNFGEIIGRLILAGGLDFKVV  752

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + D+ Y K VF A M+ +S +PSG  +LD+ A+ VEAC++L 
Sbjct  753   KEILKKMEDDLYQKAVFDAAMKTISLNPSGQGLLDASASEVEACQNLF  800



>ref|XP_004507752.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor isoform 4G-1-like [Cicer arietinum]
Length=786

 Score =   228 bits (582),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L RKT +LL+EYF+IRLLDEALQC+EELK+PAYYPE VK+AISLGLDKSPPCV+PV  
Sbjct  620  DDLHRKTASLLEEYFNIRLLDEALQCVEELKAPAYYPEFVKEAISLGLDKSPPCVEPVAN  679

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+E+LF KK+  +  +G+GC  FASLLDD+ +DLPKAP+NFG+IIG+L+LAGG++F +V 
Sbjct  680  LIEHLFIKKVLSARDIGTGCLLFASLLDDIGIDLPKAPSNFGEIIGKLILAGGLDFKVVI  739

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+++ K +F++ M+V+SS+ SG A+LDSQA+++EAC+ L 
Sbjct  740  EILKKVSDDYFQKTIFNSAMQVISSA-SGQAVLDSQASDIEACQVLF  785



>ref|XP_003549535.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform 1 [Glycine max]
Length=789

 Score =   228 bits (582),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKTV+LL+EYF++RLLDEALQC+EELK+PAYYPE VK+AISL LDKSPPC +PV  
Sbjct  623  DELQRKTVSLLEEYFNVRLLDEALQCVEELKAPAYYPEFVKEAISLALDKSPPCAEPVAN  682

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L EYLF KKI  +  +G+GC  FASLLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  683  LFEYLFIKKILSARDIGTGCMLFASLLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVT  742

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K +FS+ ++V++S+ SG A+LD+QA+++EAC+SL 
Sbjct  743  EILKKVEDDRFQKAIFSSALQVITSA-SGQAVLDAQASDIEACQSLF  788



>gb|KHN17504.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Glycine soja]
Length=789

 Score =   228 bits (581),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKTV+LL+EYF++RLLDEALQC+EELK+PAYYPE VK+AISL LDKSPPC +PV  
Sbjct  623  DELQRKTVSLLEEYFNVRLLDEALQCVEELKAPAYYPEFVKEAISLALDKSPPCAEPVAN  682

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L EYLF KKI  +  +G+GC  FASLLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  683  LFEYLFIKKILSARDIGTGCMLFASLLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVT  742

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K +FS+ ++V++S+ SG A+LD+QA+++EAC+SL 
Sbjct  743  EILKKVEDDRFQKAIFSSALQVITSA-SGQAVLDAQASDIEACQSLF  788



>ref|XP_002534061.1| Eukaryotic initiation factor iso-4F subunit p82-34, putative 
[Ricinus communis]
 gb|EEF28321.1| Eukaryotic initiation factor iso-4F subunit p82-34, putative 
[Ricinus communis]
Length=587

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL+RKT++LL EYFS+RLLDEALQC+EEL SP Y+PE+VK+ I LGL+++PPCV+PV 
Sbjct  420   PNELRRKTISLLKEYFSVRLLDEALQCVEELNSPVYHPEIVKEVICLGLEENPPCVEPVA  479

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  +  +G+GC  + S+LDD+ +DLPKAP NFG+IIG LVLAGG++F +V
Sbjct  480   KLLEYLFSKKVLTAKDIGTGCLLYGSMLDDIGIDLPKAPNNFGEIIGLLVLAGGMDFKVV  539

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ Y K +  A MR +S SP G  +LDSQA+++EAC++LL
Sbjct  540   REVLKKMEDDRYQKAIVDAAMRTISYSPDGQVVLDSQASDIEACQTLL  587



>ref|XP_006575314.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Glycine max]
Length=784

 Score =   228 bits (580),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKTV+LL+EYFS+RLLDEALQC+EELK+PAYYPE VK+AISL LDKSPPCV+PV  
Sbjct  618  DELQRKTVSLLEEYFSVRLLDEALQCVEELKAPAYYPEFVKEAISLALDKSPPCVEPVAN  677

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L EYL  KKI  +  +G+GC  FASLLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  678  LFEYLLIKKILSARDIGTGCMLFASLLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVV  737

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K +FS+ ++V+SS  SG A+LDSQA+++EAC+SL 
Sbjct  738  EILKKVEDDRFQKAIFSSALQVISSV-SGQAVLDSQASDIEACQSLF  783



>gb|KHN14133.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Glycine soja]
Length=784

 Score =   227 bits (579),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKTV+LL+EYFS+RLLDEALQC+EELK+PAYYPE VK+AISL LDKSPPCV+PV  
Sbjct  618  DELQRKTVSLLEEYFSVRLLDEALQCVEELKAPAYYPEFVKEAISLALDKSPPCVEPVAN  677

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L EYL  KKI  +  +G+GC  FASLLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  678  LFEYLLIKKILSARDIGTGCMLFASLLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVV  737

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K +FS+ ++V+SS  SG A+LDSQA+++EAC+SL 
Sbjct  738  EILKKVEDDRFQKAIFSSALQVISSV-SGQAVLDSQASDIEACQSLF  783



>ref|XP_003610290.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Medicago 
truncatula]
 gb|AES92487.1| eukaryotic translation initiation factor iso4G [Medicago truncatula]
Length=779

 Score =   227 bits (578),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L RKTV+LL+EYF++RLLDEALQC+EELK+P Y+PEVVK+AISLGLDKSPP V+PV  
Sbjct  613  DDLHRKTVSLLEEYFNVRLLDEALQCVEELKAPTYHPEVVKEAISLGLDKSPPRVEPVAN  672

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYLF KKI  +  +G+GC  FASLLDD+ +DLPKAP NFG+IIG+LVL+ G++F +V 
Sbjct  673  LIEYLFTKKILTARDIGTGCLLFASLLDDIGIDLPKAPNNFGEIIGKLVLSAGLDFKVVK  732

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK +GD+++ K +F++ ++V+SS+ SG A+LDSQA+++EAC++L +
Sbjct  733  EILKKVGDDYFQKAIFNSAVQVISSA-SGQAVLDSQASDIEACQALFE  779



>gb|KHG16321.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Gossypium 
arboreum]
Length=790

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKT ALL+EYFS+RLLDEALQC+EELKSPAY+PEVVK+AIS+ L+KSPPCV+PV K
Sbjct  624  DDLQRKTRALLEEYFSVRLLDEALQCVEELKSPAYHPEVVKEAISVALEKSPPCVEPVSK  683

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF KK+  +  +G+GC  + +LLDD+ +DLPKAP NFG+IIG+LVLAGG++F +V 
Sbjct  684  LLEYLFIKKVLTARDIGTGCLLYGALLDDIGIDLPKAPNNFGEIIGKLVLAGGLDFKVVK  743

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ Y K VF A +R++   PSG A+LD+QA  V+AC SL 
Sbjct  744  EILKKMEDDMYQKAVFDATIRIIGLDPSGKALLDAQAIEVDACMSLF  790



>gb|KHG01242.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Gossypium 
arboreum]
Length=803

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P++L+RK  ALLDEYF +RLLDEAL C+EELKSP+++PEVVK+AIS+ LDKSPPCV+PV 
Sbjct  636   PDDLQRKIRALLDEYFIVRLLDEALLCVEELKSPSHHPEVVKEAISIALDKSPPCVEPVW  695

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+F +  + +GC  + +LLDD+A+DLPKAP NFG+IIGRL+LAGG++F +V
Sbjct  696   KLLEYLFSKKVFAARDIATGCLLYGALLDDIAIDLPKAPNNFGEIIGRLILAGGLDFKVV  755

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + DNFY K VF A  + +S +PSG  +LD+ A+ VEAC++L 
Sbjct  756   KEILKKMEDNFYQKAVFDAATKTISLNPSGQGLLDASASEVEACQNLF  803



>gb|KHG05617.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Gossypium 
arboreum]
Length=722

 Score =   224 bits (570),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT ALL+EYFS+RLLDEALQC+EELKSP YYPEVVK+AIS+ L+K PPCV+PV K
Sbjct  556  DELSRKTKALLEEYFSVRLLDEALQCVEELKSPGYYPEVVKEAISIALEKIPPCVEPVSK  615

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYLF KK+  +  +G+GC  + +LLDD+ +DLP+AP NFG+IIG+L LAGG++F++V 
Sbjct  616  LIEYLFIKKVLTARDIGTGCLLYGALLDDIGIDLPQAPNNFGEIIGKLALAGGLDFNVVR  675

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
             ILK + D+ + K VF A MR+VSSSPSG A+L+ QA+ V+ C+SL 
Sbjct  676  GILKKMEDDLFQKAVFDAAMRIVSSSPSGQAVLEEQASEVKVCQSLF  722



>gb|KJB27041.1| hypothetical protein B456_004G273900 [Gossypium raimondii]
Length=781

 Score =   224 bits (572),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT ALL+EYFS+RLLDEALQC+EELKSP Y+PE VK+AIS+ L+KSPPCV+PV K
Sbjct  615  DELWRKTQALLEEYFSVRLLDEALQCVEELKSPLYHPEFVKEAISIALEKSPPCVEPVSK  674

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF KK+  +  LG+GC  + +LLDD+ +DLPKAP NFG+IIG LVL GG++  ++ 
Sbjct  675  LLEYLFIKKVLTATDLGTGCLLYGALLDDIGIDLPKAPNNFGEIIGTLVLVGGLDIKVLK  734

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            E+LK + D+ Y K VF+A MR++SS+PSG AILD+QA+ VEA ++LL
Sbjct  735  EVLKKMEDDLYKKAVFNATMRIISSNPSGQAILDAQASEVEASQNLL  781



>gb|KDO62267.1| hypothetical protein CISIN_1g0453992mg, partial [Citrus sinensis]
Length=574

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT++LL+EYF+IR+L+EAL C+EELKSP Y+PEVVK+AISL L+K+PPCVDPV K
Sbjct  409  DELCRKTISLLEEYFNIRVLEEALMCVEELKSPGYHPEVVKEAISLALEKNPPCVDPVTK  468

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF +K+  +  +G+GC  F +L+DD+ +DLP+AP NFG+IIG+L+LAGG++F +V 
Sbjct  469  LLEYLFTQKVITARDIGTGCLLFGALMDDVGIDLPRAPNNFGEIIGKLILAGGLDFKVVQ  528

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + +  Y K V  A +R++S SP G  ILDSQA+++EAC+SLL
Sbjct  529  EILKKMEEEMYRKSVLDAALRIISCSP-GQNILDSQASDIEACQSLL  574



>ref|XP_007154871.1| hypothetical protein PHAVU_003G154900g [Phaseolus vulgaris]
 gb|ESW26865.1| hypothetical protein PHAVU_003G154900g [Phaseolus vulgaris]
Length=790

 Score =   222 bits (566),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EEL+RKT +LL+EYFS+RLLDEALQC+EELK+P Y+PEVVK+AISLGLDKSPPCV+PV  
Sbjct  624  EELQRKTSSLLEEYFSVRLLDEALQCVEELKAPTYHPEVVKEAISLGLDKSPPCVEPVGS  683

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYL+ KKI  +  + +GC  F+SLLDD+ +DLPKAP NFG+IIG+LVLAG ++F +V 
Sbjct  684  LIEYLYVKKILSARDIVTGCMLFSSLLDDIGIDLPKAPNNFGEIIGKLVLAGTLDFKMVR  743

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K +FS+ ++V+SS+ SG A+L+SQA+++EAC+SL 
Sbjct  744  EILKKVEDDRFQKTIFSSALQVISSA-SGQAVLESQASDIEACQSLF  789



>ref|XP_007013853.1| MIF4G domain-containing protein / MA3 domain-containing protein 
[Theobroma cacao]
 gb|EOY31472.1| MIF4G domain-containing protein / MA3 domain-containing protein 
[Theobroma cacao]
Length=800

 Score =   222 bits (566),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L+RKT ALL+EYF +RLLDEALQC+EELKSP+Y+PEVVK+AIS+ L+KSP CV+PV +L
Sbjct  635  DLQRKTQALLEEYFGVRLLDEALQCVEELKSPSYHPEVVKEAISIALEKSPSCVEPVSRL  694

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LEYL  KK+     +G+GC  + +LLDD+ +D PKAP NFG+IIG+LV+AGG++F +V E
Sbjct  695  LEYLLIKKVLTPRDIGTGCLLYGALLDDIGIDTPKAPNNFGEIIGKLVMAGGLDFKVVKE  754

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            ILK + D+ Y K VF A MR++SS+PSG A+LD+QA+ VEAC++L
Sbjct  755  ILKKMEDDKYQKAVFDATMRIISSNPSGEALLDAQASEVEACQNL  799



>ref|XP_006474025.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Citrus sinensis]
Length=770

 Score =   221 bits (564),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKT++LL+EYF+IR+L+EAL C+EELKSP Y+PEVVK+AISL L+K+PPCVDPV K
Sbjct  605  DELRRKTISLLEEYFNIRVLEEALMCVEELKSPGYHPEVVKEAISLALEKNPPCVDPVTK  664

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF +K+  +  +G+GC  F +L+DD+ +DLP+AP NFG+IIG+L+LAGG++F +V 
Sbjct  665  LLEYLFTQKVITARDIGTGCLLFGALMDDVGIDLPRAPNNFGEIIGKLILAGGLDFKVVQ  724

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + +  Y K V  A +R++S SP G  ILDSQA+++EAC+SLL
Sbjct  725  EILKKMEEEMYRKSVLDAALRIISCSP-GQNILDSQASDIEACQSLL  770



>ref|XP_002324526.1| MIF4G domain-containing family protein [Populus trichocarpa]
 gb|EEF03091.1| MIF4G domain-containing family protein [Populus trichocarpa]
Length=793

 Score =   221 bits (564),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+ELKRKTV+LL EYFS+ LLDEALQC+EELKSP Y+PEVVK+AI + L+ +PPCV+PV 
Sbjct  626   PDELKRKTVSLLKEYFSVLLLDEALQCVEELKSPGYHPEVVKEAIFIALEANPPCVEPVA  685

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  +  +G+GC  + S+LDD+ +DLPKAP NFG+IIG+LVL GG++F +V
Sbjct  686   KLLEYLFSKKVLTAKDIGTGCLLYGSMLDDIGIDLPKAPNNFGEIIGKLVLVGGLDFKMV  745

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ Y + +F A +RV+ SSP G  +LD+QA+ +EACRSL 
Sbjct  746   IEVLKKMEDDMYRRAMFDAAIRVIISSPDGQLVLDTQASAIEACRSLF  793



>ref|XP_006474024.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Citrus sinensis]
Length=802

 Score =   221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKT++LL+EYF+IR+L+EAL C+EELKSP Y+PEVVK+AISL L+K+PPCVDPV K
Sbjct  637  DELRRKTISLLEEYFNIRVLEEALMCVEELKSPGYHPEVVKEAISLALEKNPPCVDPVTK  696

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF +K+  +  +G+GC  F +L+DD+ +DLP+AP NFG+IIG+L+LAGG++F +V 
Sbjct  697  LLEYLFTQKVITARDIGTGCLLFGALMDDVGIDLPRAPNNFGEIIGKLILAGGLDFKVVQ  756

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + +  Y K V  A +R++S SP G  ILDSQA+++EAC+SLL
Sbjct  757  EILKKMEEEMYRKSVLDAALRIISCSP-GQNILDSQASDIEACQSLL  802



>ref|XP_011018056.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Populus euphratica]
Length=793

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKTV+LL EYFS+ LLDEALQC+EELKSPAY+PEVVK+AI + L+ +PPCV+PV 
Sbjct  626   PDELRRKTVSLLKEYFSVLLLDEALQCVEELKSPAYHPEVVKEAIFIALEANPPCVEPVA  685

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  +  +G+GC  + S+LDD+ +DLPKAP NFG+IIG+LVL GG++F +V
Sbjct  686   KLLEYLFSKKVLTAKDIGTGCLLYGSMLDDIGIDLPKAPNNFGEIIGKLVLVGGLDFKMV  745

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ Y + +F A +RV+ SSP G  +LD+QA+ +EAC+SL 
Sbjct  746   IEVLKKMEDDMYRRAMFDAAIRVIISSPDGQLVLDTQASAIEACQSLF  793



>gb|KCW45237.1| hypothetical protein EUGRSUZ_L01123 [Eucalyptus grandis]
Length=443

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++LKRKT +LL+EYFS+ +LDEALQC+EEL +PAYYPE VK+AISL L+KSPPC +PV K
Sbjct  276  DDLKRKTSSLLEEYFSVLILDEALQCVEELNAPAYYPEFVKEAISLALEKSPPCFEPVGK  335

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             L +L  KK+  S+ +G+GC  +AS+LDD+ +DLPKAP +FG++IG+L L GG++F +V 
Sbjct  336  FLGFLLTKKVISSSDVGTGCLLYASILDDVGIDLPKAPYHFGEVIGKLALVGGLDFKVVQ  395

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ Y K +F   M+ V+S+PSG ++LDSQA  +E C+SLLQ
Sbjct  396  EILKKVEDDRYQKAIFDGAMKNVASTPSGQSVLDSQAQYIEGCKSLLQ  443



>ref|XP_010040415.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like, 
partial [Eucalyptus grandis]
Length=458

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++LKRKT +LL+EYFS+ +LDEALQC+EEL +PAYYPE VK+AISL L+KSPPC +PV K
Sbjct  291  DDLKRKTSSLLEEYFSVLILDEALQCVEELNAPAYYPEFVKEAISLALEKSPPCFEPVGK  350

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             L +L  KK+  S+ +G+GC  +AS+LDD+ +DLPKAP +FG++IG+L L GG++F +V 
Sbjct  351  FLGFLLTKKVISSSDVGTGCLLYASILDDVGIDLPKAPYHFGEVIGKLALVGGLDFKVVQ  410

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ Y K +F   M+ V+S+PSG ++LDSQA  +E C+SLLQ
Sbjct  411  EILKKVEDDRYQKAIFDGAMKNVASTPSGQSVLDSQAQYIEGCKSLLQ  458



>ref|XP_010525785.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2 
isoform X2 [Tarenaya hassleriana]
 ref|XP_010525786.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2 
isoform X3 [Tarenaya hassleriana]
Length=758

 Score =   218 bits (556),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++LL+E+FS+R+LDEALQC+EELKSP+Y+PE+ K+AISLGL+K+PPCV+PV 
Sbjct  590   PDELRRKTISLLEEFFSVRILDEALQCVEELKSPSYHPELAKEAISLGLEKNPPCVEPVT  649

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL +L  K +     LG+GC  + S+LDD+ +DLPKAP NFG+I+GRL+LA G +F +V
Sbjct  650   KLLGHLLAKNVLTPKDLGTGCLLYGSMLDDIGIDLPKAPNNFGEILGRLILAKGTDFELV  709

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
              EILK + D+F+ K VF A++R V  +  G ++LDSQAT +EACR+L
Sbjct  710   KEILKKMEDDFFRKAVFEAVLRNVKENELGQSLLDSQATELEACRNL  756



>ref|XP_010525784.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2 
isoform X1 [Tarenaya hassleriana]
Length=768

 Score =   218 bits (556),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++LL+E+FS+R+LDEALQC+EELKSP+Y+PE+ K+AISLGL+K+PPCV+PV 
Sbjct  600   PDELRRKTISLLEEFFSVRILDEALQCVEELKSPSYHPELAKEAISLGLEKNPPCVEPVT  659

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL +L  K +     LG+GC  + S+LDD+ +DLPKAP NFG+I+GRL+LA G +F +V
Sbjct  660   KLLGHLLAKNVLTPKDLGTGCLLYGSMLDDIGIDLPKAPNNFGEILGRLILAKGTDFELV  719

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
              EILK + D+F+ K VF A++R V  +  G ++LDSQAT +EACR+L
Sbjct  720   KEILKKMEDDFFRKAVFEAVLRNVKENELGQSLLDSQATELEACRNL  766



>emb|CDP02830.1| unnamed protein product [Coffea canephora]
Length=799

 Score =   217 bits (552),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKT++LL+EYFS++LL+EAL C+E+LKSPAYY E+VK+A+S+GL+KSPPCV+ V K
Sbjct  632  DELRRKTISLLEEYFSVQLLEEALACVEDLKSPAYYSEIVKEALSVGLEKSPPCVELVAK  691

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEY F KK+F ++ +  G Q++A +LDDLA+DLP+AP NFG+I+GR +LAG ++F +V+
Sbjct  692  LLEYFFTKKVFTASDITLGFQRYAEMLDDLAIDLPRAPANFGEIVGRSILAGELDFKVVS  751

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+++ K +F++ ++VVSSSP+G  ILDSQA ++ AC +L Q
Sbjct  752  EILKKVTDDYFQKAIFTSTLKVVSSSPNGKLILDSQALDIRACEALFQ  799



>ref|XP_008384281.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor isoform 4G-1-like [Malus domestica]
Length=814

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKT++L +EYF+I LLDEAL C+EEL+SPAY+PEVVK+ I+L L+KS PCV+P+ K
Sbjct  648  DELRRKTISLFEEYFNIGLLDEALLCVEELQSPAYHPEVVKEGIALALEKSQPCVEPLXK  707

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF KK+  ++ + SGC  +AS+L+D+ +DLPKAP+NFG IIG+LVL GG++F +V 
Sbjct  708  LLEYLFSKKVLTTSDVRSGCLLYASILNDVGIDLPKAPSNFGQIIGKLVLVGGLDFKVVK  767

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            E+LK + D+++ K +  A ++VVSSSPSG  +LDSQA++++ACRSL 
Sbjct  768  EVLKAVDDDYFQKAILDAALKVVSSSPSGQGLLDSQASDIDACRSLF  814



>ref|XP_002309358.1| MIF4G domain-containing family protein [Populus trichocarpa]
 gb|EEE92881.1| MIF4G domain-containing family protein [Populus trichocarpa]
Length=798

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++LL EYFS+ LLDEALQC+EELKSPAY+PEVVK+AIS+ L+ +PP V+PV 
Sbjct  631   PDELRRKTLSLLKEYFSVLLLDEALQCVEELKSPAYHPEVVKEAISIALEANPPRVEPVS  690

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+     +G+GC  + S+LDD+ +DLPKAP NFG+I G+LVL GG++F +V
Sbjct  691   KLLEYLFAKKVITVKDIGTGCLLYGSMLDDIGIDLPKAPYNFGEITGKLVLVGGLDFKVV  750

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ Y + VF A  R++SSSP G  +LD+QA++++AC+SL 
Sbjct  751   IEVLKKMEDDMYQRAVFDAATRIISSSPDGQLVLDTQASDIKACQSLF  798



>ref|XP_009366204.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Pyrus x bretschneideri]
Length=813

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++L +EYF+I LLDEAL C+EEL+SPAY+ EVVK+ I+L L+KS PCV+P+V
Sbjct  642   PDELRRKTISLFEEYFNIGLLDEALLCVEELQSPAYHAEVVKEGIALALEKSRPCVEPLV  701

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  ++ + SGC  +AS+L+D+ +DLPKAP+NFG IIG+LVL GG++F +V
Sbjct  702   KLLEYLFSKKVLTTSDVRSGCLLYASILNDVGIDLPKAPSNFGQIIGKLVLVGGLDFKVV  761

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D ++ K ++ A +++VSSSPSG  +LDSQA++++ACRSL 
Sbjct  762   KEVLKAVDDYYFQKAIWDAALKIVSSSPSGQGLLDSQASDIDACRSLF  809



>ref|XP_009366203.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Pyrus x bretschneideri]
Length=843

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++L +EYF+I LLDEAL C+EEL+SPAY+ EVVK+ I+L L+KS PCV+P+V
Sbjct  672   PDELRRKTISLFEEYFNIGLLDEALLCVEELQSPAYHAEVVKEGIALALEKSRPCVEPLV  731

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+  ++ + SGC  +AS+L+D+ +DLPKAP+NFG IIG+LVL GG++F +V
Sbjct  732   KLLEYLFSKKVLTTSDVRSGCLLYASILNDVGIDLPKAPSNFGQIIGKLVLVGGLDFKVV  791

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D ++ K ++ A +++VSSSPSG  +LDSQA++++ACRSL 
Sbjct  792   KEVLKAVDDYYFQKAIWDAALKIVSSSPSGQGLLDSQASDIDACRSLF  839



>ref|XP_010047063.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Eucalyptus grandis]
 gb|KCW78818.1| hypothetical protein EUGRSUZ_C00248 [Eucalyptus grandis]
Length=800

 Score =   214 bits (545),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++LKRKT +LL+EYFS+ +LDEALQC+EEL +PAYYPE VK+AISL L+KSPPC +PV K
Sbjct  633  DDLKRKTSSLLEEYFSVLILDEALQCVEELNAPAYYPEFVKEAISLALEKSPPCFEPVGK  692

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  KK+  S+ +G+GC  +AS+LDD+ +DLPKAP +FG++IG+L L GG++F +V 
Sbjct  693  LLGFLLTKKVISSSDVGTGCLLYASILDDVGIDLPKAPYHFGEVIGKLALVGGLDFKVVQ  752

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ Y K +F   M+ V+S+PSG ++LDSQA  +E C+SLLQ
Sbjct  753  EILKKVEDDRYQKAIFDGAMKNVASTPSGQSVLDSQAQYIEGCKSLLQ  800



>ref|XP_004287143.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Fragaria vesca subsp. vesca]
Length=774

 Score =   213 bits (543),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL++KTV+LL+EYFS+R+LDEAL C+EEL SPAY+PEVVK+AISL L+KS  CV+P+VK
Sbjct  608  DELRKKTVSLLEEYFSVRILDEALLCVEELNSPAYHPEVVKEAISLALEKSTSCVEPLVK  667

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLE+LF KK+F ++ + SGC  +ASLL D+ +DLPKAP+ FG+++ +L+L G ++F  V 
Sbjct  668  LLEHLFSKKVFTASDIRSGCLLYASLLSDICIDLPKAPSYFGEVLAKLILVGALDFKAVK  727

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D++Y K +F+A ++++ SSPSG A+LDSQA+++EACRSL 
Sbjct  728  EILKEVDDDYYQKAIFNAGLQIIDSSPSGQAVLDSQASDIEACRSLF  774



>ref|XP_008220656.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Prunus mume]
Length=754

 Score =   213 bits (542),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 132/165 (80%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L RKTV+LL+EYFS+R+LDEALQC+EELK+PAY+PEVVK+AI++ L+K PPCV+PV+KLL
Sbjct  589  LHRKTVSLLEEYFSVRILDEALQCVEELKAPAYHPEVVKEAIAVALEKIPPCVEPVIKLL  648

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+LF KK+  S  +G+GC  + S+LDD+ +DLPKAPTNFGD+IG+L LAG ++F +V +I
Sbjct  649  EFLFNKKVVTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGDVIGKLALAGVLDFKVVTQI  708

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F A  + ++SSPSG   L +Q T V+AC +LL
Sbjct  709  LKKVEDDMFRTAIFGAAKKSITSSPSGQEFLANQETEVQACETLL  753



>ref|XP_007138423.1| hypothetical protein PHAVU_009G207600g [Phaseolus vulgaris]
 gb|ESW10417.1| hypothetical protein PHAVU_009G207600g [Phaseolus vulgaris]
Length=760

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKT++LL EYFS+RLLDEALQC+EELKSP++YPEVVK+AI L LDKSPPCV+PV  
Sbjct  593  DDLRRKTISLLQEYFSVRLLDEALQCVEELKSPSFYPEVVKEAICLALDKSPPCVEPVAN  652

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYL+ KKI  +  + +GC  F SLLDD+ +DLPK+P+NFG IIG+L+LAGG++F +  
Sbjct  653  LMEYLYIKKILTAIDIEAGCLLFGSLLDDIGIDLPKSPSNFGMIIGKLILAGGLDFKVAR  712

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ + +++F + +  + SS SG A+LD Q ++++AC+SLL+
Sbjct  713  EILKKVEDDMFQREIFDSAVGAIKSSASGQAVLDLQTSDIKACQSLLK  760



>ref|XP_007204278.1| hypothetical protein PRUPE_ppa001554mg [Prunus persica]
 gb|EMJ05477.1| hypothetical protein PRUPE_ppa001554mg [Prunus persica]
Length=803

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  981  TVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLF  802
            TV+LL+EYFS+ LLDEAL C+EEL+SPAY+PEVVK+AIS  L+KS PCV+ +VKLLEYLF
Sbjct  643  TVSLLEEYFSVELLDEALLCVEELRSPAYHPEVVKEAISFALEKSRPCVESLVKLLEYLF  702

Query  801  EKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNI  622
             KK+F ++ + SGC  +AS+L+D+ +DLPKAP+NFG++IG+L+L GG++F +V E+LK +
Sbjct  703  SKKVFTASDIRSGCLLYASILNDVGIDLPKAPSNFGEVIGKLILVGGLDFKVVKEVLKEV  762

Query  621  GDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
             D+++ + +  A ++VVSSSPSG  +LDSQA++++ACRSL 
Sbjct  763  DDDYFQRAILEAGLKVVSSSPSGQGVLDSQASDIDACRSLF  803



>ref|XP_006453585.1| hypothetical protein CICLE_v10007494mg [Citrus clementina]
 gb|ESR66825.1| hypothetical protein CICLE_v10007494mg [Citrus clementina]
Length=613

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT++LL+EYF+IR+L+EAL C+EELKSP Y+PEVVK+AISL L+K+PPCVD V K
Sbjct  448  DELCRKTISLLEEYFNIRVLEEALMCVEELKSPGYHPEVVKEAISLALEKNPPCVDLVTK  507

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  +K+  +  + +GC  F +L+DD+ +DLP+AP NFG+IIG+L+LAGG++F +V 
Sbjct  508  LLEYLLTQKVITARDIWTGCLLFGALMDDVGIDLPRAPHNFGEIIGKLILAGGLDFKVVQ  567

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + +  Y K V  A +R++S SP G  ILDSQA+++EAC+SLL
Sbjct  568  EILKKMEEEMYRKSVLDAALRIISCSP-GQNILDSQASDIEACQSLL  613



>ref|XP_002285559.2| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Vitis vinifera]
Length=791

 Score =   211 bits (537),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L+RKTV+LL+EYFS+R+LDEALQC+EELKSPAY+PEVVK+A+SL L+KSPPCV+PV+
Sbjct  623   PVDLRRKTVSLLEEYFSVRILDEALQCVEELKSPAYHPEVVKEAVSLALEKSPPCVEPVI  682

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL YLF K +  +  LG+GC  + SLLDD+ +DLPKAP NFG+++G+LVLAGG++F +V
Sbjct  683   KLLVYLFNKNVLLARDLGTGCLLYGSLLDDVGIDLPKAPNNFGEVLGKLVLAGGLDFKVV  742

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+L+ + D+ +   +F A+M  +SS P G  +++    +++ C+SLL
Sbjct  743   KEVLEKVEDDRFQAAIFDAVMSGISSDPLGQGLMEKHRLDIQDCKSLL  790



>ref|XP_010047062.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Eucalyptus grandis]
 gb|KCW78817.1| hypothetical protein EUGRSUZ_C00247 [Eucalyptus grandis]
Length=815

 Score =   211 bits (537),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT +LL+EYFS+ LLDEALQC+ EL +PAYYPE VK+AISL L+KSPPC +PV K
Sbjct  648  DELTRKTKSLLEEYFSVLLLDEALQCVVELNAPAYYPEFVKEAISLALEKSPPCFEPVGK  707

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  KK+  S+ +G+GC  FAS+LDDLA+DLPKAP +FG+I+G+LVLAGG++F ++ 
Sbjct  708  LLGFLLTKKVISSSDVGTGCLLFASMLDDLAIDLPKAPVHFGEIVGKLVLAGGLDFKVIK  767

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ +   +  A+M++V+S  SG A+L SQA+++E C+ LLQ
Sbjct  768  EILKKVEDDRFQNAILDAVMKIVTSDASGQAVLSSQASDIEECKGLLQ  815



>emb|CBI21151.3| unnamed protein product [Vitis vinifera]
Length=836

 Score =   211 bits (536),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L+RKTV+LL+EYFS+R+LDEALQC+EELKSPAY+PEVVK+A+SL L+KSPPCV+PV+
Sbjct  668   PVDLRRKTVSLLEEYFSVRILDEALQCVEELKSPAYHPEVVKEAVSLALEKSPPCVEPVI  727

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL YLF K +  +  LG+GC  + SLLDD+ +DLPKAP NFG+++G+LVLAGG++F +V
Sbjct  728   KLLVYLFNKNVLLARDLGTGCLLYGSLLDDVGIDLPKAPNNFGEVLGKLVLAGGLDFKVV  787

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+L+ + D+ +   +F A+M  +SS P G  +++    +++ C+SLL
Sbjct  788   KEVLEKVEDDRFQAAIFDAVMSGISSDPLGQGLMEKHRLDIQDCKSLL  835



>ref|XP_008243017.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Prunus mume]
Length=803

 Score =   210 bits (535),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = -2

Query  981  TVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLF  802
            TV+LL+EYFS+ LLDEAL C+EEL+SPAY+PEVVK+AISL L+KS PCV+ +VKLLEYLF
Sbjct  643  TVSLLEEYFSVGLLDEALLCVEELRSPAYHPEVVKEAISLALEKSRPCVESLVKLLEYLF  702

Query  801  EKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNI  622
             KK+F ++ + SGC  +AS+L+D+ +DLPKAP+NFG++IG+L+L GG++F +V E+LK +
Sbjct  703  SKKVFTASDIRSGCLLYASILNDVGIDLPKAPSNFGEVIGKLILVGGLDFKVVKEVLKEV  762

Query  621  GDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
             D+++ + +  A ++VVSSSPSG  +LDSQ ++++ACRSL 
Sbjct  763  DDDYFQRAILEAGLKVVSSSPSGQGVLDSQVSDIDACRSLF  803



>ref|XP_008384241.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Malus domestica]
 ref|XP_008354323.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Malus domestica]
Length=814

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKT++L +EYFSI LLDEAL C+EEL+SPAY+PEVVK+ I+L L+KS PCV+P+VK
Sbjct  648  DELRRKTISLFEEYFSIGLLDEALLCVEELQSPAYHPEVVKEGITLALEKSRPCVEPLVK  707

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLE LF KK+  ++ +  GC  +AS+L+D+ +DLPKAPTNFG+IIG+LVL GG++F +V 
Sbjct  708  LLEXLFSKKVLTTSDIRRGCLLYASILNDVGIDLPKAPTNFGEIIGKLVLVGGLDFKVVK  767

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            ++LK + D+++ K +    ++VVSSSPSG  +L+SQA++++ACR L 
Sbjct  768  DVLKGVDDDYFQKAILDGAVKVVSSSPSGQGLLESQASDIDACRXLF  814



>ref|XP_004976117.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Setaria italica]
Length=783

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL++KTV+LL+EYF IR+LDEA QCIEEL+SP YYPE+VK+AI+L LDK    VDP+V+L
Sbjct  617  ELQKKTVSLLEEYFGIRILDEAQQCIEELQSPGYYPEIVKEAINLALDKGTNFVDPLVRL  676

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ KKIF +  L +GC  + +LLDD+ +DLPKAPT FG+II RL L+GG+ F  V E
Sbjct  677  LEHLYTKKIFKTQDLETGCLLYGALLDDIGIDLPKAPTQFGEIIARLTLSGGLRFEAVEE  736

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
             LK + D FY K VF+A+M+ + ++PSG AIL S A  V++C+SLL+
Sbjct  737  TLKKMEDTFYRKAVFNAVMKTMEANPSGQAILGSHAAVVDSCKSLLE  783



>gb|KFK41363.1| hypothetical protein AALP_AA2G120200 [Arabis alpina]
Length=696

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFS+RLLDEALQC+EELKSP+Y+ E+VK+A+SLGL+K+PPCV+PV K 
Sbjct  531  ELERKTKSLLEEYFSVRLLDEALQCVEELKSPSYHSELVKEAVSLGLEKNPPCVEPVAKF  590

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     LG+GC  ++S+LDD+ +DLPKAP +FG+I+G+LV A  ++F +V E
Sbjct  591  LEHLISKNVLTCKDLGTGCLLYSSMLDDIGIDLPKAPNSFGEILGKLVSAKVLDFELVRE  650

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + D ++ K V  A+++ VS SPSG A+L SQA  VEACRSLL
Sbjct  651  VLKKMEDEWFRKTVLDAVIKCVSESPSGQALLVSQAAEVEACRSLL  696



>ref|XP_011033390.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Populus euphratica]
Length=798

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL+RKT++LL EYFS+ LLDEALQC+EELKSPAY+PEVVK+AIS+ L+ +PP V+PV 
Sbjct  631   PDELRRKTLSLLKEYFSVLLLDEALQCVEELKSPAYHPEVVKEAISIALEANPPRVEPVS  690

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+     +G+GC  + S LDD+ +DLPKAP NFG+I G+LVL GG++F +V
Sbjct  691   KLLEYLFAKKVITVEDIGTGCLLYGSKLDDIGIDLPKAPYNFGEITGKLVLVGGLDFKVV  750

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + DN Y + VF A   V+SSSP G  +LD+ A++++AC+SL 
Sbjct  751   IEVLKKMEDNMYQRAVFDAAKSVISSSPDGQLVLDTLASDIKACQSLF  798



>ref|XP_002309681.1| hypothetical protein POPTR_0006s28110g [Populus trichocarpa]
 gb|EEE93204.1| hypothetical protein POPTR_0006s28110g [Populus trichocarpa]
Length=766

 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PE+L+RKT++LL+EYFS+R+LDEALQC+EELK PA++PEV K+AI+L L+KSPPCV PV+
Sbjct  598   PEDLRRKTISLLEEYFSVRILDEALQCVEELKDPAFHPEVAKEAIALALEKSPPCVGPVI  657

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+I+G LV+  G++F ++
Sbjct  658   KLLEFLLTKNVITARDIGTGCLLYGSLLDDIGIDLPKAPNNFGEILGNLVVVQGLDFEVM  717

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+L+ + DN + K +F   M+ ++S+PSG  +L +Q +N++AC SL 
Sbjct  718   KELLEKVEDNRFRKAIFDCAMKSINSNPSGQEVLATQGSNIQACESLF  765



>gb|KDO67424.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis]
Length=526

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L++KTV+LL+EYFSIR+LDEALQC+EEL++P Y+PEVVK+AI+L L+K PPCV+PV++L
Sbjct  360  DLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQL  419

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+++G+LV+A  ++F ++ E
Sbjct  420  LEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKE  479

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + DN + + +F+A M+ + SSP+G  +L  Q   V+AC SLL
Sbjct  480  VLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLL  525



>ref|XP_006453584.1| hypothetical protein CICLE_v10007494mg [Citrus clementina]
 gb|ESR66824.1| hypothetical protein CICLE_v10007494mg [Citrus clementina]
Length=802

 Score =   208 bits (530),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT++LL+EYF+IR+L+EAL C+EELKSP Y+PEVVK+AISL L+K+PPCVD V K
Sbjct  637  DELCRKTISLLEEYFNIRVLEEALMCVEELKSPGYHPEVVKEAISLALEKNPPCVDLVTK  696

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  +K+  +  + +GC  F +L+DD+ +DLP+AP NFG+IIG+L+LAGG++F +V 
Sbjct  697  LLEYLLTQKVITARDIWTGCLLFGALMDDVGIDLPRAPHNFGEIIGKLILAGGLDFKVVQ  756

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + +  Y K V  A +R++S SP G  ILDSQA+++EAC+SLL
Sbjct  757  EILKKMEEEMYRKSVLDAALRIISCSP-GQNILDSQASDIEACQSLL  802



>ref|XP_004513079.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like, 
partial [Cicer arietinum]
Length=189

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L RKT +LL+EYF+IRLLDEALQC++ELK+PAYYPE VK+AISLGLDKSPPCV+PV  
Sbjct  38   DDLHRKTASLLEEYFNIRLLDEALQCVDELKAPAYYPEFVKEAISLGLDKSPPCVEPVAN  97

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+E+LF KKI  +  +G+GC  FASLLDD+ +DLPKAP+NFG+IIG+L+LAGG++F +V 
Sbjct  98   LIEHLFIKKILSARDIGTGCLLFASLLDDIGIDLPKAPSNFGEIIGKLILAGGLDFKVVI  157

Query  639  EILKNIGDNFYLKDVFSA  586
            EILK + D+++ K +F++
Sbjct  158  EILKKVSDDYFQKTIFNS  175



>ref|XP_010929170.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Elaeis guineensis]
Length=800

 Score =   207 bits (528),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL +KTVALL+EYF +R+L EALQC+EELKSP Y+PEVVK+AI+L LDK P C+DPVV
Sbjct  632   PNELHKKTVALLEEYFHVRILAEALQCVEELKSPEYHPEVVKEAINLALDKGPNCIDPVV  691

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+     LG+GC  + S LDD+ +DLPKAPT FG++IG L+LAGG+ F +V
Sbjct  692   RLLEFLFVKKVITPKDLGTGCLLYGSTLDDIGIDLPKAPTYFGEVIGELILAGGMCFQVV  751

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + D+ +   +F A+M+ + + PSG A+L SQA  + AC+++L
Sbjct  752   EEILKKVEDSRFRSVMFDAVMKRIEAKPSGQAVLGSQAAYITACKNVL  799



>ref|XP_010905020.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2 
[Elaeis guineensis]
Length=795

 Score =   207 bits (528),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +KTV+LL+EYF +R+LDEALQC+EELKSP Y+PEVVK+AI+L LDK P C++PVV+L
Sbjct  629  ELHKKTVSLLEEYFHVRILDEALQCVEELKSPEYHPEVVKEAINLALDKVPNCINPVVRL  688

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+LF K++     LG+GC  + ++LDD+ +DLPKAPT+FG++IG+L+LAGG+ F +V E
Sbjct  689  LEHLFVKEVITPKDLGTGCLLYGTMLDDIGIDLPKAPTHFGEVIGKLILAGGLGFKVVEE  748

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            ILK + D  +   +F  +M+ + ++PSG A+L SQA ++ AC+ LL
Sbjct  749  ILKKVEDGRFRSAMFDEVMKSIEANPSGRALLGSQAADIGACKELL  794



>ref|XP_002448124.1| hypothetical protein SORBIDRAFT_06g021600 [Sorghum bicolor]
 gb|EES12452.1| hypothetical protein SORBIDRAFT_06g021600 [Sorghum bicolor]
Length=791

 Score =   207 bits (527),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL++KT+ALL+EYF IR+LDEA QCIEEL+SP YYPE+VK+A++L LDK    VDP+++L
Sbjct  625  ELQKKTIALLEEYFGIRILDEAQQCIEELQSPGYYPEIVKEAVNLALDKGTNFVDPLIRL  684

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ KKIF +  L +GC  + +LLDD+ +DLPKAPT FG+II RL L G + F  V E
Sbjct  685  LEHLYTKKIFKTQDLEAGCLLYGALLDDIGIDLPKAPTQFGEIIARLTLLGALRFEAVEE  744

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +LK + D FY K VF+A+M+ + ++PSG AIL SQA  ++AC SLL+
Sbjct  745  VLKKMEDTFYRKQVFNAVMKTLEANPSGQAILGSQAAVIDACNSLLK  791



>ref|XP_003522928.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Glycine max]
 gb|KHN37189.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Glycine soja]
Length=774

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            + L+ +TV+LL+EYFS++LL+EALQC+EELKSP+Y+PEVVK+AISL LDKSPPCV+PV  
Sbjct  608  DNLRCRTVSLLEEYFSVQLLEEALQCVEELKSPSYHPEVVKEAISLALDKSPPCVEPVAN  667

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYL+ KKI     +G+GC  F SLLDD+ +DLPKAP+NFG+IIG+L+LAGG++  +V 
Sbjct  668  LIEYLYIKKILTPIDIGTGCLLFGSLLDDIGIDLPKAPSNFGEIIGKLILAGGLDCKLVR  727

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D  + + +F +++  + S+ SG A+LD+Q +++EAC+S+L+
Sbjct  728  EILKKVDDGMFQRAIFDSVVGAIRSA-SGQAVLDAQTSDIEACQSMLK  774



>ref|XP_009396249.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2 
[Musa acuminata subsp. malaccensis]
Length=782

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL +KTVALL+EYF IR+LDEALQC+EELKSP Y+PEVVK+AI++ LDK   C++P+V
Sbjct  614   PNELHKKTVALLEEYFHIRILDEALQCVEELKSPEYHPEVVKEAINIALDKGVSCLEPLV  673

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
              LLEYL  KK+F    LG+GC  + ++LDD+++DLPKAPT FG+++G+LVL GG++F +V
Sbjct  674   NLLEYLLVKKVFTPRDLGTGCLLYGAMLDDISIDLPKAPTYFGEVVGKLVLIGGVDFKVV  733

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + +  +   VF A+MRV+ S P+G A+L +QA  ++AC  L+
Sbjct  734   EEILKKVEEASFQSAVFDAVMRVIKSGPNGEAVLGTQAAEIKACEKLV  781



>ref|XP_011031436.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Populus euphratica]
Length=766

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P++L+RKT++LL+EYFS+++LDEALQC+EELK PA++PEV K+AI+L L+KSPPCV PV+
Sbjct  598   PDDLRRKTISLLEEYFSVQILDEALQCVEELKDPAFHPEVAKEAIALALEKSPPCVGPVI  657

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+I+G LV+  G++F +V
Sbjct  658   KLLEFLLTKNVLTARDIGTGCLLYGSLLDDIGIDLPKAPNNFGEILGNLVVVQGLDFKVV  717

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+L+ + DN + K +F   M+ ++S+PSG  +L +Q +N++AC SL+
Sbjct  718   KELLEKVEDNRFRKAIFDCAMKSINSNPSGQEVLATQGSNIQACESLV  765



>gb|KDO67422.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis]
 gb|KDO67423.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis]
Length=630

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L++KTV+LL+EYFSIR+LDEALQC+EEL++P Y+PEVVK+AI+L L+K PPCV+PV++L
Sbjct  464  DLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQL  523

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+++G+LV+A  ++F ++ E
Sbjct  524  LEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKE  583

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + DN + + +F+A M+ + SSP+G  +L  Q   V+AC SLL
Sbjct  584  VLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLL  629



>ref|XP_006404902.1| hypothetical protein EUTSA_v10000058mg [Eutrema salsugineum]
 gb|ESQ46355.1| hypothetical protein EUTSA_v10000058mg [Eutrema salsugineum]
Length=747

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFS+RLLDEALQC+EELKSP+Y+PE+VK+A+SLGL+K+PP V+PV KL
Sbjct  582  ELERKTKSLLEEYFSVRLLDEALQCVEELKSPSYHPELVKEAVSLGLEKNPPFVEPVAKL  641

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     L  GC  + S+LDD+ +DLPKAP +FG+I+G+LV A  ++F +V E
Sbjct  642  LEHLISKNVLTCKDLRMGCLLYGSMLDDIGIDLPKAPNSFGEILGKLVSAKVLDFELVKE  701

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + D ++ K V  A++++V+ SPSG ++LDSQA  VEACRSLL
Sbjct  702  VLKKMEDEWFKKTVIDAVIKIVNESPSGQSLLDSQAAEVEACRSLL  747



>ref|XP_010927940.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   206 bits (523),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L RKTVALL+EYF IR+LDEALQC++ELKSP Y+PEVVK+AISL LDK   CVD VV
Sbjct  561   PNQLHRKTVALLEEYFHIRILDEALQCVKELKSPEYHPEVVKEAISLALDKGQSCVDLVV  620

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE L  +K+F    LG+GC  + ++LDD+A+DLPKAPT FG+++G+L+ AGG+ F++V
Sbjct  621   KLLESLLAQKVFTPGDLGTGCLLYGAMLDDVAIDLPKAPTYFGEVVGKLIPAGGLGFNVV  680

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILKN+ D+ +   +F A+M+ +   P+G A+L   A +++AC+SLL
Sbjct  681   EEILKNVEDSGFQSAMFDAVMKTIERGPNGQAVLGGLAADIKACKSLL  728



>ref|XP_008443845.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Cucumis melo]
Length=800

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++LK+KT++LL+EYFSIRLLDEALQC+EEL SPAY+PEVVK+AISL L+KSPPCV+ VVK
Sbjct  633  DDLKKKTLSLLEEYFSIRLLDEALQCVEELMSPAYHPEVVKEAISLALEKSPPCVEAVVK  692

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             L+YL  KK+F +  + +GC  +AS+L D  +DLPKAP NFG+IIG+LVL+  ++F +V 
Sbjct  693  FLDYLLSKKVFTTGDIETGCLGYASMLHDAGIDLPKAPINFGEIIGKLVLSRCLDFQVVK  752

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E +K + D+ + KDVF A+++ + S+ SG  +LDS A+++E CRSL
Sbjct  753  EAIKKVEDDRFRKDVFDAVLQTIRSNMSGQGLLDSLASDIEECRSL  798



>ref|XP_010687620.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Beta vulgaris subsp. vulgaris]
Length=782

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 134/168 (80%), Gaps = 5/168 (3%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELKRKT++LL+EYF++RLLDEAL C+EELKSP+YY E+V++AI+LGL+K+PPC + V 
Sbjct  620   PEELKRKTISLLEEYFNVRLLDEALICVEELKSPSYYSEIVREAINLGLEKNPPCAEQVA  679

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYLF KK+F +  + +GC  +  ++DD+A+DLPKAP NFG+I+G+L+LA  +NFS+V
Sbjct  680   KLLEYLFAKKVFTATDITTGCLLYGQMMDDIAIDLPKAPNNFGEILGKLILAEALNFSVV  739

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EIL+ + D +  K +F A +RV     +G A+L++Q  +VEAC+++L
Sbjct  740   KEILQKVEDEYSRKPIFDATVRV-----AGPAVLEAQTADVEACKAIL  782



>ref|XP_004146671.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Cucumis sativus]
 gb|KGN65177.1| hypothetical protein Csa_1G257340 [Cucumis sativus]
Length=799

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++LK+KT++LL+EYFSIR LDEALQC+EEL SPAY+PEVVK+AISL L++SPPCV+ VVK
Sbjct  632  DDLKKKTLSLLEEYFSIRFLDEALQCVEELMSPAYHPEVVKEAISLALEESPPCVEAVVK  691

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             L+YLF KK+F ++ + +GC  +AS+L D  +DLPKAP NFG+IIG+LVL+  ++F +V 
Sbjct  692  FLDYLFSKKVFTTSDIETGCLGYASMLHDAGIDLPKAPINFGEIIGKLVLSRCLDFQVVK  751

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E +K + D+ + KDVF  +++ +SS+ SG  +LDS A+++E CRSL
Sbjct  752  EAIKKVEDDRFRKDVFDGVLQTISSNVSGRGLLDSLASDIEDCRSL  797



>gb|KDO67421.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis]
Length=776

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L++KTV+LL+EYFSIR+LDEALQC+EEL++P Y+PEVVK+AI+L L+K PPCV+PV++L
Sbjct  610  DLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQL  669

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+++G+LV+A  ++F ++ E
Sbjct  670  LEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKE  729

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + DN + + +F+A M+ + SSP+G  +L  Q   V+AC SLL
Sbjct  730  VLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLL  775



>gb|KDO67419.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis]
Length=811

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L++KTV+LL+EYFSIR+LDEALQC+EEL++P Y+PEVVK+AI+L L+K PPCV+PV++L
Sbjct  645  DLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQL  704

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+++G+LV+A  ++F ++ E
Sbjct  705  LEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKE  764

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + DN + + +F+A M+ + SSP+G  +L  Q   V+AC SLL
Sbjct  765  VLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLL  810



>ref|XP_006483537.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Citrus sinensis]
 gb|KDO67420.1| hypothetical protein CISIN_1g003543mg [Citrus sinensis]
Length=777

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L++KTV+LL+EYFSIR+LDEALQC+EEL++P Y+PEVVK+AI+L L+K PPCV+PV++L
Sbjct  611  DLRKKTVSLLEEYFSIRILDEALQCVEELRAPTYHPEVVKEAIALALEKIPPCVEPVIQL  670

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +  +  +G+GC  + SLLDD+ +DLPKAP NFG+++G+LV+A  ++F ++ E
Sbjct  671  LEFLLNKNVLTTRDIGTGCLLYGSLLDDIGIDLPKAPNNFGEMVGKLVVAKSLDFIVLKE  730

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + DN + + +F+A M+ + SSP+G  +L  Q   V+AC SLL
Sbjct  731  VLKKVEDNMFRRSIFTAAMKSIQSSPAGQEVLAVQGAEVQACESLL  776



>ref|XP_010904622.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Elaeis guineensis]
Length=792

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P+EL +KTVALL+EYF IR+LDEALQC++ELKSP Y+PEVVK+AI+L LDK   CVD VV
Sbjct  624   PKELHKKTVALLEEYFHIRILDEALQCVKELKSPEYHPEVVKEAINLALDKGQSCVDLVV  683

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYL   K+     LG+GC  + ++LDD+ +DLPKAPT FG+++G+L+L+GG++F +V
Sbjct  684   QLLEYLLASKVLTPRDLGTGCSLYGAMLDDVGIDLPKAPTYFGEVVGKLILSGGLSFKVV  743

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + D+ +   +F A+M+ + +S +G A+L SQAT+++AC SLL
Sbjct  744   EEILKKVEDSRFQSAMFDAVMKTIKASLNGQAVLGSQATDIKACESLL  791



>ref|XP_010927939.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Elaeis guineensis]
Length=784

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L RKTVALL+EYF IR+LDEALQC++ELKSP Y+PEVVK+AISL LDK   CVD VV
Sbjct  616   PNQLHRKTVALLEEYFHIRILDEALQCVKELKSPEYHPEVVKEAISLALDKGQSCVDLVV  675

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE L  +K+F    LG+GC  + ++LDD+A+DLPKAPT FG+++G+L+ AGG+ F++V
Sbjct  676   KLLESLLAQKVFTPGDLGTGCLLYGAMLDDVAIDLPKAPTYFGEVVGKLIPAGGLGFNVV  735

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILKN+ D+ +   +F A+M+ +   P+G A+L   A +++AC+SLL
Sbjct  736   EEILKNVEDSGFQSAMFDAVMKTIERGPNGQAVLGGLAADIKACKSLL  783



>ref|XP_002324920.2| hypothetical protein POPTR_0018s02700g [Populus trichocarpa]
 gb|EEF03485.2| hypothetical protein POPTR_0018s02700g [Populus trichocarpa]
Length=750

 Score =   204 bits (520),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P++L+RKT++LL+EYFS+R+LDEALQC+EELK  +++PEV K+AI+L L+KSPPCV+PVV
Sbjct  582   PDDLRRKTISLLEEYFSVRILDEALQCVEELKDTSFHPEVAKEAIALALEKSPPCVEPVV  641

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  K +  +  +G+GC  + S LDD+ +DLPKAP NFG+I+G LV+A G++F + 
Sbjct  642   KLLEFLLTKNVLTARDIGTGCVLYGSSLDDIGIDLPKAPNNFGEILGSLVVAQGLDFEVF  701

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ + K +FS+ M  ++S+PSG  +L +Q +N++AC SLL
Sbjct  702   KEVLKKVEDDRFRKAIFSSAMLSINSNPSGQEVLATQGSNIQACESLL  749



>gb|EYU35354.1| hypothetical protein MIMGU_mgv1a001641mg [Erythranthe guttata]
Length=780

 Score =   204 bits (519),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +ELKRKT++LL+EYFS+R+LDEALQC+EELKSP Y+PEVVK+AISL L+K P  V+PV K
Sbjct  614  DELKRKTISLLEEYFSVRILDEALQCVEELKSPDYHPEVVKEAISLALEKGPSFVEPVSK  673

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+ +LF K +  +  + SGC  +ASL+DDLA+DLPKAP+ FG+I+G+LVLAG ++F    
Sbjct  674  LVLHLFAKNVLTAKDIVSGCLAYASLMDDLAIDLPKAPSGFGEIVGKLVLAGALDFKATK  733

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EIL  + D +Y K +FS  ++++ S P+G  +LDSQA+ V AC SL 
Sbjct  734  EILAAVEDGYYKKAIFSGAVKIIGSDPAGKELLDSQASEVAACESLF  780



>ref|XP_008790156.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2 
[Phoenix dactylifera]
Length=787

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L +KT+ALL+EYF + +LDEALQC+EELKSP YYPEVVK+AI+L LDK P C++ VV+LL
Sbjct  622  LHKKTIALLEEYFHVCILDEALQCVEELKSPEYYPEVVKEAINLALDKGPNCINSVVRLL  681

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+LF K++     LG+GC  + S+LDD+ +DLPKAPT FG++IG+L+LAGG+ F +V EI
Sbjct  682  EFLFVKEVITPKDLGTGCLLYGSMLDDIGIDLPKAPTCFGEVIGKLILAGGLGFKVVEEI  741

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F A+M+ + +SPSG A+L SQA ++ AC+ LL
Sbjct  742  LKKVEDSRFQSAMFDAVMKSIEASPSGQALLGSQAADITACKELL  786



>ref|XP_004145494.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Cucumis sativus]
 gb|KGN55419.1| hypothetical protein Csa_4G651850 [Cucumis sativus]
Length=768

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL++KTV+LL+EYFS+R+L EALQC+EELKSPAY+PEVVK+++++ L+K PP VDPVV+L
Sbjct  602  ELQKKTVSLLEEYFSVRILYEALQCVEELKSPAYHPEVVKKSLTIALEKIPPRVDPVVEL  661

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LEYL  K +     +G+GC  + S +DD+ +DLPKAP NFG+I+G+L+L GG++F++V E
Sbjct  662  LEYLLRKNVLTPKDIGTGCYLYGSQMDDIGIDLPKAPNNFGEILGKLILIGGLDFTVVKE  721

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL+ + D+++ K +F   M+ + SSPSG  +L +Q+  V+AC +LL
Sbjct  722  ILEKLEDDYFQKSIFDGAMKTLKSSPSGEGVLATQSDEVQACETLL  767



>ref|XP_003527199.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Glycine max]
 gb|KHN13442.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Glycine soja]
Length=775

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L R+TV+LL+EYFS+RLL+EALQC+EELKSP+Y+PEVVK+AI L LDKSPPCV+ V  
Sbjct  609  DDLCRRTVSLLEEYFSVRLLEEALQCVEELKSPSYHPEVVKEAIYLALDKSPPCVETVAN  668

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYL+ KKI     +G+GC  F SLLDD+ +DLPKAP+NFG+IIG+L+LAGG++F +V 
Sbjct  669  LIEYLYIKKILTPLDIGTGCLLFGSLLDDIGIDLPKAPSNFGEIIGKLILAGGLDFKVVG  728

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ + + +F +++  + S+ S  AILD+Q +++E C+S L+
Sbjct  729  EILKKVDDDMFRRAIFDSVVGAIRSA-SEQAILDAQTSDIEVCQSQLK  775



>ref|XP_010545451.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Tarenaya hassleriana]
Length=773

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E LKRKT +LL+EYFS+R+LDEALQC+EEL SP Y+ E+VK+AISLGL+KSPPCV+P  K
Sbjct  608  EVLKRKTKSLLEEYFSVRILDEALQCVEELGSPWYHAEIVKEAISLGLEKSPPCVEPTAK  667

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEY+  KK+  +  L +GC  + S+LDD+ +D+P APTNFG+I+GRL+L GG++F +V+
Sbjct  668  LLEYMLSKKVVTAKDLENGCLMYGSMLDDVGIDVPMAPTNFGEIVGRLILGGGLDFKVVS  727

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRS  505
            +++K + D+ + K V  A +R V SS  G ++L+ QA +VEACR+
Sbjct  728  QVVKKMEDDRFQKAVVDAAVRTVGSSEQGKSLLELQAADVEACRN  772



>ref|XP_008810701.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Phoenix dactylifera]
Length=790

 Score =   203 bits (516),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL +KTVALL+EYF +R+LDEALQC++ELKSP Y+PEVVK+AI+L LDK   CVD VV
Sbjct  622   PNELHKKTVALLEEYFHVRILDEALQCVKELKSPEYHPEVVKEAINLALDKGQSCVDHVV  681

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYL  + +  +  LG+GC  + ++LDD+ +DLPKAPT FG+++G+L+L+GG+ F +V
Sbjct  682   KLLEYLLAQNVLTAKDLGTGCLLYGTMLDDVGIDLPKAPTYFGEVVGKLILSGGLGFKVV  741

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + D+ +   +F A+M+ + +SP+G A+L  QA +++ C SLL
Sbjct  742   EEILKKVEDSRFQSAMFDAVMKTIKASPNGQAVLGRQAADIKDCESLL  789



>ref|NP_194797.1| Initiation factor eIF-4 gamma, MA3 [Arabidopsis thaliana]
 emb|CAB52441.1| translation initiation factor-like protein [Arabidopsis thaliana]
 emb|CAB79786.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AEE85795.1| Initiation factor eIF-4 gamma, MA3 [Arabidopsis thaliana]
Length=263

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 124/166 (75%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL RKT +LL+EYF++RLLDEALQCIEELK+P+Y+PE+VK+AISLGL+K+PPCV+PV KL
Sbjct  103  ELSRKTNSLLEEYFNVRLLDEALQCIEELKTPSYHPELVKEAISLGLEKNPPCVEPVAKL  162

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     L +GC  + S+LDD+ +DLPKAP NFG+I+G LV+A   +  +V E
Sbjct  163  LEHLVSKNVLTPKDLRNGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMAKASDSELVKE  222

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  +GD ++ K V  A+MR VS S     +L ++A  VEACR L+
Sbjct  223  ILMKMGDEWFKKAVLEAVMRSVSES-----LLTTEAVEVEACRGLV  263



>ref|XP_011459622.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Fragaria vesca subsp. vesca]
Length=764

 Score =   202 bits (515),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 128/165 (78%), Gaps = 4/165 (2%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L++KTV+LL+EYFS+R+LDEALQC+EELK+PAY+PE VK+AI+L LDKSPP V+PV+KLL
Sbjct  603  LRKKTVSLLEEYFSVRILDEALQCVEELKAPAYHPEFVKEAIALALDKSPPFVEPVIKLL  662

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            EYLF K +  S  +G+GC  + S+LD++ +DLPKAP NFG+IIG+LV AGG++F IV EI
Sbjct  663  EYLFSKNVLTSRDIGTGCLSYGSMLDEIGIDLPKAPNNFGEIIGKLVQAGGLDFKIVKEI  722

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            L  + D+ Y   +F A M+ ++S       L SQ + ++AC+SLL
Sbjct  723  LTKVEDDMYRPIIFGAAMKRITS----QEFLASQESEIQACKSLL  763



>ref|XP_008379294.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Malus domestica]
Length=763

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EYFS+R+LDEALQC+EELK+P Y+PEVVK+AI+L L+K PPCV+PV+KLL
Sbjct  598  LQRKTVSLLEEYFSVRILDEALQCVEELKAPTYHPEVVKEAINLALEKIPPCVEPVIKLL  657

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S+LDD+ +DLPKAPTNFG+I+G+L LA  ++F +V +I
Sbjct  658  EFLVNKNVLTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGEILGKLALAKVLDFKVVTQI  717

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F +  + ++SSPSG   L +Q T V+AC SLL
Sbjct  718  LKKVEDDMFRTAIFGSTKKSIASSPSGQEYLVTQETEVQACESLL  762



>ref|XP_008379300.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Malus domestica]
Length=758

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EYFS+R+LDEALQC+EELK+P Y+PEVVK+AI+L L+K PPCV+PV+KLL
Sbjct  593  LQRKTVSLLEEYFSVRILDEALQCVEELKAPTYHPEVVKEAINLALEKIPPCVEPVIKLL  652

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S+LDD+ +DLPKAPTNFG+I+G+L LA  ++F +V +I
Sbjct  653  EFLVNKNVLTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGEILGKLALAKVLDFKVVTQI  712

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F +  + ++SSPSG   L +Q T V+AC SLL
Sbjct  713  LKKVEDDMFRTAIFGSTKKSIASSPSGQEYLVTQETEVQACESLL  757



>ref|XP_009386818.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=766

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +KT+ALL+EYF IRL+DEALQCIEEL SP YYPEVVK+A++L L+K P C++PV++L
Sbjct  600  ELHKKTIALLEEYFHIRLIDEALQCIEELNSPEYYPEVVKEAVNLALEKGPSCMEPVMRL  659

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LEYL   KIF S  LG+GC  +A++LDD+ +DLP+APT FG+I G+LVLAGGI+ ++V +
Sbjct  660  LEYLAVNKIFTSRDLGTGCLLYAAILDDIGIDLPRAPTYFGEITGKLVLAGGIDLTVVEQ  719

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            ILK + D  +   +F A+ + + +SP+G +IL  QA  + AC  LL
Sbjct  720  ILKKVEDPLFRSMIFDAVTKAIRTSPNGQSILSGQAAIISACEKLL  765



>ref|XP_009386817.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=771

 Score =   202 bits (514),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +KT+ALL+EYF IRL+DEALQCIEEL SP YYPEVVK+A++L L+K P C++PV++L
Sbjct  605  ELHKKTIALLEEYFHIRLIDEALQCIEELNSPEYYPEVVKEAVNLALEKGPSCMEPVMRL  664

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LEYL   KIF S  LG+GC  +A++LDD+ +DLP+APT FG+I G+LVLAGGI+ ++V +
Sbjct  665  LEYLAVNKIFTSRDLGTGCLLYAAILDDIGIDLPRAPTYFGEITGKLVLAGGIDLTVVEQ  724

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            ILK + D  +   +F A+ + + +SP+G +IL  QA  + AC  LL
Sbjct  725  ILKKVEDPLFRSMIFDAVTKAIRTSPNGQSILSGQAAIISACEKLL  770



>ref|XP_008452837.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Cucumis melo]
Length=768

 Score =   202 bits (513),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L++KTV+LL+EYFS+R+LDEALQC+EELKS AY+PEVVK+++++ L+K PP VDPVVKL
Sbjct  602  DLQKKTVSLLEEYFSVRILDEALQCVEELKSSAYHPEVVKKSLTMALEKIPPRVDPVVKL  661

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +  +  +G+GC  + S +DD+ +DLPKAP NFG+I+G L+L GG++F++V E
Sbjct  662  LEHLLCKNVLTAKDIGTGCYLYGSQMDDIGIDLPKAPNNFGEILGMLILIGGLDFTVVKE  721

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL+ + DN++ K +F   M+ + SSPSG  IL +Q+  V+AC +LL
Sbjct  722  ILEKLEDNYFQKSIFDGAMKTLKSSPSGERILATQSVEVQACETLL  767



>ref|XP_009363516.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Pyrus x bretschneideri]
Length=763

 Score =   202 bits (513),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EYFS+R+LDEALQC+EELK+P Y+PEVVK+AI+L L+K PPCV+PV+KLL
Sbjct  598  LQRKTVSLLEEYFSVRILDEALQCVEELKAPTYHPEVVKEAINLALEKIPPCVEPVIKLL  657

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S+LDD+ +DLPKAPTNFG+I+G+L LA  ++F +V +I
Sbjct  658  EFLVNKNVLTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGEILGKLALAKVLDFKVVTQI  717

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F +  + V+SSPSG   L +Q T V+AC SLL
Sbjct  718  LKKVEDDIFRTAIFGSAKKGVASSPSGQEYLVTQETEVQACESLL  762



>gb|KCW78816.1| hypothetical protein EUGRSUZ_C00247 [Eucalyptus grandis]
Length=843

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL RKT +LL+EYFS+ LLDEALQC+ EL +PAYYPE VK+AISL L+KSPPC +PV K
Sbjct  648  DELTRKTKSLLEEYFSVLLLDEALQCVVELNAPAYYPEFVKEAISLALEKSPPCFEPVGK  707

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  KK+  S+ +G+GC  FAS+LDDLA+DLPKAP +FG+I+G+LVLAGG++F ++ 
Sbjct  708  LLGFLLTKKVISSSDVGTGCLLFASMLDDLAIDLPKAPVHFGEIVGKLVLAGGLDFKVIK  767

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVE  517
            EILK + D+ +   +  A+M++V+S  SG A+L SQA+++E
Sbjct  768  EILKKVEDDRFQNAILDAVMKIVTSDASGQAVLSSQASDIE  808



>ref|XP_011036701.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Populus euphratica]
Length=768

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P++L+RKT++LL+EYFS+R+LDEALQC+EELK  +++PEV K+AI+L L+KSPPCV+PV+
Sbjct  600   PDDLRRKTISLLEEYFSVRILDEALQCVEELKDTSFHPEVAKEAIALALEKSPPCVEPVI  659

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  K +  +  +G+GC  + S LDD+ +DLPKAP NFG+I+G LV+A G++F + 
Sbjct  660   QLLEFLLTKNVLTARDIGTGCLLYGSSLDDIGIDLPKAPNNFGEILGSLVVAQGLDFEVF  719

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK + D+ + K +FS+ M  ++S+PSG  +L +Q ++++AC SLL
Sbjct  720   KEVLKKVEDDRFRKAIFSSAMVSINSNPSGQEVLATQGSSIQACESLL  767



>gb|AAL32572.1| putative eukaryotic initiation factor 4, eIF4 [Arabidopsis thaliana]
 gb|AAN72098.1| putative eukaryotic initiation factor 4, eIF4 [Arabidopsis thaliana]
Length=747

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFSIRL+DEALQC+EELKSP+Y+PE+VK+ ISLGL+K+PP V+P+ KL
Sbjct  582  ELERKTKSLLEEYFSIRLVDEALQCVEELKSPSYHPELVKETISLGLEKNPPLVEPIAKL  641

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +  S  LG+GC  + S+LDD+ +DLPKAP +FG+ +G LV A  ++F +V +
Sbjct  642  LKHLISKNVLTSKDLGAGCLLYGSMLDDIGIDLPKAPNSFGEFLGELVSAKVLDFELVRD  701

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + D ++ K V +A+++ V   PSG ++LDSQA  VEAC+SLL
Sbjct  702  VLKKMEDEWFRKTVLNAVIKSVRECPSGQSVLDSQAVEVEACQSLL  747



>gb|AFW58747.1| hypothetical protein ZEAMMB73_485485 [Zea mays]
Length=526

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            ELK+KT+ALL+EYFSIR+LDEA QCIEEL++  YYPE+VK+A++L LDK    VDP+V+L
Sbjct  360  ELKKKTIALLEEYFSIRILDEAQQCIEELQNRGYYPEIVKEAVNLALDKGTNFVDPLVRL  419

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ KKIF +  L SGC  + +LLDD+ +DLPKAPT FG+II RL L G + F ++ E
Sbjct  420  LEHLYTKKIFKTQDLESGCLLYGALLDDIGIDLPKAPTQFGEIIARLTLLGALRFEVMEE  479

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            ILK + D  Y K VF A+ + + ++PSG  IL S A  ++AC SLL+
Sbjct  480  ILKKMEDTMYRKAVFDAVKKTLEANPSGQTILGSHAAVIDACNSLLE  526



>ref|NP_179983.1| eukaryotic translation initiation factor isoform 4G-2 [Arabidopsis 
thaliana]
 sp|O82233.1|IF4G2_ARATH RecName: Full=Eukaryotic translation initiation factor isoform 
4G-2; Short=eIF(iso)4G-2 [Arabidopsis thaliana]
 gb|AAC63673.1| putative eukaryotic initiation factor 4, eIF4 [Arabidopsis thaliana]
 gb|AEC07523.1| eukaryotic translation initiation factor isoform 4G-2 [Arabidopsis 
thaliana]
Length=747

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFSIRL+DEALQC+EELKSP+Y+PE+VK+ ISLGL+K+PP V+P+ KL
Sbjct  582  ELERKTKSLLEEYFSIRLVDEALQCVEELKSPSYHPELVKETISLGLEKNPPLVEPIAKL  641

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +  S  LG+GC  + S+LDD+ +DLPKAP +FG+ +G LV A  ++F +V +
Sbjct  642  LKHLISKNVLTSKDLGAGCLLYGSMLDDIGIDLPKAPNSFGEFLGELVSAKVLDFELVRD  701

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + D ++ K V +A+++ V   PSG ++LDSQA  VEAC+SLL
Sbjct  702  VLKKMEDEWFRKTVLNAVIKSVRECPSGQSVLDSQAVEVEACQSLL  747



>ref|XP_007011701.1| MIF4G domain-containing protein / MA3 domain-containing protein 
isoform 1 [Theobroma cacao]
 gb|EOY29320.1| MIF4G domain-containing protein / MA3 domain-containing protein 
isoform 1 [Theobroma cacao]
Length=795

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L+RKT +LL+E+FSIRLLDEALQCIEELK+P ++PEVVK+AI+L L+ SPPCVD V 
Sbjct  627   PADLQRKTKSLLEEFFSIRLLDEALQCIEELKAPTFHPEVVKEAIALALENSPPCVDAVT  686

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  K +F +  +G+G   + SLLDD+ +DLPKAP NFG+++G+LV+AGG++F+++
Sbjct  687   KLLEFLLNKNVFTARDIGAGSILYGSLLDDIGIDLPKAPNNFGEVLGKLVMAGGLDFTVI  746

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EIL  + D  +   +F A +  ++S PSG  +L  Q T+V+AC SLL
Sbjct  747   KEILMKVEDERFRASIFGAAIGSINSFPSGQELLAKQHTDVQACESLL  794



>gb|EYU34333.1| hypothetical protein MIMGU_mgv1a0025261mg, partial [Erythranthe 
guttata]
Length=415

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            LKRKT++LL+EYFS+RLLDEALQC+EELKSPAY+PE VK+A+SLG +K    V+P+ KLL
Sbjct  250  LKRKTISLLEEYFSVRLLDEALQCVEELKSPAYHPEFVKEALSLGFEKGSSFVEPIAKLL  309

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGG-INFSIVNE  637
            EYLF K +  ++ + +G   +A LL+DLA+DLPKAP+NFG+IIG+LVLA G I+F+ V E
Sbjct  310  EYLFSKNVLSADDVKTGFLLYAELLEDLAIDLPKAPSNFGEIIGKLVLARGLIDFNAVKE  369

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  I D ++ K VF++ M+ V S   G  ++D+QA+++ AC SL 
Sbjct  370  ILSKIDDGYFKKAVFTSAMKTVGSETGGKEVMDAQASDIAACESLF  415



>ref|NP_001168275.1| uncharacterized protein LOC100382039 [Zea mays]
 gb|ACN27663.1| unknown [Zea mays]
 gb|AFW58748.1| hypothetical protein ZEAMMB73_485485 [Zea mays]
Length=556

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            ELK+KT+ALL+EYFSIR+LDEA QCIEEL++  YYPE+VK+A++L LDK    VDP+V+L
Sbjct  390  ELKKKTIALLEEYFSIRILDEAQQCIEELQNRGYYPEIVKEAVNLALDKGTNFVDPLVRL  449

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ KKIF +  L SGC  + +LLDD+ +DLPKAPT FG+II RL L G + F ++ E
Sbjct  450  LEHLYTKKIFKTQDLESGCLLYGALLDDIGIDLPKAPTQFGEIIARLTLLGALRFEVMEE  509

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            ILK + D  Y K VF A+ + + ++PSG  IL S A  ++AC SLL+
Sbjct  510  ILKKMEDTMYRKAVFDAVKKTLEANPSGQTILGSHAAVIDACNSLLE  556



>ref|XP_007011702.1| MIF4G domain-containing protein / MA3 domain-containing protein 
isoform 2 [Theobroma cacao]
 gb|EOY29321.1| MIF4G domain-containing protein / MA3 domain-containing protein 
isoform 2 [Theobroma cacao]
Length=822

 Score =   200 bits (508),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L+RKT +LL+E+FSIRLLDEALQCIEELK+P ++PEVVK+AI+L L+ SPPCVD V 
Sbjct  654   PADLQRKTKSLLEEFFSIRLLDEALQCIEELKAPTFHPEVVKEAIALALENSPPCVDAVT  713

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  K +F +  +G+G   + SLLDD+ +DLPKAP NFG+++G+LV+AGG++F+++
Sbjct  714   KLLEFLLNKNVFTARDIGAGSILYGSLLDDIGIDLPKAPNNFGEVLGKLVMAGGLDFTVI  773

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EIL  + D  +   +F A +  ++S PSG  +L  Q T+V+AC SLL
Sbjct  774   KEILMKVEDERFRASIFGAAIGSINSFPSGQELLAKQHTDVQACESLL  821



>gb|ERM94906.1| hypothetical protein AMTR_s00009p00164690 [Amborella trichopoda]
Length=634

 Score =   198 bits (503),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L RKT +LL+EYFS+R L+EA+QC+EELKSP Y+PE VK+AI+   +KSPPCV+P+ 
Sbjct  465   PVDLVRKTKSLLEEYFSVRDLNEAMQCVEELKSPNYHPEFVKEAIAQAFEKSPPCVEPIG  524

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  KK+     +G GC  +AS+LDD+  D+PKAP NFG++IGRL+L GG++F +V
Sbjct  525   KLLEFLLAKKVISGRDVGVGCLHYASMLDDIVFDIPKAPINFGEVIGRLILVGGVDFELV  584

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E L  + D     DV++A+M+ V+SSPS  AIL S+   ++AC SLL
Sbjct  585   REALSKMEDTKQRGDVYNAVMKAVNSSPSAQAILGSKMAGIQACESLL  632



>gb|ADO64264.1| eukaryotic initiation factor iso4G [Carica papaya]
Length=801

 Score =   199 bits (505),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P++L+RKTV+LL+EY+S+RLLDEALQC+EEL+SP+Y+PEVVK+AIS+ L+KSPPCV+PV 
Sbjct  634   PDDLRRKTVSLLEEYYSVRLLDEALQCVEELRSPSYHPEVVKEAISIALEKSPPCVEPVA  693

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL+YL  KK+     +G+G   +AS+LDD+ +DLPKAP NFG+IIG+L+LA G++F+ V
Sbjct  694   KLLDYLLLKKVLAPKDVGTGVLLYASMLDDIGIDLPKAPNNFGEIIGKLILAMGLDFAAV  753

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E+LK I D+ + K V  + +R VSSSPSG ++LDSQA  +EAC++ L
Sbjct  754   QEVLKKIEDDRFRKVVMDSAVRTVSSSPSGQSVLDSQAAEIEACQNSL  801



>ref|XP_009137959.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Brassica rapa]
Length=748

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 128/167 (77%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++R++DEALQC+EELKSPAY+PE+VK+AISLGL+K+PPCV+PV +
Sbjct  587  EVLSRKTKSLLEEYFNVRIMDEALQCVEELKSPAYHPELVKEAISLGLEKNPPCVEPVAR  646

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+  +  +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A   +F  V 
Sbjct  647  LLEYLVSKKVLTTKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMANASDFETVE  706

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K V  A+++ VS S     +L +QA  +EACRSL+
Sbjct  707  EILKKMEDDRFKKAVLDAVIKSVSES-----LLAAQAAKIEACRSLV  748



>ref|XP_008662121.1| PREDICTED: uncharacterized protein LOC100382039 isoform X1 [Zea 
mays]
 gb|AFW58750.1| hypothetical protein ZEAMMB73_485485 [Zea mays]
Length=785

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            ELK+KT+ALL+EYFSIR+LDEA QCIEEL++  YYPE+VK+A++L LDK    VDP+V+L
Sbjct  619  ELKKKTIALLEEYFSIRILDEAQQCIEELQNRGYYPEIVKEAVNLALDKGTNFVDPLVRL  678

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ KKIF +  L SGC  + +LLDD+ +DLPKAPT FG+II RL L G + F ++ E
Sbjct  679  LEHLYTKKIFKTQDLESGCLLYGALLDDIGIDLPKAPTQFGEIIARLTLLGALRFEVMEE  738

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            ILK + D  Y K VF A+ + + ++PSG  IL S A  ++AC SLL+
Sbjct  739  ILKKMEDTMYRKAVFDAVKKTLEANPSGQTILGSHAAVIDACNSLLE  785



>ref|XP_011624611.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Amborella trichopoda]
Length=820

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L RKT +LL+EYFS+R L+EA+QC+EELKSP Y+PE VK+AI+   +KSPPCV+P+ 
Sbjct  651   PVDLVRKTKSLLEEYFSVRDLNEAMQCVEELKSPNYHPEFVKEAIAQAFEKSPPCVEPIG  710

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  KK+     +G GC  +AS+LDD+  D+PKAP NFG++IGRL+L GG++F +V
Sbjct  711   KLLEFLLAKKVISGRDVGVGCLHYASMLDDIVFDIPKAPINFGEVIGRLILVGGVDFELV  770

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E L  + D     DV++A+M+ V+SSPS  AIL S+   ++AC SLL
Sbjct  771   REALSKMEDTKQRGDVYNAVMKAVNSSPSAQAILGSKMAGIQACESLL  818



>ref|XP_010438142.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
Length=799

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 125/166 (75%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL RKT +LL+EYF++RLLDEALQC+EELKSP+Y+PE+VK AISLGLDK+PPCV+PV KL
Sbjct  639  ELSRKTKSLLEEYFNVRLLDEALQCVEELKSPSYHPELVKDAISLGLDKNPPCVEPVAKL  698

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     +G+GCQ +  +LDD+ +DLPKAP NFG+I+G LV+A   +F +V E
Sbjct  699  LEHLVSKNVLTPKDIGNGCQLYGCMLDDIGIDLPKAPNNFGEILGSLVMAKASDFELVKE  758

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  + D ++ K V  A++R VS S     +L +QA  VEACRSL+
Sbjct  759  ILMKMEDEWFKKAVLEAVIRSVSES-----LLATQAAEVEACRSLV  799



>ref|XP_010240075.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Brachypodium distachyon]
Length=792

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL++KT+ALL+EYF IR+LDEA QCIEEL+SPAYYPE+VK+AI+L LDK    VDP+V
Sbjct  624   PAELQKKTIALLEEYFGIRILDEAQQCIEELQSPAYYPEIVKEAINLALDKGASFVDPLV  683

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L+ KKIF +  L +GC  + SLL+D+ +DLPKAPT FG+I+ RL+L+ G+ F  V
Sbjct  684   RLLEHLYTKKIFKTEDLENGCLLYGSLLEDIGIDLPKAPTQFGEIVARLILSCGLRFEAV  743

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
              EILK + D F+ K++F A+ + + ++  G AIL S A  ++AC +L
Sbjct  744   EEILKKMDDTFFRKEIFKAVTKTLEANSPGQAILSSHAAVIDACNNL  790



>ref|XP_010483339.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Camelina sativa]
Length=278

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLLDEALQC+EEL SP+Y+ E VK+AISL L+KSPP V+P+ K
Sbjct  113  EVLQRKTKSLLEEYFNVRLLDEALQCVEELGSPSYHAEFVKEAISLSLEKSPPVVEPIAK  172

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + +LLDD+ +DLPKAP NFG+I+G+L++AGG++F +V 
Sbjct  173  LLEYLLTKKVVTPKDLETGFLLYGALLDDIGIDLPKAPNNFGEILGKLIMAGGVDFKLVR  232

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R++ SS  G ++L SQA +V+AC++L
Sbjct  233  EIIGKMEDDRFQKMVVDAAVRILESSEQGKSMLASQAADVKACQNL  278



>ref|XP_002880542.1| MIF4G domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56801.1| MIF4G domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=751

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFS+RL DEALQC+EELKSP+Y+PE+VK+AISLGL+K+PP V+P+ KL
Sbjct  586  ELERKTKSLLEEYFSVRLEDEALQCVEELKSPSYHPELVKEAISLGLEKNPPLVEPITKL  645

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +     LG+GC  + S+LDD+ +DLPKAP +FG+I+G+LV A  ++F +V +
Sbjct  646  LKHLISKNVLTCKDLGAGCLLYGSMLDDIGIDLPKAPNSFGEILGKLVSAKVLDFELVKK  705

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +L  + D ++ K V  A++  V  SPSG ++LDSQA  VEAC+SLL
Sbjct  706  VLMKMEDEWFRKAVLDAVILSVRESPSGQSVLDSQAAEVEACQSLL  751



>ref|XP_009358420.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Pyrus x bretschneideri]
Length=813

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            +EL+RKT++L +EYFSI LLDEAL C+EEL+SPAY+PEVVK+ I+L L+KS PCV P+VK
Sbjct  647  DELRRKTISLFEEYFSIGLLDEALLCVEELQSPAYHPEVVKEGITLALEKSRPCVGPLVK  706

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYLF KK+  ++ + SGC  +AS+L+D+ +DLPKAPTNFG+IIG+LVL GG++F +V 
Sbjct  707  LLEYLFSKKVLMTSDIRSGCLLYASILNDVGIDLPKAPTNFGEIIGKLVLVGGLDFKVVK  766

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            ++LK + D+++ K +  A + VV SSPSG  +L+SQA++++ACRSL 
Sbjct  767  DVLKVVVDDYFPKAILDAAVEVVRSSPSGQGLLESQASDIDACRSLF  813



>ref|XP_009400372.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Musa acuminata subsp. malaccensis]
Length=786

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL +KTVALL+EYF IRLLDEALQCI EL SP Y+PEVVK+AI++ L+K P CV+ VV
Sbjct  618   PNELHKKTVALLEEYFHIRLLDEALQCIAELNSPEYHPEVVKEAINMALEKGPSCVELVV  677

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLEYL  +KIF    LG+GC  +A+ LDD+ +DLPKAP  FG+++ +LVLAGG++F +V
Sbjct  678   KLLEYLIVEKIFAPRDLGTGCLLYAATLDDIGIDLPKAPIFFGEVVSKLVLAGGVDFKVV  737

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + D+ +   +F  +++VV +SP+G  +L  Q   V AC  LL
Sbjct  738   EEILKKVEDSRFQATIFDVVVKVVKASPNGQTVLSGQEAMVRACEKLL  785



>emb|CDY39236.1| BnaA03g50480D [Brassica napus]
Length=739

 Score =   196 bits (498),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 127/167 (76%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++R++DEALQC+EELKSPAY+PE+VK+AISLGL+K+PPCV+PV +
Sbjct  578  EVLSRKTKSLLEEYFNVRIMDEALQCVEELKSPAYHPELVKEAISLGLEKNPPCVEPVAR  637

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  K +  +  +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A   +F  V 
Sbjct  638  LLEYLVSKTVLTTKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMANASDFETVE  697

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K V  A+++ VS S     +L +QA  +EACRSL+
Sbjct  698  EILKKMEDDRFKKAVLDAVIKSVSES-----LLAAQAAKIEACRSLV  739



>gb|AHA84160.1| eukaryotic initiation factor iso-4F subunit p82-34-like isoform 
1 [Phaseolus vulgaris]
Length=757

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++ +RKT+  L EYFS+RLLDEALQC+EELK P++YPEVVK+AI L LDKSPPCV+PV  
Sbjct  590  DDFRRKTIFFLQEYFSVRLLDEALQCVEELKFPSFYPEVVKEAICLALDKSPPCVEPVAN  649

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             +EYL+ KKI  +  + +GC  F  LLDD+ +DLPK+P+NFG IIG+L+LAGG++F +  
Sbjct  650  FMEYLYIKKILTAIDIEAGCLLFGFLLDDIGIDLPKSPSNFGMIIGKLILAGGLDFKVAR  709

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            EILK + D+ + +++F + +  +    SG A+LD Q  +++AC+SLL+
Sbjct  710  EILKKVEDDMFQREIFDSAVGAIKFFASGQAVLDLQTFDIKACQSLLK  757



>ref|XP_010447683.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
Length=751

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 126/166 (76%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL RKT +LL+EYF++RLL EALQC+EELKSP+Y+PE+VK+AISLGLDK+PPCV+PV KL
Sbjct  591  ELSRKTKSLLEEYFNVRLLAEALQCVEELKSPSYHPELVKEAISLGLDKNPPCVEPVAKL  650

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     +G+GC  + S+LDD+ +DLPKAP NFG+I+G LV+A   +F +V E
Sbjct  651  LEHLVSKNVLTPKDIGNGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMAKASDFELVKE  710

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  + D+++ K V  A++R VS S     +L +QA  VEACRSL+
Sbjct  711  ILIKMEDDWFKKAVLEAVIRSVSES-----LLATQAAEVEACRSLV  751



>emb|CDX72262.1| BnaC07g42840D [Brassica napus]
Length=746

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 126/167 (75%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++RL+DEALQC+EELKSPAY PE+VK+AISLGL+K+PPC++PV +
Sbjct  585  EVLSRKTKSLLEEYFNVRLMDEALQCVEELKSPAYNPELVKEAISLGLEKNPPCIEPVAR  644

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK   +  +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A   +F  V 
Sbjct  645  LLEYLVSKKGLTTKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMANASDFETVE  704

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EILK + D+ + K V  A+++ VS S     +L +QA  +EACRSL+
Sbjct  705  EILKKMEDDRFKKAVLDAVIKSVSES-----LLAAQAAKIEACRSLV  746



>ref|XP_009359130.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Pyrus x bretschneideri]
Length=762

 Score =   194 bits (493),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EYFS+R+LDEALQC+EELK+PAY+PEVVK+AI+L L+K PP V+PV+KLL
Sbjct  597  LQRKTVSLLEEYFSVRILDEALQCVEELKAPAYHPEVVKEAINLALEKIPPSVEPVIKLL  656

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S+LDD+ +DLPKAPTNFG+I+G+L LA  ++  +V +I
Sbjct  657  EFLVNKNMLTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGEILGKLALAKVLDLKVVMQI  716

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F    + ++SSPSG   L +Q T V+AC SLL
Sbjct  717  LKKVEDDMFRAAIFGTAKKSIASSPSGQEFLLTQETVVQACESLL  761



>ref|XP_010265526.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Nelumbo nucifera]
Length=801

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L++KT++LLDEYF IR L+EAL+C+EELK P YYPEVVK++IS  LD+  PC D  V
Sbjct  633   PAGLQKKTISLLDEYFEIRDLEEALRCVEELKDPGYYPEVVKESISRSLDRKTPCPDLAV  692

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+LF KK+  +  +G+GC  +AS+LDD+A+DLPKAP+ FGD++ +LVL+G I+F ++
Sbjct  693   KLLEFLFAKKLLSARDIGTGCLLYASMLDDIAIDLPKAPSYFGDVMAKLVLSGAIDFKVI  752

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              E LK + D+++ + +F+A M  VSS PSG  +L  Q   ++AC++LL
Sbjct  753   MEALKKVEDSYFRELIFNAAMNSVSSDPSGKTVLSVQGAEIQACQNLL  800



>ref|XP_008377631.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Malus domestica]
Length=763

 Score =   193 bits (490),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EYFS+R+L+EALQC+EELK+PA +PEVVK+AI+L L+K PPCV+PV+KLL
Sbjct  598  LQRKTVSLLEEYFSVRILNEALQCVEELKAPAXHPEVVKEAINLALEKIPPCVEPVIKLL  657

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S LDD+ +DLPKAPTNFG+I+G+L  A  ++F +V +I
Sbjct  658  EFLVNKNMLTSVDIGTGCLLYGSXLDDIGIDLPKAPTNFGEILGKLAXAKVLDFKVVMQI  717

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F    + ++SSPSG   L +Q T V+AC SLL
Sbjct  718  LKKVEDDMFRTAIFGTAKKSIASSPSGQEFLLAQETEVQACESLL  762



>ref|XP_009359111.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Pyrus x bretschneideri]
Length=762

 Score =   193 bits (490),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EY+S+R+LDEALQC+EELK+PAY+PEVVK+AI+L L+K PP V+PV+KLL
Sbjct  597  LQRKTVSLLEEYYSVRILDEALQCVEELKAPAYHPEVVKEAINLALEKIPPSVEPVIKLL  656

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S+LDD+ +DLPKAPTNFG+I+G+L LA  ++  +V +I
Sbjct  657  EFLVNKNMLTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGEILGKLALAKVLDLKVVMQI  716

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F    + ++SSPSG   L +Q T V+AC SLL
Sbjct  717  LKKVEDDMFRAAIFGTAKKSIASSPSGQEFLLTQETVVQACESLL  761



>ref|XP_008377630.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Malus domestica]
Length=796

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L+RKTV+LL+EYFS+R+L+EALQC+EELK+PA +PEVVK+AI+L L+K PPCV+PV+KLL
Sbjct  631  LQRKTVSLLEEYFSVRILNEALQCVEELKAPAXHPEVVKEAINLALEKIPPCVEPVIKLL  690

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K +  S  +G+GC  + S LDD+ +DLPKAPTNFG+I+G+L  A  ++F +V +I
Sbjct  691  EFLVNKNMLTSVDIGTGCLLYGSXLDDIGIDLPKAPTNFGEILGKLAXAKVLDFKVVMQI  750

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D+ +   +F    + ++SSPSG   L +Q T V+AC SLL
Sbjct  751  LKKVEDDMFRTAIFGTAKKSIASSPSGQEFLLAQETEVQACESLL  795



>ref|XP_010091165.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Morus notabilis]
 gb|EXB42935.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Morus notabilis]
Length=822

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDK-SPPCVDPV  826
             P +L +KTV+LL+EYF +R+LDEALQC+E+LKSPAY+ EVVK+AISL L+  SPP +   
Sbjct  654   PADLHKKTVSLLEEYFDVRMLDEALQCVEDLKSPAYHHEVVKEAISLALEHNSPPFIQLA  713

Query  825   VKLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSI  646
             V+LLEYL  KK+F    +G+GC  +ASLLDDL +DLPKAP NFG+IIG L+L GG++F +
Sbjct  714   VRLLEYLLSKKVFTVGDIGTGCLLYASLLDDLGIDLPKAPNNFGEIIGNLLLIGGLDFKV  773

Query  645   VNEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
             V E+LK + ++ +   +F+A MR+VS SPSG+++L++QA++V+ACRSLL
Sbjct  774   VKEVLKKVENDCFQIAIFNAAMRIVSESPSGHSVLEAQASDVDACRSLL  822



>gb|AIZ68195.1| eukaryotic translation initiation factor isoform 4G-1 [Ornithogalum 
saundersiae]
Length=780

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L+RKTVA+L+EYF IR+LDEA+QCIEELKSP Y+ EVVK+ IS+ LDK   CVD  +KL
Sbjct  614  DLQRKTVAILEEYFHIRVLDEAVQCIEELKSPGYHSEVVKETISIALDKGSACVDLAIKL  673

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L+ L  KKI     LG+GC  + S+LDD+ +DLPKAPT FG++ GRL++AGG++F +V E
Sbjct  674  LDTLLAKKIITPGDLGTGCLLYGSMLDDIGIDLPKAPTYFGNVAGRLIVAGGLSFKVVEE  733

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + D+ +   +F A+M+ + +SPS   IL+  A ++++C+SLL
Sbjct  734  VLKKMEDSRFQAAMFDAVMKSIQASPSAQVILERHAADIKSCQSLL  779



>gb|KFK27326.1| hypothetical protein AALP_AA8G368600 [Arabis alpina]
Length=779

 Score =   190 bits (483),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E LKRKT +LL+EYF++RLLDEALQC+EEL SP+Y+ E VK+AISL L+KSPP V+P+ K
Sbjct  614  EVLKRKTKSLLEEYFNVRLLDEALQCVEELGSPSYHAEFVKEAISLSLEKSPPVVEPIAK  673

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  674  LLEYLLSKKVITPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  733

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            ++L  + D+ + K V  A +R++ SS  G ++L SQA +++ACR+L
Sbjct  734  DVLGKMEDDRFQKAVVDAAVRILESSEQGKSLLASQAADIDACRNL  779



>ref|XP_002867334.1| hypothetical protein ARALYDRAFT_353746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43593.1| hypothetical protein ARALYDRAFT_353746 [Arabidopsis lyrata subsp. 
lyrata]
Length=745

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL RKT +LL+EYF++RLLDEALQC+EELK+P+Y+PE+VK+AISLGL+K+PPCV+PV KL
Sbjct  585  ELSRKTNSLLEEYFNVRLLDEALQCVEELKTPSYHPELVKEAISLGLEKNPPCVEPVAKL  644

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     LG+GC  + S+LDD+ +DLPKAP NFG+IIG LV+A   +F +V E
Sbjct  645  LEHLVSKNVLTPKDLGNGCLLYGSMLDDIGIDLPKAPNNFGEIIGSLVMAKASDFELVKE  704

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  + D ++ K V  A++  VS S     +L +Q   VE CRSL+
Sbjct  705  ILMKMEDEWFKKAVLKAVIGSVSES-----LLATQEAEVEVCRSLV  745



>gb|EAY86656.1| hypothetical protein OsI_08037 [Oryza sativa Indica Group]
Length=780

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL++KT++LL EYF I LLDEA QCIEELKSP YYPEVVK+AI+L LDK    +DP+++L
Sbjct  612  ELQKKTISLLKEYFHILLLDEAQQCIEELKSPDYYPEVVKEAINLALDKGTNSIDPLLRL  671

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ K +F +  L +GC  ++SLLD+LA+DLPKAP +FG++IGRLVL+  ++  +V +
Sbjct  672  LEHLYNKNVFKATDLETGCLLYSSLLDELAIDLPKAPVHFGEVIGRLVLSHCLSIEVVED  731

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
             LK I D+F+   VF A+M+++ ++PSG AIL S    ++AC  LL
Sbjct  732  TLKKIEDSFFRAAVFEAMMKIMKANPSGQAILGSHVAKIDACSKLL  777



>emb|CDY28203.1| BnaA01g06460D [Brassica napus]
Length=511

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 122/167 (73%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++RLLDEALQC+EELKSP+Y+PE+VK+AISLGL+K+PPCV PV  
Sbjct  350  EVLSRKTKSLLEEYFNVRLLDEALQCVEELKSPSYHPELVKEAISLGLEKNPPCVTPVAN  409

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  K +     +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A    F +V 
Sbjct  410  LLAHLVSKNVLTPKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMASASGFEVVK  469

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +IL  + D ++ K V  A+++ VS S     +L + A +VEACRSL+
Sbjct  470  DILMKMEDEWFKKAVLDAVIKSVSDS-----LLATHAADVEACRSLV  511



>ref|XP_010432953.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
 ref|XP_010432954.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
 ref|XP_010432955.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
Length=747

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL RKT +LL+EYF++RLL EALQC+EELKSP+Y+PE+VK+AISLGLDK+PPCV+ V KL
Sbjct  587  ELSRKTKSLLEEYFNVRLLAEALQCVEELKSPSYHPELVKEAISLGLDKNPPCVEAVAKL  646

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     +G+GC  +  +LDD+ +DLPKAP NFG+I+G LV+A   +F +V E
Sbjct  647  LEHLVSKNVLTPKDIGNGCLLYGCMLDDIGIDLPKAPNNFGEILGSLVMAKASDFELVKE  706

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  + D ++ K V  A++R VS S     +L +QA  VEACRSL+
Sbjct  707  ILMKMEDEWFKKAVLEAVIRSVSES-----LLATQAAEVEACRSLV  747



>emb|CDX68687.1| BnaC01g07660D [Brassica napus]
Length=748

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 122/167 (73%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++RLLDEALQC+EELKSP+Y+PE+VK+AISLGL+K+PPCV PV  
Sbjct  587  EVLSRKTKSLLEEYFNVRLLDEALQCVEELKSPSYHPELVKEAISLGLEKNPPCVTPVAN  646

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  K +     +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A    F +V 
Sbjct  647  LLAHLVSKNVLTPKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMAKASGFEMVK  706

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EIL  + D ++ K V  A+++ VS S     +L +QA  VEACRSL+
Sbjct  707  EILMKMEDEWFKKAVLDAVIKSVSES-----LLATQAAEVEACRSLV  748



>gb|EPS69198.1| hypothetical protein M569_05568, partial [Genlisea aurea]
Length=763

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             PEELK+KT +LL+EYF +++LDEAL+C++ELK+P+Y+PEVVK+AI LGL+K       V 
Sbjct  595   PEELKKKTTSLLEEYFHVKILDEALRCVDELKAPSYHPEVVKEAIFLGLEKGSTLAAHVA  654

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLEYL  K +F    + SGC+ +++LL+D+A+DLP AP+ FG IIG L+L+GG+NF  +
Sbjct  655   RLLEYLLSKNVFTQTDIISGCRLYSALLEDIAIDLPIAPSGFGVIIGNLILSGGLNFKEL  714

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
               IL N+GD++Y K VF++ + +V S PSG  IL+SQA++V AC   L
Sbjct  715   RGILVNVGDDYYQKAVFTSAVEIVRSDPSGKKILESQASDVGACEQGL  762



>ref|XP_009127643.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Brassica rapa]
Length=736

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++RLLDEALQC+EELKSP+Y+PE+VK+AISLGL+K+PPCV PV  
Sbjct  575  EVLSRKTKSLLEEYFNVRLLDEALQCVEELKSPSYHPELVKEAISLGLEKNPPCVTPVAN  634

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  K +     +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A    F +V 
Sbjct  635  LLAHLVSKNVLTPKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMASASGFEVVK  694

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EIL  + D ++ K V  A+++ VS S     +L + A +VEACRSL+
Sbjct  695  EILMKMEDEWFKKAVLDAVIKSVSDS-----LLATHAADVEACRSLV  736



>dbj|BAB08857.1| eukaryotic initiation factor 4, eIF4-like protein [Arabidopsis 
thaliana]
Length=751

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLL EALQC+EEL  P+Y+PE VK+AISL L+KSPP V+P+  
Sbjct  586  EVLQRKTKSLLEEYFNVRLLGEALQCVEELGLPSYHPEFVKEAISLSLEKSPPVVEPIAT  645

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  646  LLEYLLSKKVVAPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  705

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R+V SS  G ++L SQA ++EACR+L
Sbjct  706  EIIGKMEDDRFQKMVVDAAVRIVESSEQGKSLLASQAADIEACRNL  751



>ref|XP_006283106.1| hypothetical protein CARUB_v10004122mg [Capsella rubella]
 gb|EOA16004.1| hypothetical protein CARUB_v10004122mg [Capsella rubella]
Length=841

 Score =   189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 123/166 (74%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL RKT +LL+EYF++RLLDEALQC+EELK+P+Y+PE+VK+AISLGL+K+PPCV+PV KL
Sbjct  681  ELSRKTNSLLEEYFNVRLLDEALQCVEELKTPSYHPELVKEAISLGLEKNPPCVEPVAKL  740

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L  K +     +G+GC  +  +LDD+ +DLPKAP NFG+I+G LV A   +F +V E
Sbjct  741  LEHLVSKSVLTPKDIGNGCLLYGCMLDDIGIDLPKAPNNFGEILGGLVNAKASDFELVKE  800

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            IL  + D  + K V  A++R VS S     +L +QA  VEACRSL+
Sbjct  801  ILMKMEDELFKKAVLEAVLRSVSES-----LLAAQAAKVEACRSLV  841



>gb|AAN72067.1| eukaryotic initiation factor 4, eIF4-like protein [Arabidopsis 
thaliana]
Length=776

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLL EALQC+EEL  P+Y+PE VK+AISL L+KSPP V+P+  
Sbjct  611  EVLQRKTKSLLEEYFNVRLLGEALQCVEELGLPSYHPEFVKEAISLSLEKSPPVVEPIAT  670

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  671  LLEYLLSKKVVAPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  730

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R+V SS  G ++L SQA ++EACR+L
Sbjct  731  EIIGKMEDDRFQKMVVDAAVRIVESSEQGKSLLASQAADIEACRNL  776



>ref|NP_200595.2| putative translation initiation factor [Arabidopsis thaliana]
 gb|AED96965.1| putative translation initiation factor [Arabidopsis thaliana]
Length=776

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLL EALQC+EEL  P+Y+PE VK+AISL L+KSPP V+P+  
Sbjct  611  EVLQRKTKSLLEEYFNVRLLGEALQCVEELGLPSYHPEFVKEAISLSLEKSPPVVEPIAT  670

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  671  LLEYLLSKKVVAPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  730

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R+V SS  G ++L SQA ++EACR+L
Sbjct  731  EIIGKMEDDRFQKMVVDAAVRIVESSEQGKSLLASQAADIEACRNL  776



>ref|XP_010452883.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Camelina sativa]
Length=778

 Score =   188 bits (477),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLLDEALQC+EEL SP+Y+ E VK+AISL L+KSPP V+P+ K
Sbjct  613  EVLQRKTKSLLEEYFNVRLLDEALQCVEELGSPSYHAEFVKEAISLSLEKSPPVVEPIAK  672

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + +LLDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  673  LLEYLLTKKVVTPKDLETGFLLYGALLDDIGIDLPKAPNNFGEILGKLILAGGLDFKLVR  732

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI++ + D+ + K V  A +R++ SS  G ++L SQ+ +V+AC++L
Sbjct  733  EIIRKMEDDRFQKMVVDAAVRILESSEQGQSLLASQSADVKACQNL  778



>ref|NP_851207.1| putative translation initiation factor [Arabidopsis thaliana]
 sp|Q93ZT6.1|IF4G1_ARATH RecName: Full=Eukaryotic translation initiation factor isoform 
4G-1; Short=eIF(iso)4G-1 [Arabidopsis thaliana]
 gb|AAL07115.1| putative eukaryotic initiation factor eIF4 [Arabidopsis thaliana]
 gb|AAM14197.1| putative eukaryotic initiation factor 4 [Arabidopsis thaliana]
 gb|AED96964.1| putative translation initiation factor [Arabidopsis thaliana]
Length=780

 Score =   188 bits (477),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLL EALQC+EEL  P+Y+PE VK+AISL L+KSPP V+P+  
Sbjct  615  EVLQRKTKSLLEEYFNVRLLGEALQCVEELGLPSYHPEFVKEAISLSLEKSPPVVEPIAT  674

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  675  LLEYLLSKKVVAPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  734

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R+V SS  G ++L SQA ++EACR+L
Sbjct  735  EIIGKMEDDRFQKMVVDAAVRIVESSEQGKSLLASQAADIEACRNL  780



>ref|XP_009130188.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor isoform 4G-2 [Brassica rapa]
Length=630

 Score =   187 bits (474),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 5/167 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L RKT +LL+EYF++RLLDEALQC+EELKSP+Y+PE+VK+AISLGL+K+PPCV PV  
Sbjct  469  EVLSRKTKSLLEEYFNVRLLDEALQCVEELKSPSYHPELVKEAISLGLEKNPPCVTPVAN  528

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL +L  K +     +GSGC  + S+LDD+ +DLPKAP NFG+I+G LV+A    F +V 
Sbjct  529  LLAHLVSKNVLTPKDIGSGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMASASGFEVVK  588

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            EIL  + D ++ K V  A+++ VS S     +L + A +VEACRSL+
Sbjct  589  EILMKMEDEWFKKAVLDAVIKSVSDS-----LLVTHAADVEACRSLV  630



>sp|Q41583.1|IF4G2_WHEAT RecName: Full=Eukaryotic translation initiation factor isoform 
4G-2; Short=eIF(iso)-4G-2; Short=eIF(iso)4G-2; AltName: Full=Eukaryotic 
initiation factor iso-4F subunit p82-16; Short=eIF-(iso)4F 
p82-16 subunit [Triticum aestivum]
 gb|AAA74724.1| initiation factor (iso)4f p82 subunit [Triticum aestivum]
Length=787

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L++KT +LL+EYF IR+LDEA QCIEEL+SP Y+PE+VK+AI+L LDK    VDP+V
Sbjct  619   PAGLEKKTASLLEEYFGIRILDEAQQCIEELQSPDYHPEIVKEAINLALDKGASFVDPLV  678

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L+ KK F +  L +GC  + SLL+D+ +DLPKAPT FG++I RL+L+ G+ F  V
Sbjct  679   KLLEHLYTKKTFKTEDLENGCLLYGSLLEDIGIDLPKAPTQFGEVIARLILSCGLRFEAV  738

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
               ILK + D F+ K +F+++ + + + P+G AIL S A  V+AC SL
Sbjct  739   EGILKAMEDTFFRKAIFTSVTKTLEADPAGQAILSSHAAVVDACNSL  785



>ref|NP_001047407.1| Os02g0611500 [Oryza sativa Japonica Group]
 sp|Q6K641.1|IF4G2_ORYSJ RecName: Full=Eukaryotic translation initiation factor isoform 
4G-2; Short=eIF(iso)-4G-2; Short=eIF(iso)4G-2; AltName: Full=Eukaryotic 
initiation factor iso-4F subunit p82; Short=eIF-(iso)4F 
p82 subunit [Oryza sativa Japonica Group]
 dbj|BAD19680.1| putative eukaryotic initiation factor (iso)4F subunit p82-34 
(eIF-(iso)4F p82-34) [Oryza sativa Japonica Group]
 dbj|BAF09321.1| Os02g0611500 [Oryza sativa Japonica Group]
 gb|EAZ23786.1| hypothetical protein OsJ_07496 [Oryza sativa Japonica Group]
 dbj|BAG92814.1| unnamed protein product [Oryza sativa Japonica Group]
Length=780

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL++KT++LL EYF I LL EA QCIEELKSP YYPEVVK+AI+L LDK    +DP+++L
Sbjct  612  ELQKKTISLLKEYFHILLLHEAQQCIEELKSPDYYPEVVKEAINLALDKGTNSIDPLLRL  671

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ K +F +  L +GC  ++SLLD+LA+DLPKAP +FG++IGRLVL+  ++  +V +
Sbjct  672  LEHLYNKNVFKATDLETGCLLYSSLLDELAIDLPKAPVHFGEVIGRLVLSHCLSIEVVED  731

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
             LK I D+F+   VF A+M+++ ++PSG AIL S    ++AC  LL
Sbjct  732  TLKKIEDSFFRAAVFEAMMKIMKANPSGQAILGSHVAKIDACSKLL  777



>gb|EMS68053.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Triticum 
urartu]
Length=730

 Score =   187 bits (475),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L++KT +LL+EYF IR+LDEA QCIEEL+SP Y+PE+VK+AI+L LDK    VDP+V
Sbjct  562   PAGLEKKTASLLEEYFGIRILDEAQQCIEELQSPDYHPEIVKEAINLALDKGASFVDPLV  621

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L+ KK F +  L +GC  + SLL+D+ +DLPKAPT FG++I RL L+ G+ F  V
Sbjct  622   KLLEHLYTKKTFKTEDLENGCLLYGSLLEDIGIDLPKAPTQFGEVIARLTLSCGLRFEAV  681

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
               ILK + D F+ K +F+++ + + + P+G AIL S A  V+AC SL
Sbjct  682   EGILKAMEDTFFRKAIFTSVTKTLEADPAGQAILSSHAAVVDACNSL  728



>gb|AAN17444.1| eukaryotic initiation factor 4, eIF4-like protein [Arabidopsis 
thaliana]
 gb|AAO30087.1| eukaryotic initiation factor 4, eIF4-like protein [Arabidopsis 
thaliana]
Length=780

 Score =   187 bits (475),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLL EALQC+EEL  P+Y+PE VK+AISL L+KSPP V+P+  
Sbjct  615  EVLQRKTKSLLEEYFNVRLLGEALQCVEELGLPSYHPEFVKEAISLSLEKSPPVVEPIAT  674

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     + +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  675  LLEYLLSKKVVAPKDIETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  734

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R+V SS  G ++L SQA ++EACR+L
Sbjct  735  EIIGKMEDDRFQKMVVDAAVRIVESSEQGKSLLASQAADIEACRNL  780



>dbj|BAK00069.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=789

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L++KT +LL+EYF IR+LDEA QCIEEL+SP Y+PE+VK+AI+L LDK    VDP+V
Sbjct  621   PAGLQKKTASLLEEYFGIRILDEAQQCIEELQSPDYHPEIVKEAINLALDKGASFVDPLV  680

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L+ KK F +  L +GC  + SLL+D+ +DLPKAPT FG+++  L+L+ G+ F  +
Sbjct  681   KLLEHLYTKKTFKTEDLENGCLLYGSLLEDIGIDLPKAPTQFGEVVAHLILSCGLRFEAL  740

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
               ILK + D F+ K +F+++ + + ++P+G AIL S A  VEAC SLL
Sbjct  741   EGILKAMEDTFFRKAIFNSVTKTLEANPAGQAILSSHAAVVEACNSLL  788



>ref|NP_001053219.2| Os04g0499300 [Oryza sativa Japonica Group]
 dbj|BAF15133.2| Os04g0499300 [Oryza sativa Japonica Group]
Length=480

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  312   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  371

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  372   RLLEHLHAKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  431

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  432   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  480



>ref|XP_006648829.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Oryza brachyantha]
Length=760

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L++KT++LL EY+ I LLDEA QCIEELKSP YYPEVVK+AISL LD+    ++P+++LL
Sbjct  593  LQKKTISLLKEYYHILLLDEAQQCIEELKSPDYYPEVVKEAISLALDRGTNSINPLLRLL  652

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L+ K IF    L +GC  ++SLLD+LA+DLPKAP +FG++IG LVL+  +    + + 
Sbjct  653  EHLYTKNIFKPTDLETGCLLYSSLLDELAIDLPKAPAHFGEVIGHLVLSHCLGMEAIEDT  712

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK I DNF+   VF AIM+ + ++PSG AIL S A  + AC +LL
Sbjct  713  LKKIEDNFFRTAVFDAIMKTIKANPSGQAILSSHAAKINACSNLL  757



>ref|XP_007226996.1| hypothetical protein PRUPE_ppa001769mg [Prunus persica]
 gb|EMJ28195.1| hypothetical protein PRUPE_ppa001769mg [Prunus persica]
Length=767

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L RKTV+LL+EYFS+R+LDEALQC+EELK+PAY+PEVVK+AI++ L+K PPCV+PV+KLL
Sbjct  604  LHRKTVSLLEEYFSVRILDEALQCVEELKAPAYHPEVVKEAIAVALEKIPPCVEPVIKLL  663

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+LF KK+  S  +G+GC  + S+LDD+ +DLPKAPTNFGD+IG+L LAG ++F +V +I
Sbjct  664  EFLFNKKVVTSVDIGTGCLLYGSMLDDIGIDLPKAPTNFGDVIGKLALAGVLDFKVVTQI  723

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAIL  541
            LK + D+ +   +F A ++ V  +   N IL
Sbjct  724  LKKVEDDMFRTAIF-AWVKFVPGTIEMNRIL  753



>ref|XP_010443497.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Camelina sativa]
Length=782

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLLDEALQC+EEL SP+Y+ E VK+AISL L+KSPP V+P+ K
Sbjct  617  EVLQRKTKSLLEEYFNVRLLDEALQCVEELGSPSYHAEFVKEAISLSLEKSPPVVEPIAK  676

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + +LLDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  677  LLEYLLTKKVVTPKDLETGFLLYGALLDDIGIDLPKAPNNFGEILGKLILAGGVDFKLVR  736

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E +  + D+ + K V  A +R++ SS  G ++L SQA +V+AC++L
Sbjct  737  EFIGKMEDDRFQKMVVDAAVRILESSEQGKSLLASQAADVKACQNL  782



>sp|Q03387.2|IF4G1_WHEAT RecName: Full=Eukaryotic translation initiation factor isoform 
4G-1; Short=eIF(iso)-4G-1; Short=eIF(iso)4G-1; AltName: Full=Eukaryotic 
initiation factor iso-4F subunit p82-34; Short=eIF-(iso)4F 
p82-34 subunit [Triticum aestivum]
 gb|AAA16209.1| initiation factor (iso)4f p82 subunit [Triticum aestivum]
Length=788

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L++KT +LL+EYF IR+LDEA QCIEEL+SP Y+PE+VK+AI+L LDK    VDP+V
Sbjct  620   PAGLQKKTASLLEEYFGIRILDEAQQCIEELQSPDYHPEIVKEAINLALDKGASFVDPLV  679

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L+ KK F +  L +GC  + SLL+D+ +DLPKAPT FG+++ RL+L+ G+ F   
Sbjct  680   KLLEHLYTKKTFKTEDLENGCLLYGSLLEDIGIDLPKAPTQFGEVVARLILSCGLRFEAA  739

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
               ILK + D F+ K +F+++ + + + P+G AIL S A  V+AC SL
Sbjct  740   EGILKAMEDTFFRKAIFTSVTKTLGADPAGQAILSSHAAVVDACNSL  786



>gb|EMT29623.1| Eukaryotic initiation factor iso-4F subunit p82-34 [Aegilops 
tauschii]
Length=814

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L++KT +LL+EYF IR+LDEA QCIEEL+SP Y+PE+VK+AI+L LDK    VDP+V
Sbjct  646   PAGLQKKTASLLEEYFGIRILDEAQQCIEELQSPDYHPEIVKEAINLALDKGASFVDPLV  705

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L+ KK F +  L +GC  + SLL+D+ +DLPKAPT FG+++ RL+L+ G+ F   
Sbjct  706   KLLEHLYTKKTFKTEDLENGCLLYGSLLEDIGIDLPKAPTQFGEVVARLILSCGLRFEAA  765

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
               ILK + D F+ K +F+++ + + + P+G AIL S A  V+AC SL
Sbjct  766   EGILKAMEDTFFRKAIFTSVTKTLGADPAGQAILSSHAAVVDACNSL  812



>ref|XP_010273660.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Nelumbo nucifera]
Length=806

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL++KT++LLDEYF IR LDEA +C+EELK  ++YPEVVK+ IS  LD+  PCVD  +
Sbjct  638   PAELEKKTISLLDEYFEIRDLDEAFRCVEELKDTSFYPEVVKETISRSLDRRVPCVDLAL  697

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL++LF +K+  +  +G+GC  +AS+LDD+ +DLPKAP+NFGD+ G+LVL+G ++F ++
Sbjct  698   KLLDFLFARKLLSARDMGTGCLLYASMLDDIGIDLPKAPSNFGDVTGKLVLSGALDFKVI  757

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EILK + D ++ K +F A M  + S PSG  IL      ++  +S+L
Sbjct  758   KEILKKVEDTYFRKLIFDAAMSSLDSDPSGQKILSVNGAEIQTFQSML  805



>ref|XP_006401158.1| hypothetical protein EUTSA_v10012738mg [Eutrema salsugineum]
 gb|ESQ42611.1| hypothetical protein EUTSA_v10012738mg [Eutrema salsugineum]
Length=780

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E  KRKT +LL+EYFS+RLLDEALQC+EELKSP+Y+ E VK+AISL L+KSPP V+P+ +
Sbjct  615  EVFKRKTKSLLEEYFSVRLLDEALQCVEELKSPSYHAEFVKEAISLSLEKSPPVVEPIAR  674

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL YL  K +     + +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  675  LLGYLLSKNVVTPKDIETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  734

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E+L  + D+ + K V  A + ++ SS  G  +L SQA ++EACR+L
Sbjct  735  EVLGKMEDDRFQKAVMDAAVHILESSEQGKFLLASQAADIEACRNL  780



>ref|XP_006280039.1| hypothetical protein CARUB_v10025916mg [Capsella rubella]
 gb|EOA12937.1| hypothetical protein CARUB_v10025916mg [Capsella rubella]
Length=782

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RLLDEALQC+EEL SP+Y+ E VK+AISL L+KSPP V+P+ K
Sbjct  617  EVLQRKTKSLLEEYFNVRLLDEALQCVEELGSPSYHAEFVKEAISLSLEKSPPVVEPIAK  676

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLE+L  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G L+LAGG++F +V 
Sbjct  677  LLEHLLTKKVVSPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIMGNLILAGGVDFKLVR  736

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            EI+  + D+ + K V  A +R V SS  G ++L SQA  V+AC++L
Sbjct  737  EIIGKMEDDRFQKMVVDAAVRTVESSEQGKSLLASQAAEVKACQNL  782



>emb|CAN70487.1| hypothetical protein VITISV_008663 [Vitis vinifera]
Length=1302

 Score =   187 bits (476),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 123/164 (75%), Gaps = 10/164 (6%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P +L+RKTV+LL+EYFS+R+LDEALQC+EELKSPAY+PEVVK+A+SL L+KSPPCV+PV+
Sbjct  681   PVDLRRKTVSLLEEYFSVRILDEALQCVEELKSPAYHPEVVKEAVSLALEKSPPCVEPVI  740

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLL YLF K +  +  LG+GC  + SLLDD+ +DLPKAP NFG+++G+LVLAGG++F +V
Sbjct  741   KLLVYLFNKNVLLARDLGTGCLLYGSLLDDVGIDLPKAPNNFGEVLGKLVLAGGLDFKVV  800

Query  642   NEILKNIGDNFYLKDVFS----------AIMRVVSSSPSGNAIL  541
              E+L+ + D+ +L  + S           I R VS      AIL
Sbjct  801   KEVLEKVEDDSFLYSLSSVDSGLQRWNRVIKRRVSQGNPDQAIL  844



>ref|XP_008794367.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Phoenix dactylifera]
Length=817

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  L +KTVALL+EYF +R+LDEALQC+EELKSP Y+PEVVK+AI+L L+K   C+DPVV
Sbjct  649   PNGLHKKTVALLEEYFHVRILDEALQCVEELKSPEYHPEVVKEAINLALEKGLNCIDPVV  708

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+LF KK+     LG+GC  + S+LDD+ +DLPKAPT FG++IG L+LAGG+ F +V
Sbjct  709   RLLEFLFVKKVITPKDLGTGCLLYGSMLDDIGIDLPKAPTYFGEVIGGLILAGGLGFKVV  768

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
              EI+K + D+ +   +F A+M+ + + PSG AIL SQA  + AC+++L
Sbjct  769   EEIMKKVEDSRFRSAMFDAVMKNIEAKPSGQAILGSQAAYITACKNIL  816



>ref|XP_006293720.1| hypothetical protein CARUB_v10022680mg, partial [Capsella rubella]
 gb|EOA26618.1| hypothetical protein CARUB_v10022680mg, partial [Capsella rubella]
Length=777

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 125/166 (75%), Gaps = 5/166 (3%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYF++RLLDEA+QC+EELKSP+Y+PE+VK+AISLGL+K+PP V+P+ KL
Sbjct  617  ELERKTKSLLEEYFNVRLLDEAMQCVEELKSPSYHPELVKEAISLGLEKNPPLVEPIAKL  676

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +     LG+GC  + S+LDD+ +DLPKAP +FG+I+G LV A   +  +V E
Sbjct  677  LKHLISKNVLTCEDLGAGCLLYGSMLDDIGIDLPKAPNSFGEILGELVSAKVSDVKLVRE  736

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            +LK + D+++ K V  A+++ V  +PS      SQA  +EACRSLL
Sbjct  737  VLKKMEDDWFRKTVLDAVIKSVGETPS-----TSQAEELEACRSLL  777



>ref|XP_010539464.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010539465.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
isoform X2 [Tarenaya hassleriana]
Length=780

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E +KRKT +LL+E+FS+R+L+EALQC+EEL SP Y+ E+VK+AISLGL+KSP CV+P  K
Sbjct  615  EVVKRKTKSLLEEFFSVRILEEALQCVEELGSPWYHAEIVKEAISLGLEKSPSCVEPTAK  674

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+YL  K    +  + +GC  + SLLDD  +DLPKAP NFG+I+GRL+L GG+ F +V 
Sbjct  675  LLDYLLSKNAITAKDMETGCLLYGSLLDDAGIDLPKAPNNFGEIVGRLILGGGLTFKVVR  734

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E+LK + ++ + K V  A +RVV SS  G ++L+S+A++VEAC++L
Sbjct  735  EVLKKVEEDSFQKAVVDAAVRVVGSSEQGRSLLESEASDVEACQNL  780



>emb|CAJ42901.1| putative eukaryotic translation initiation factor 4 gamma [Oryza 
glaberrima]
Length=793

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  685   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  793



>emb|CAJ42900.1| putative eukaryotic translation initiation factor 4 gamma [Oryza 
glaberrima]
Length=793

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  685   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  793



>emb|CAJ42899.1| putative eukaryotic translation initiation factor 4 gamma [Oryza 
glaberrima]
Length=790

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  622   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  681

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  682   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  741

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  742   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  790



>emb|CBA10132.1| putative eukaryotic translation initiation factor 4 gamma [Oryza 
glaberrima]
Length=740

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  572   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  631

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  632   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  691

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  692   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  740



>sp|Q84PB3.2|IF4G1_ORYSJ RecName: Full=Eukaryotic translation initiation factor isoform 
4G-1; Short=eIF(iso)-4G-1; Short=eIF(iso)4G-1; AltName: Full=Eukaryotic 
initiation factor iso-4F subunit p82; Short=eIF-(iso)4F 
p82 subunit [Oryza sativa Japonica Group]
Length=793

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  685   RLLEHLHAKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  793



>ref|XP_008669212.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Zea mays]
 tpg|DAA37098.1| TPA: hypothetical protein ZEAMMB73_550956 [Zea mays]
Length=786

 Score =   182 bits (462),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL++KT+ALL+EYF IR+LDEA QCI EL+SP YYPE+VK+A++L LDK    VDP+V+L
Sbjct  618  ELQKKTIALLEEYFGIRILDEAHQCIVELQSPDYYPEIVKEAVNLALDKGTNFVDPLVRL  677

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            LE+L+ KKIF +  L SGC  + +LLDD+ +DLPKAP  FG+II RL L G + F  +  
Sbjct  678  LEHLYTKKIFKTQDLESGCLLYGTLLDDIGIDLPKAPAQFGEIIARLTLLGALRFEALEV  737

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATN--VEACRSLLQ  496
            ILK + D +  K V +A M+ + ++PSG AIL S A    ++AC SLL+
Sbjct  738  ILKKMEDTYNRKAVSNAFMKTLEANPSGQAILGSPAAAAVIDACNSLLE  786



>ref|XP_002864533.1| hypothetical protein ARALYDRAFT_495887 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40792.1| hypothetical protein ARALYDRAFT_495887 [Arabidopsis lyrata subsp. 
lyrata]
Length=774

 Score =   181 bits (460),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E L+RKT +LL+EYF++RL DEALQC+EEL SP+Y+PE VK+AISL L+KSPP V+P+  
Sbjct  615  EVLQRKTKSLLEEYFNVRLRDEALQCVEELGSPSYHPEFVKEAISLSLEKSPPVVEPIAD  674

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LLEYL  KK+     L +G   + ++LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V 
Sbjct  675  LLEYLLSKKVLTPKDLETGFLLYGAMLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVR  734

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNV  520
            EI+  + D+ + K V +A +R+V SS  G ++L SQA +V
Sbjct  735  EIIGKMEDDRFQKMVANAALRIVESSEQGKSLLASQAADV  774



>ref|XP_009126808.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1 
[Brassica rapa]
Length=770

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E LK KT +LL+EYF++RLLDEA+QC+ +L SP+Y+ E V +AI+L L+KSPP V+P+  
Sbjct  605  EVLKSKTKSLLEEYFNVRLLDEAMQCLVDLASPSYHAEFVNEAITLALEKSPPVVEPIAS  664

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL YL  KK+     L +GC  F ++LDD+ +DLPKAP NFG+I+G+L++ GG++F  V 
Sbjct  665  LLVYLLSKKVVTPKDLETGCLMFGAMLDDVGIDLPKAPNNFGEIVGKLIVTGGVDFKFVR  724

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E+L  + D+ + K V  A +R+V SS  G ++L SQA +VEACR+L
Sbjct  725  EVLGKMEDDRFQKAVIDAAVRIVESSEQGKSLLASQAADVEACRNL  770



>emb|CDY32742.1| BnaA02g08040D [Brassica napus]
Length=770

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E LK KT +LL+EYF++RLLDEA+QC+ +L SP+Y+ E V +AI+L L+KSPP V+P+  
Sbjct  605  EVLKSKTKSLLEEYFNVRLLDEAMQCLVDLASPSYHAEFVNEAITLALEKSPPVVEPIAS  664

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL YL  KK+     L +GC  F ++LDD+ +DLPKAP NFG+I+G+L++ GG++F  V 
Sbjct  665  LLVYLLSKKVVTPKDLETGCLMFGAMLDDVGIDLPKAPNNFGEIVGKLIVTGGVDFKFVR  724

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E+L  + D+ + K V  A +R+V SS  G ++L SQA +VEACR+L
Sbjct  725  EVLGKMEDDRFQKAVIDAAVRIVESSEQGKSLLASQAADVEACRNL  770



>gb|EEC77567.1| hypothetical protein OsI_16505 [Oryza sativa Indica Group]
Length=761

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  593   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  652

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V
Sbjct  653   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVV  712

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  713   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  761



>ref|XP_006653567.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Oryza brachyantha]
Length=824

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++K V+LL+EYF IR+LDEA  CIEEL+ P +YPEVVK+AI+L LDK P   DP+V
Sbjct  656   PAAVQKKIVSLLEEYFGIRILDEAQHCIEELQCPDHYPEVVKEAINLALDKGPNFTDPLV  715

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +ASLL+D+ +DLP AP+ FG+++ RL  + G++F +V
Sbjct  716   RLLEHLHTKKIFKTEDLKTGCLLYASLLEDIGIDLPLAPSLFGEVVARLSFSCGLSFGVV  775

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F AIM+ + ++ SG AIL S +  V+AC +LL+
Sbjct  776   EEILKAVEDTYFRKGIFDAIMKTMGANSSGQAILSSHSDVVDACNNLLK  824



>emb|CAJ42898.1| putative eukaryotic translation initiation factor 4 gamma [Oryza 
sativa Indica Group]
Length=793

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V
Sbjct  685   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  793



>emb|CAC09503.2| H0711G06.9 [Oryza sativa Indica Group]
Length=792

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  624   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  683

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V
Sbjct  684   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVV  743

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  744   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  792



>gb|AAO72569.1| eukaryotic initiation factor-like protein [Oryza sativa Japonica 
Group]
Length=792

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  624   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  683

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V
Sbjct  684   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVV  743

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  744   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  792



>emb|CAJ42897.1| putative eukaryotic translation initiation factor 4 gamma [Oryza 
sativa Indica Group]
Length=793

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V
Sbjct  685   RLLEHLHTKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D ++ K +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  793



>emb|CDY02774.1| BnaC02g11150D [Brassica napus]
Length=772

 Score =   179 bits (455),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E LK KT +LL+EYF +RLLDEA+QC+ +L SP+Y+ E V +AI+L L+++PP V+P+  
Sbjct  607  EVLKSKTKSLLEEYFDLRLLDEAMQCLVDLASPSYHAEFVNEAITLALERNPPVVEPIAS  666

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL YL  KK+     L +GC  F ++LDD+ +DLPKAP NFG+I+G+L++AGG++F  V 
Sbjct  667  LLVYLLSKKVVTPKDLETGCLMFGAMLDDVGIDLPKAPNNFGEIVGKLIVAGGVDFKFVK  726

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
            E+L  + D+ + K V  A +R+V SS  G ++L SQA +VEACR+L
Sbjct  727  EVLGKMEDDRFQKAVVDAAVRIVESSEQGKSLLASQAADVEACRNL  772



>gb|AGQ04568.1| rice yellow mottle virus 1-like protein, partial [Oryza longistaminata]
 gb|AGQ04569.1| rice yellow mottle virus 1-like protein, partial [Oryza barthii]
 gb|AGQ04571.1| rice yellow mottle virus 1-like protein, partial [Oryza glaberrima]
Length=154

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  957  FSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKKIFDSN  778
            F IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V+LLE+L  KKIF + 
Sbjct  1    FGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHTKKIFKTE  60

Query  777  VLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKD  598
             L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V EILK + D ++ K 
Sbjct  61   DLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVVEEILKAVEDTYFRKG  120

Query  597  VFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  121  IFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  154



>gb|AGQ04573.1| rice yellow mottle virus 1-like protein, partial [Oryza sativa 
Japonica Group]
Length=154

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  957  FSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKKIFDSN  778
            F IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V+LLE+L  KKIF + 
Sbjct  1    FGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHAKKIFKTE  60

Query  777  VLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKD  598
             L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V EILK + D ++ K 
Sbjct  61   DLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVVEEILKAVEDTYFRKG  120

Query  597  VFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  121  IFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  154



>ref|XP_004953072.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Setaria italica]
Length=757

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L++K V+LL+EYF + +LDEA QCIEELKSP YYPEVVK+AI+L LDK    +DP+VKLL
Sbjct  590  LQKKAVSLLEEYFHVCILDEAQQCIEELKSPDYYPEVVKEAINLALDKGANSIDPLVKLL  649

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            E+L  K IF +  L +GC  + SLLDDLA+DLPKAP +FG+++GRL+L+  +   ++ + 
Sbjct  650  EHLHSKNIFKTVDLETGCLLYGSLLDDLAIDLPKAPAHFGEVVGRLILSRCLGIGVLEDT  709

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            LK + D F+   VF A   V+ +  SG AIL S    +EAC +LL
Sbjct  710  LKKMEDTFFRSAVFKAATTVIGAHSSGQAILSSHIAEIEACSNLL  754



>gb|AGQ04570.1| rice yellow mottle virus 1-like protein, partial [Oryza meridionalis]
Length=154

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 111/154 (72%), Gaps = 0/154 (0%)
 Frame = -2

Query  957  FSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKKIFDSN  778
            F IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V+LLE+L  KK+F + 
Sbjct  1    FGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHTKKLFKTE  60

Query  777  VLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKD  598
             L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V EILK + D ++ K 
Sbjct  61   DLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVVEEILKAVEDTYFRKG  120

Query  597  VFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  121  IFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  154



>gb|AGQ04567.1| rice yellow mottle virus 1-like protein, partial [Oryza glumipatula]
Length=154

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  957  FSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKKIFDSN  778
            F IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V+LLE+L  KKIF + 
Sbjct  1    FGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHTKKIFKTE  60

Query  777  VLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKD  598
             L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V EILK + D ++ K 
Sbjct  61   DLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSNGLSFEVVEEILKAVEDAYFRKG  120

Query  597  VFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +  A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  121  ILDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  154



>ref|XP_009418536.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-1-like 
[Musa acuminata subsp. malaccensis]
Length=772

 Score =   176 bits (446),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 121/169 (72%), Gaps = 0/169 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P EL +KTVALL+EYF IR+LDEALQC+EELKSP Y+PEVVK+AI+L LDK P CV+ ++
Sbjct  602   PMELHKKTVALLEEYFHIRILDEALQCVEELKSPEYHPEVVKEAINLALDKGPSCVELLM  661

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             KLLE+L  KK+F    LG+GC  + ++LDD+ +DLPKAP  FG+++G+L+L  G++F +V
Sbjct  662   KLLEHLLIKKVFTPRDLGTGCLLYGAMLDDVGIDLPKAPAFFGEVVGKLILVHGVDFKVV  721

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
              EILK + D  +   +F  ++R +  SP G   L   A  + AC+ L+ 
Sbjct  722   EEILKKVEDANFQSAIFDCVLRTLQPSPDGQPPLSEYAAEINACKKLIH  770



>gb|AGQ04566.1| rice yellow mottle virus 1-like protein, partial [Oryza rufipogon]
Length=154

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 110/154 (71%), Gaps = 0/154 (0%)
 Frame = -2

Query  957  FSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKKIFDSN  778
            F IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V+LLE+L  KKIF + 
Sbjct  1    FGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHTKKIFKTE  60

Query  777  VLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKD  598
             L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V EILK + + ++ K 
Sbjct  61   DLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVVEEILKAVENTYFRKG  120

Query  597  VFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  121  IFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  154



>gb|AGQ04572.1| rice yellow mottle virus 1-like protein, partial [Oryza sativa 
Indica Group]
Length=153

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = -2

Query  957  FSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKKIFDSN  778
            F IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V+LLE+L  KKIF + 
Sbjct  1    FGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLVRLLEHLHTKKIFKTE  60

Query  777  VLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKD  598
             L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+  ++F +V EILK + D ++ K 
Sbjct  61   DLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCSLSFEVVEEILKAV-DTYFRKG  119

Query  597  VFSAIMRVVSSSPSGNAILDSQATNVEACRSLLQ  496
            +F A+M+ +  + SG AIL S A  ++AC  LL+
Sbjct  120  IFDAVMKTMGGNSSGQAILSSHAVVIDACNKLLK  153



>ref|XP_010417143.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
Length=741

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFS+RLL EALQC+EELKSP+Y+PE+VK+AISLGL+K+PP V+P+ KL
Sbjct  591  ELERKTKSLLEEYFSVRLLGEALQCVEELKSPSYHPELVKEAISLGLEKNPPLVEPIAKL  650

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +     LG+GC  + S+LDD+ +DLPKAP +FG+I+G LV A  + F  V E
Sbjct  651  LKHLISKNVLTCEDLGAGCFLYGSMLDDIGIDLPKAPNSFGEILGELVSAKALEFEFVGE  710

Query  636  ILKNIGDNFYLKDVFSAIMRVV---SSSPSG  553
            ++K I D ++   V  A+ + +   S SPSG
Sbjct  711  VVKKIEDEWFRNIVLEAVSKSITAASESPSG  741



>ref|XP_010472401.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
Length=737

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFS+RLL EALQC+EELKSP+Y+PE+VK+AISLGL+K+PP V+P+ KL
Sbjct  587  ELERKTKSLLEEYFSVRLLGEALQCVEELKSPSYHPELVKEAISLGLEKNPPLVEPIAKL  646

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +     LG+GC  + S+LDD+ +DLPKAP +FG+I+G LV A  + F  V E
Sbjct  647  LKHLISKNVLTCEDLGAGCFLYGSMLDDIGIDLPKAPNSFGEILGELVSAKALEFEFVGE  706

Query  636  ILKNIGDNFYLKDVFSAIMRVVSS---SPSG  553
            ++K + D ++   V  A+ + +S+   SPSG
Sbjct  707  VVKKMEDEWFRNIVVEAVSKSISAASESPSG  737



>ref|XP_010429358.1| PREDICTED: eukaryotic translation initiation factor isoform 4G-2-like 
[Camelina sativa]
Length=736

 Score =   167 bits (424),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL+RKT +LL+EYFS+RLL EALQC+EELKSP+Y+PE+VK+AISLGL+K+PP V+P+ KL
Sbjct  586  ELERKTKSLLEEYFSVRLLGEALQCVEELKSPSYHPELVKEAISLGLEKNPPLVEPIAKL  645

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L++L  K +     LG+GC  + S+LDD+ +DLPKAP +FG+I+G LV A  + F  V E
Sbjct  646  LKHLISKNVLTCEDLGAGCLLYGSMLDDIGIDLPKAPKSFGEILGELVSAKALEFDFVGE  705

Query  636  ILKNIGDNFYLKDVFSAIMRVV---SSSPSG  553
            +LK + D ++   V  A  + +   S SPSG
Sbjct  706  VLKKMEDEWFRTIVLEAASKCISEASESPSG  736



>gb|EEE61263.1| hypothetical protein OsJ_15338 [Oryza sativa Japonica Group]
Length=903

 Score =   166 bits (421),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  685   RLLEHLHAKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSG  553
              EILK + D ++ K +F A+M+ +  + SG
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSG  774



>emb|CAE01628.3| OSJNBa0029H02.9 [Oryza sativa Japonica Group]
Length=923

 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P  +++KTV+LL+EYF IR+LDEA QCIEEL+ P YY E+VK+AI+L LDK P  +DP+V
Sbjct  625   PAAVQKKTVSLLEEYFGIRILDEAQQCIEELQCPEYYSEIVKEAINLALDKGPNFIDPLV  684

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
             +LLE+L  KKIF +  L +GC  +A+LL+D+ +DLP AP  FG+++ RL L+ G++F +V
Sbjct  685   RLLEHLHAKKIFKTEDLKTGCLLYAALLEDIGIDLPLAPALFGEVVARLSLSCGLSFEVV  744

Query  642   NEILKNIGDNFYLKDVFSAIMRVVSSSPSG  553
              EILK + D ++ K +F A+M+ +  + SG
Sbjct  745   EEILKAVEDTYFRKGIFDAVMKTMGGNSSG  774



>emb|CBI36548.3| unnamed protein product [Vitis vinifera]
Length=630

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++L+RKTV+LL+EYF +R+LDEALQC+EELKSPAY+PEVVK+AISL L+KSPPCVDPV K
Sbjct  540  DDLRRKTVSLLEEYFGVRILDEALQCVEELKSPAYHPEVVKEAISLALEKSPPCVDPVAK  599

Query  819  LLEYLFEKKIFDSNVLGSGC  760
            LLE+LF KK+  +  +G+GC
Sbjct  600  LLEFLFSKKVLTTMDIGTGC  619



>gb|EYU25308.1| hypothetical protein MIMGU_mgv1a018093mg, partial [Erythranthe 
guttata]
Length=208

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E +K K  +LLDE+F+ R+L+E LQ + EL SP Y+PE V++ + + L K PPC +    
Sbjct  41   ELMKGKITSLLDEFFTNRVLEETLQRVVELNSPEYHPEFVREGLYVALKKGPPCHNQFSL  100

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+E+LF+  + ++  +GSGC  +A+ L  L++D P     FG+IIG LV+A  + F + N
Sbjct  101  LMEHLFDCNVLNAEDIGSGCLVYATTLCGLSIDTPDM---FGEIIGNLVMAEAMGFKVFN  157

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILD  538
            EIL+ + D +Y + +F A M++V +     A L 
Sbjct  158  EILEKVEDKYYKRPLFIAAMKIVDTRVMAEAFLH  191



>gb|EYU25307.1| hypothetical protein MIMGU_mgv11b020545mg [Erythranthe guttata]
Length=166

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 98/165 (59%), Gaps = 5/165 (3%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCI-EELKSPAYYPEVVKQAISLGLDKSPP-CVDPVVK  820
            +KRK  ++LDE+F+ ++L+E LQ + +EL+SP Y+P  V++ IS+ + K PP C +    
Sbjct  1    MKRKISSILDEFFTNKVLEETLQRVDQELESPEYHPRFVREGISVAIKKRPPHCHNQFSL  60

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            L+EYLF++ +  +  +G GC  +A+ L  L +        FG+IIG L+LA  ++  + N
Sbjct  61   LIEYLFDRDVVSAEDIGRGCILYATSLRGLFIGTADI---FGEIIGDLLLARVLDLKVFN  117

Query  639  EILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRS  505
            +I+  + D  Y + + SA M+VV +     A+++     + AC S
Sbjct  118  KIVAKVEDKSYKEAIISAAMKVVKTGDEIEALVEEFRVALSACSS  162



>ref|XP_002967145.1| hypothetical protein SELMODRAFT_30927, partial [Selaginella moellendorffii]
 gb|EFJ31744.1| hypothetical protein SELMODRAFT_30927, partial [Selaginella moellendorffii]
Length=589

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 93/165 (56%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L +K+ +LL+EYFSI  L EA  CI+E+KSP Y+P+ V+ A++L L+K     + + KL 
Sbjct  425  LNKKSESLLEEYFSIMDLTEATLCIQEMKSPDYHPQFVQVAVTLALEKRDRERELLFKLF  484

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
             +L  + +     L SG    A  LD+ A+D P AP   G ++  L  +  +   I+  I
Sbjct  485  NHLHAQGVVTEAQLASGLMLLAEQLDETAIDSPMAPKQIGQLVAALATSRALQLKILPGI  544

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            L+ + D +  + V  A+++ + S   G+ ++ S  +++++C  LL
Sbjct  545  LEKVQDEYVRRQVLEAVLKDLKSRDGGDKVMVSARSDLKSCVKLL  589



>gb|AAK62591.1| AT5g57870/MTI20_13 [Arabidopsis thaliana]
 gb|AAK91491.1| AT5g57870/MTI20_13 [Arabidopsis thaliana]
Length=81

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  744  LLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLKDVFSAIMRVVSS  565
            +LDD+ +DLPKAP NFG+I+G+L+LAGG++F +V EI+  + D+ + K V  A +R+V S
Sbjct  1    MLDDIGIDLPKAPNNFGEIVGKLILAGGVDFKLVREIIGKMEDDRFQKMVVDAAVRIVES  60

Query  564  SPSGNAILDSQATNVEACRSL  502
            S  G ++L SQA ++EACR+L
Sbjct  61   SEQGKSLLASQAADIEACRNL  81



>ref|XP_002960868.1| hypothetical protein SELMODRAFT_437322 [Selaginella moellendorffii]
 gb|EFJ38407.1| hypothetical protein SELMODRAFT_437322 [Selaginella moellendorffii]
Length=780

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 93/165 (56%), Gaps = 0/165 (0%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            L +K+ +LL+EYFSI  L EA  CI+E+KSP Y+P+ V+ A++L L+K     + + KL 
Sbjct  598  LNKKSESLLEEYFSIMDLTEATLCIQEMKSPDYHPQFVQVAVTLALEKRDRERELLFKLF  657

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
             +L  + +     L SG    A  LD+ A+D P AP   G ++  L  +  +   I+  I
Sbjct  658  NHLHAQGVVTEAQLASGLMLLAEQLDETAIDSPMAPKQIGQLVAALATSRALQLKILPGI  717

Query  633  LKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSLL  499
            L+ + D +  + V  A+++ + S   G+ ++ S  +++++C  LL
Sbjct  718  LEKVQDEYVRRQVLEAVLKDLKSRDGGDKVMVSARSDLKSCVKLL  762



>ref|XP_001764043.1| predicted protein [Physcomitrella patens]
 gb|EDQ71182.1| predicted protein [Physcomitrella patens]
Length=815

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 90/165 (55%), Gaps = 9/165 (5%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            +L +++ +LL EYFSI  L+EAL C++ELK+P+++PE V+ AIS  L+        V+KL
Sbjct  639  DLVKRSESLLKEYFSIVDLNEALLCVQELKNPSFHPEFVRIAISTALEMREKESGLVLKL  698

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L +L  K +  S  L  G    A  L+D+AMD P AP   G +I  L+L+      ++ E
Sbjct  699  LVHLQSKGVVSSEDLRGGVVMVAEGLEDMAMDAPLAPKQLGGMIAGLILSEASEVRLMQE  758

Query  636  ILKNIGDNFYLKDVFSAIMRVVSSSPSGNAILDSQATNVEACRSL  502
                I D F  KDV  A++         N + +++A   E CR +
Sbjct  759  AAAKIEDEFLQKDVLKAVV---------NKLKENEAQVGEVCRKV  794



>ref|XP_001764039.1| predicted protein [Physcomitrella patens]
 gb|EDQ71178.1| predicted protein, partial [Physcomitrella patens]
Length=721

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 0/139 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +K+ +LL EYFSI  L+EAL C++ELK P+++PE V+ AIS  L+        V+KL
Sbjct  576  ELTKKSESLLKEYFSIVDLNEALLCVQELKKPSFHPEFVRIAISTALEMREKECGLVLKL  635

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L +L  K +  S  L  G    A  L+D+AMD P AP   G +I  L+L+      ++ E
Sbjct  636  LVHLQSKGVVSSEDLRGGVVMVAEGLEDMAMDAPLAPKQLGGMIAGLILSEASEVRLMQE  695

Query  636  ILKNIGDNFYLKDVFSAIM  580
                + D F  KDV  A++
Sbjct  696  AAAKMEDEFLQKDVLKAVV  714



>ref|XP_001763974.1| predicted protein [Physcomitrella patens]
 gb|EDQ71113.1| predicted protein, partial [Physcomitrella patens]
Length=700

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 0/139 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +K+ +LL EYFSI  L+EAL C++ELK P+++PE V+ AIS  L+        V+KL
Sbjct  562  ELTKKSESLLKEYFSIVDLNEALLCVQELKKPSFHPEFVRIAISTALEMREKECGLVLKL  621

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L +L  K +  S  L  G    A  L+D+AMD P AP   G +I  L+L+      ++ E
Sbjct  622  LVHLQSKGVVSSEDLRGGVVMVAEGLEDMAMDAPLAPKQLGGMIAGLILSEASEVWLMQE  681

Query  636  ILKNIGDNFYLKDVFSAIM  580
                + D F  KDV  A++
Sbjct  682  AAAKMEDEFLQKDVLKAVV  700



>ref|XP_001758887.1| predicted protein [Physcomitrella patens]
 gb|EDQ76393.1| predicted protein, partial [Physcomitrella patens]
Length=691

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 0/139 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +K+ +LL EY SI  L+EA  C++ELK+P ++PE+VK AIS  LD      + V+KL
Sbjct  546  ELTKKSESLLKEYLSIVDLNEAALCVQELKNPGFHPELVKIAISTALDMREKECNLVLKL  605

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L +L  K +  S  L  G       L+D+AMD P AP   G +I  LVLAG     +V E
Sbjct  606  LLHLQSKGVISSGDLRGGVLMVMEGLEDMAMDAPLAPKQLGSMIAGLVLAGASELRLVQE  665

Query  636  ILKNIGDNFYLKDVFSAIM  580
             +  + D F  KDV   ++
Sbjct  666  AVAKLEDEFVQKDVLKGVV  684



>ref|XP_001758889.1| predicted protein [Physcomitrella patens]
 gb|EDQ76395.1| predicted protein, partial [Physcomitrella patens]
Length=688

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 0/139 (0%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            EL +K+ +LL EY SI  L+EA  C++ELK+P ++PE+VK AIS  LD      + V+KL
Sbjct  543  ELTKKSESLLKEYLSIVDLNEAALCVQELKNPGFHPELVKIAISTALDMREKECNLVLKL  602

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNE  637
            L +L  K +  S  L  G       L+D+AMD P AP   G +I  LVLAG     +V E
Sbjct  603  LLHLQSKGVISSGDLRGGVLMVMEGLEDMAMDAPLAPKQLGSMIAGLVLAGASELRLVQE  662

Query  636  ILKNIGDNFYLKDVFSAIM  580
             +  + D F  KDV   ++
Sbjct  663  AVAKLEDEFVQKDVLKGVV  681



>ref|XP_006450271.1| hypothetical protein CICLE_v10009981mg [Citrus clementina]
 gb|ESR63511.1| hypothetical protein CICLE_v10009981mg [Citrus clementina]
Length=108

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 61/104 (59%), Gaps = 0/104 (0%)
 Frame = +2

Query  581  IIAEKTSFR*KLSPIFFRISFTMLKLIPPARTSLPMMSPKLVGALGKSMARSSNRDANF*  760
            I A K   R  LS  FFR SF  +K    A T+LP +SPKL+GA GKSM  SSN +    
Sbjct  4    IAAVKMDLRNMLSSTFFRTSFKTMKSKLFATTNLPTISPKLLGAFGKSMPISSNNEPYRR  63

Query  761  QPLPKTFESKIFFSNKYSRSFTTGSTQGGLLSNPREIACFTTSG  892
            QP+P +   K F  +K SRS  TGST GG+ S  R IA  TTSG
Sbjct  64   QPVPMSLVVKTFLFSKNSRSCMTGSTHGGIFSRARAIASLTTSG  107



>ref|XP_008648420.1| PREDICTED: uncharacterized protein LOC100501384 [Zea mays]
 gb|AFW74399.1| hypothetical protein ZEAMMB73_681593 [Zea mays]
Length=720

 Score = 76.6 bits (187),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KR+   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     +VK
Sbjct  303  EEVKRRIADLLKEYIRNGDTAEACRCIRELAVPFFHHEVVKRALTLGME-SPAAEALIVK  361

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+   E+ +  S+ +  G  + A  LDDL +D+P A + F  ++ + +  G ++ S VN
Sbjct  362  LLKEASEECLVSSSQMMKGFHRVAESLDDLILDIPSAKSEFQLLVSKAISEGWLDSSYVN  421


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 3/114 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA  CI EL    +  EVVK+A+ + ++K     +  + 
Sbjct  600  EDAKDKITKLLEEYESGGDVGEACNCIRELGMSFFNHEVVKKALVMAMEKKN---ERTLN  656

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGI  658
            LL+  F + I   N +  G  +    LDDLA+D+P A   F   + R   +G +
Sbjct  657  LLQECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAREKFLSYVQRAKKSGWL  710



>dbj|BAJ94459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=720

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KR+   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     + K
Sbjct  303  EEVKRRITDLLKEYIKNGDTAEACRCIRELAVPFFHHEVVKRAVTLGME-SPAAETLIAK  361

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            LL+   E+ +  S+ +  G  +    LDDL++D+P A + F  ++ + V  G ++ S
Sbjct  362  LLKEASEEGLISSSQMAKGFSRIVESLDDLSLDIPSAKSQFQTLVSKAVSEGWLDSS  418


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA +CI E+  P +  EVVK+A+ + ++K     +  + 
Sbjct  600  EDAKDKITKLLEEYESGGDVGEACKCIREMGMPFFNHEVVKKALVMAMEKKK---EGTLA  656

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL   F + I   N +  G  +    LDDLA+D+P A   F
Sbjct  657  LLHECFGEGIITINQMTKGFSRVRDGLDDLALDIPDARDKF  697



>ref|XP_003573315.1| PREDICTED: uncharacterized protein LOC100842871 [Brachypodium 
distachyon]
Length=718

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 76/134 (57%), Gaps = 6/134 (4%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KR+   L+ EY       EA +CI EL  P ++ EVVK+A++LG++ SP     ++K
Sbjct  301  EEVKRRITDLVKEYIKNGDTTEACRCIRELAVPFFHHEVVKRAVTLGME-SPATEALIIK  359

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+   E+ +  S+ +  G  + A  LDDL++D+P A + F  ++ + V  G ++ S V 
Sbjct  360  LLKEAAEEGLISSSQMMKGFSRVAESLDDLSLDVPSAKSQFQTLVPKAVSEGWLDSSYVP  419

Query  639  EILKNIGDNFYLKD  598
                  G N +++D
Sbjct  420  S-----GANGHVQD  428


 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   L EA  CI E+  P +  EVVK+A+ + ++K     +  ++
Sbjct  598  EDAKDKIAKLLEEYESGGDLGEACNCIREMGMPFFNHEVVKKALVMAMEKK---TERTLE  654

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + I   N +  G  +    LDDLA+D+P AP  F
Sbjct  655  LLQECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAPEKF  695



>gb|EMS50754.1| Programmed cell death protein 4 [Triticum urartu]
Length=638

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KR+   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     +VK
Sbjct  221  EEVKRRITDLLKEYIKNGDTAEACRCIRELAVPFFHHEVVKRAVTLGME-SPAAETLIVK  279

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            LL+   E+ +  S+ +  G  +    LDDL++D+P A + F  ++ + V  G ++ S
Sbjct  280  LLKEASEEGLISSSQMVKGFSRIVESLDDLSLDIPSAKSQFQTLVSKAVSEGWLDSS  336


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA +CI E+  P +  EVVK+A+ + ++K   C   ++ 
Sbjct  518  EDAKDKITKLLEEYESGGDVGEACKCIREMGMPFFNHEVVKKALVMAMEKKKEC---MLA  574

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL   F + I   N +  G  +    LDDLA+D+P A   F
Sbjct  575  LLHECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAREKF  615



>gb|EMT22556.1| hypothetical protein F775_27355 [Aegilops tauschii]
Length=747

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KR+   LL EY       EA +CI EL  P ++ EVVK+A +LG++ SP     +VK
Sbjct  330  EEVKRRITDLLKEYIKNGDTAEACRCIRELAVPFFHHEVVKRAATLGME-SPAAETLIVK  388

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            LL+   E+ +  S+ +  G  +    LDDL++D+P A + F  ++ + V  G ++ S
Sbjct  389  LLKEASEEGLISSSQMVKGFSRIVESLDDLSLDIPSAKSQFQTLVSKAVSEGWLDSS  445


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA +CI E+  P +  EVVK+A+ + ++K   C    + 
Sbjct  627  EDAKDKITKLLEEYESGGDVGEACKCIREMGMPFFNHEVVKKALVMAMEKKKEC---TLS  683

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL   F + I   N +  G  +    LDDLA+D+P A   F
Sbjct  684  LLHECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAREKF  724



>ref|XP_004972984.1| PREDICTED: uncharacterized protein LOC101773560 [Setaria italica]
Length=729

 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+K++   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     +VK
Sbjct  312  EEVKKRIADLLKEYIRNGDTAEACRCIRELAVPFFHHEVVKRALTLGME-SPAAEALIVK  370

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+   E+ +  S+ +  G  + A  LDDL +D+P A + F  ++ +    G ++ S ++
Sbjct  371  LLKEASEECLISSSQMMKGFSRVAESLDDLILDIPSAKSEFQLLVSKATSEGWLDSSYMS  430


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 3/114 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA  CI EL    +  EVVK+A+ + ++K     +  + 
Sbjct  609  EDAKDKITKLLEEYESGGDVGEACNCIRELGMSFFNHEVVKKALVMAMEKKN---ERTLS  665

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGI  658
            LL+  F + I   N +  G  +    LDDLA+D+P A   F   + R   +G +
Sbjct  666  LLQECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAREKFLSYVERAKKSGWL  719



>ref|XP_011464198.1| PREDICTED: programmed cell death protein 4 [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 70.1 bits (170),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 3/121 (2%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EE+K+K   LL EY       EA +CI EL    Y+ EVVK+A+ LG++      +P++ 
Sbjct  120  EEVKKKISGLLREYVESGDTLEACRCIRELGVSFYHHEVVKRALILGMETR--TAEPLIT  177

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
            KLL+   E+ I  S+ +  G  + A  LDDLA+D+P A T F  ++ + +  G ++ S V
Sbjct  178  KLLKEAAEEGIISSSQMAKGFSRLAESLDDLALDIPSAKTLFQSLVPKAISEGWLDDSFV  237

Query  642  N  640
             
Sbjct  238  E  238


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S R++ EA QCI ++  P +  EVVK+A+ + ++K     D ++ 
Sbjct  417  EDAKDKITKLLEEYESGRVVAEACQCIRDIGMPFFNHEVVKKALVMAMEKKN---DSMLD  473

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + +   N +  G  +    LDDLA+D+P A   F
Sbjct  474  LLQECFGEGLITINQMTKGFTRIKDGLDDLALDIPNAREKF  514



>ref|XP_002444968.1| hypothetical protein SORBIDRAFT_07g002090 [Sorghum bicolor]
 gb|EES14463.1| hypothetical protein SORBIDRAFT_07g002090 [Sorghum bicolor]
Length=732

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+K++   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     + K
Sbjct  315  EEVKKRIADLLKEYIRNGDTAEACRCIRELAVPFFHHEVVKRALTLGME-SPAAEALIAK  373

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+   E+ +  S+ +  G  + A  LDDL +D+P A + F  ++ + +  G ++ S V 
Sbjct  374  LLKEASEECLISSSQMMKGFYRVAESLDDLILDIPSAKSEFQLLVSKAISEGWLDSSYVK  433


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   L EA  CI EL    +  EVVK+A+ + ++K     +  + 
Sbjct  612  EDAKDKITKLLEEYESGGDLGEACNCIRELGMSFFNHEVVKKALVMAMEKKN---ERTLS  668

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + I   N +  G  +    LDDLA+D+P A   F
Sbjct  669  LLQECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAREKF  709



>ref|XP_002295291.1| hypothetical protein THAPSDRAFT_264946 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED87357.1| hypothetical protein THAPSDRAFT_264946, partial [Thalassiosira 
pseudonana CCMP1335]
Length=345

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            E K +    + EYF     DE ++CI+ELK   Y+PEVVK+AISLGLD+ P   + V +L
Sbjct  61   EFKIRVSDAVREYFDSSDADEVVRCIDELKCREYHPEVVKRAISLGLDEGPRERELVSRL  120

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
            L  L    + D  + G G +     ++DL +D+P A    G  + R V+
Sbjct  121  LACLHPNPLRDEEMEG-GFEVLLDSIEDLVIDIPDAKAMVGSFLARAVV  168


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 56/123 (46%), Gaps = 7/123 (6%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDK-------SPPC  838
            ELK     LL EY   R LDEA  C+ ELK+  +  E+VK+ + + +++           
Sbjct  220  ELKDIMDQLLKEYLLSRELDEAASCVRELKASHFNHELVKRGVKIAMEEDGRDHASESSA  279

Query  837  VDPVVKLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGI  658
            +D +  L ++L +  I     +  G  +   ++ DL +D+P A     +  G     G +
Sbjct  280  LDAMAALFKFLVKNSIVSEYQVAKGVSRLRKIMPDLKLDVPAAERMLDEFEGMAKEGGFL  339

Query  657  NFS  649
            + S
Sbjct  340  HIS  342



>ref|NP_001060879.1| Os08g0120500 [Oryza sativa Japonica Group]
 dbj|BAD10818.1| putative MA3 domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF22793.1| Os08g0120500 [Oryza sativa Japonica Group]
 gb|EAZ05422.1| hypothetical protein OsI_27634 [Oryza sativa Indica Group]
 gb|EAZ41340.1| hypothetical protein OsJ_25855 [Oryza sativa Japonica Group]
Length=716

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            +K +   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     +VKLL
Sbjct  301  VKLRITDLLKEYIKNGDTAEACRCIRELAVPFFHHEVVKRALTLGME-SPTAEALIVKLL  359

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEI  634
            +   E+ +  S+ +  G  +    LDDL++D+P A + F  ++ + V  G ++ S V   
Sbjct  360  KEASEELLISSSQMMKGFSRVVDSLDDLSLDIPSAKSQFQTLVSKAVSEGWLDSSFV---  416

Query  633  LKNIGDNFYLKD  598
              ++G N  ++D
Sbjct  417  --HVGANGDVQD  426


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA  CI EL  P +  EVVK+A+ + ++K     D ++ 
Sbjct  596  EDTKDKIAKLLEEYESGGDVGEACNCIRELHMPFFNHEVVKKALVMAMEKKN---DRILG  652

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + I   N +  G  +    LDDLA+D+P A   F
Sbjct  653  LLQECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAREKF  693



>ref|XP_006659779.1| PREDICTED: programmed cell death protein 4-like [Oryza brachyantha]
Length=691

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (57%), Gaps = 1/118 (1%)
 Frame = -2

Query  993  LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLL  814
            +K +   LL EY       EA +CI EL  P ++ EVVK+A++LG++ SP     +VKLL
Sbjct  276  VKLRVTDLLKEYIKNGDTSEACRCIRELAVPFFHHEVVKRALTLGME-SPTAEALIVKLL  334

Query  813  EYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            +   E+ +  S+ +  G  +    LDDL++D+P A + F  ++ + V  G ++ S ++
Sbjct  335  KEASEELLISSSQMMKGFSRVVDSLDDLSLDIPSAKSQFQALVSKAVSEGWLDSSFIH  392


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S   + EA  CI EL  P +  EVVK+A+ + ++K     + ++ 
Sbjct  571  EDAKDKIAKLLEEYESGGDVGEACNCIRELHMPFFNHEVVKKALVMAMEKKN---ERILG  627

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + I   N +  G  +    LDDLA+D+P A   F
Sbjct  628  LLKECFGEGIITINQMTKGFSRVRDGLDDLALDIPDAKEKF  668



>gb|ABK23995.1| unknown [Picea sitchensis]
Length=350

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -2

Query  969  LDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKK-  793
            + EY+S+  +DEA  C++ELK+P ++ ++V Q ++   D++    D + KLL YL  +K 
Sbjct  3    IKEYYSVIDMDEAALCMDELKAPWFHSKIVSQWVTDSFDRNNVERDLLAKLLIYLCNEKP  62

Query  792  -IFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIG  619
             +     L +G     S L++  +D P+AP  FG IIG+LV+A  ++F+    I+K  G
Sbjct  63   NLLSHEQLLTGLGISLSSLEETVVDAPRAPEFFGVIIGKLVVAEILSFAESARIIKEGG  121



>ref|XP_002899252.1| programmed cell death protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY62221.1| programmed cell death protein, putative [Phytophthora infestans 
T30-4]
Length=409

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EELK     L  EY   R L+EA +C+ EL  P ++ EVVK+ I+  L++        + 
Sbjct  283  EELKVAIDQLTKEYLLSRDLEEAARCVRELNVPHFHHEVVKRGITNSLEEGGEANSAAMA  342

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAG  664
             LL YL   ++  +  L  G ++F  +LDD+A+D+P A   F DI+ R +  G
Sbjct  343  SLLAYLVSNEVVSTGQLVKGFERFKFVLDDVALDIPNAAALFKDIVARGISDG  395


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P E+K++ + +L+EYF+    DE L  + +L  P +  EVVK+AI++ +DK+    +   
Sbjct  123   PPEIKKRIIEILEEYFTSGDADEVLSSLNDLDEPEFNYEVVKRAITMAMDKNDKERELAS  182

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
             +LL  L+   +    VL  G ++   L  DL +D+P A         R V+
Sbjct  183   RLLSTLYLDGLTAGQVL-MGFRRVLLLAGDLQIDIPTAKNMLAIFCARAVV  232



>ref|XP_002902694.1| eukaryotic translation initiation factor 4 gamma 2, putative 
[Phytophthora infestans T30-4]
 gb|EEY56620.1| eukaryotic translation initiation factor 4 gamma 2, putative 
[Phytophthora infestans T30-4]
Length=1405

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 43/145 (30%), Positives = 73/145 (50%), Gaps = 1/145 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P ++  +  +++ EY SI  LDEA  C++EL    Y+ E  +Q I+  L+      +  V
Sbjct  1057  PAQMSTRIKSIIQEYLSIADLDEASTCVQELPVDPYHVEFTEQVINTALEGKTNEREHAV  1116

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS-I  646
             +LL  L+E+ + D+N + S        L+D+ +DLP        I GRLV AG    + I
Sbjct  1117  ELLVGLYERGVLDANSIQSALVNVMEFLEDMKIDLPLIHQYSALIFGRLVAAGCFGLTWI  1176

Query  645   VNEILKNIGDNFYLKDVFSAIMRVV  571
             ++E L +  +      VF  ++ V+
Sbjct  1177  ISEALAHCVECKLTSLVFPEVLSVL  1201



>gb|ETO77485.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=406

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EELK     L  EY   R L+EA +C+ EL  P ++ EVVK+ I+  L++        + 
Sbjct  280  EELKVAIDQLTKEYLLSRDLEEAARCVRELNVPHFHHEVVKRGITNSLEEGGEANSAAMA  339

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAG  664
             LL YL   ++  +  L  G ++F  +LDD+A+D+P A   F DI+ R +  G
Sbjct  340  SLLAYLVSNEVVSTGQLIKGFERFKFVLDDVALDIPNAAALFKDIVARGISDG  392


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P E+K++ + +L+EYF+    DE L  + +L  P +  EVVK+AI++ +DK+    +   
Sbjct  120   PPEIKKRIIVILEEYFTSGDADEVLSSLNDLDEPEFNYEVVKRAITMAMDKNDKERELAS  179

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
             +LL  L+   +    V+  G ++   L  DL +D+P A         R V+
Sbjct  180   RLLSALYLDGLTAGQVI-MGFRRVLLLAGDLQIDIPTAKNMLAIFCARAVV  229



>gb|ETO77484.1| hypothetical protein F444_07332 [Phytophthora parasitica P1976]
Length=408

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EELK     L  EY   R L+EA +C+ EL  P ++ EVVK+ I+  L++        + 
Sbjct  282  EELKVAIDQLTKEYLLSRDLEEAARCVRELNVPHFHHEVVKRGITNSLEEGGEANSAAMA  341

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAG  664
             LL YL   ++  +  L  G ++F  +LDD+A+D+P A   F DI+ R +  G
Sbjct  342  SLLAYLVSNEVVSTGQLIKGFERFKFVLDDVALDIPNAAALFKDIVARGISDG  394


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P E+K++ + +L+EYF+    DE L  + +L  P +  EVVK+AI++ +DK+    +   
Sbjct  122   PPEIKKRIIVILEEYFTSGDADEVLSSLNDLDEPEFNYEVVKRAITMAMDKNDKERELAS  181

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
             +LL  L+   +    V+  G ++   L  DL +D+P A         R V+
Sbjct  182   RLLSALYLDGLTAGQVI-MGFRRVLLLAGDLQIDIPTAKNMLAIFCARAVV  231



>gb|ETM48417.1| hypothetical protein L914_07044 [Phytophthora parasitica]
Length=408

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 1/113 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EELK     L  EY   R L+EA +C+ EL  P ++ EVVK+ I+  L++        + 
Sbjct  282  EELKVAIDQLTKEYLLSRDLEEAARCVRELNVPHFHHEVVKRGITNSLEEGGEANSAAMA  341

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAG  664
             LL YL   ++  +  L  G ++F  +LDD+A+D+P A   F DI+ R +  G
Sbjct  342  SLLAYLVSNEVVSTGQLIKGFERFKFVLDDVALDIPNAAALFKDIVARGISDG  394


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P E+K++ + +L+EYF+    DE L  + +L  P +  EVVK+AI++ +DK+    +   
Sbjct  122   PPEIKKRIIVILEEYFTSGDADEVLSSLNDLDEPEFNYEVVKRAITMAMDKNDKERELAS  181

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
             +LL  L+   +    VL  G ++   L  DL +D+P A         R V+
Sbjct  182   RLLSALYLDGLTAGQVL-MGFRRVLLLAGDLQIDIPTAKNMLAIFCARAVV  231



>ref|XP_009524165.1| hypothetical protein PHYSODRAFT_491686, partial [Phytophthora 
sojae]
 gb|EGZ21448.1| hypothetical protein PHYSODRAFT_491686, partial [Phytophthora 
sojae]
Length=1218

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 72/145 (50%), Gaps = 1/145 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P ++  +   ++ EY SI  LDEA  C++EL    Y+ E  +QAI+  L+      +  V
Sbjct  827   PAQMSSRIKNIIQEYISILDLDEATTCVQELAVDPYHVEFAEQAINTALEGKTSEREHAV  886

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS-I  646
             +LL  L+E+   D+N + +        L+D+ +DLP        I GRLV AG    S I
Sbjct  887   ELLVGLYERGALDANSIQAALTNVMEFLEDMRIDLPLIHQYSALIFGRLVAAGCFGLSWI  946

Query  645   VNEILKNIGDNFYLKDVFSAIMRVV  571
             ++E L +  +      VF  ++ V+
Sbjct  947   ISEALAHCVECKLTSLVFPEVLSVL  971



>gb|EJK59532.1| hypothetical protein THAOC_20224 [Thalassiosira oceanica]
Length=454

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 60/109 (55%), Gaps = 1/109 (1%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKL  817
            E K +    + EYF     DE ++CI E+K   Y+PEVVK+A+SLGLD+ P   + V +L
Sbjct  161  EFKIRVSDAVREYFDSSDADEVVRCIHEMKCNEYHPEVVKRAVSLGLDEGPRERELVSRL  220

Query  816  LEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
            L  L    + D   +G G +     +DDL +D+P A +  G  + R V+
Sbjct  221  LACLHPVPLTDEE-MGMGFEVLLDSIDDLVIDIPDAKSMVGCFLARAVV  268


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 53/104 (51%), Gaps = 7/104 (7%)
 Frame = -2

Query  996  ELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDK-------SPPC  838
            ELK     LL EY   R LDEA  C+ ELK+P ++ E+VK+ I + +++           
Sbjct  320  ELKDAIDQLLKEYLMSRELDEAASCVRELKAPHFHHELVKRGIKIAIEEDGHNHTSESSS  379

Query  837  VDPVVKLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAP  706
            +D +  L ++L +  I     +G G  +    L DL +D+P AP
Sbjct  380  LDAMAALFKFLVDNSIVSEYQVGKGASRLRRALPDLTLDVPAAP  423



>ref|XP_010534749.1| PREDICTED: programmed cell death protein 4-like, partial [Tarenaya 
hassleriana]
Length=480

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S  ++ EA QCI EL  P +  EVVK+A+ + ++K     D ++ 
Sbjct  360  EDAKDKIWKLLEEYESSGVVSEACQCIRELGLPFFNHEVVKKALVMAMEKKN---DRMLD  416

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
            LL+  F + +  +N +  G  +    LDDLA+D+P A   F   +G     G ++ S V
Sbjct  417  LLQESFSEGLITTNQMTKGFTRVKDALDDLALDIPNAEEKFSVYVGHGQKNGWLSSSFV  475


 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EE+K+K   LL EY   +   EA +CI EL    ++ EVVK+A+   ++   P  +P++ 
Sbjct  63   EEVKKKIAELLREYVDNKDTYEACRCIRELGVSFFHHEVVKKALITAME--IPTAEPLIF  120

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            KLL+   ++ +  S+ +  G  +    LDDLA+D+P A T FG I+   V  G ++ S
Sbjct  121  KLLKEAAKENLVSSSQMVKGFSRLGESLDDLALDIPSAKTLFGSIVSNAVSEGWLDAS  178



>ref|NP_567708.1| MA3 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031708.1| MA3 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001190828.1| MA3 domain-containing protein [Arabidopsis thaliana]
 gb|AAL32978.1| AT4g24800/F6I7_10 [Arabidopsis thaliana]
 gb|AAM70587.1| AT4g24800/F6I7_10 [Arabidopsis thaliana]
 gb|AEE84959.1| MA3 domain-containing protein [Arabidopsis thaliana]
 gb|AEE84960.1| MA3 domain-containing protein [Arabidopsis thaliana]
 gb|AEE84961.1| MA3 domain-containing protein [Arabidopsis thaliana]
Length=702

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+K+K   +L+EY       EA +C+ EL    ++ EVVK+A+   L+       PV+K
Sbjct  279  EEVKKKIADILNEYVETGETYEACRCVRELGVSFFHHEVVKRALVTALENHAAEA-PVLK  337

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            LL     + +  S+ +  G  +    LDDLA+D+P A T FG I+ + V  G ++ S
Sbjct  338  LLNEAASENLISSSQMVKGFSRLRESLDDLALDIPSARTKFGLIVPKAVSGGWLDAS  394


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S  L+ EA +CI EL  P +  EVVK+A+ +G++K    +  ++ 
Sbjct  576  EDAKDKISNLLEEYESSGLVSEACKCIHELGMPFFNHEVVKKALVMGMEKKKDKM--MLD  633

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+  F + +  +N +  G  +    L+DLA+D+P A   F D +      G ++ S + 
Sbjct  634  LLQESFSEGLITTNQMTKGFTRVKDGLEDLALDIPNAKEKFNDYVEYGKKNGWVSSSFLT  693

Query  639  EILK--NIG  619
             + +  N+G
Sbjct  694  SLTEDANVG  702



>dbj|BAD95421.1| hypothetical protein [Arabidopsis thaliana]
Length=702

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+K+K   +L+EY       EA +C+ EL    ++ EVVK+A+   L+       PV+K
Sbjct  279  EEVKKKIADILNEYVETGETYEACRCVRELGVSFFHHEVVKRALVTALENHAAEA-PVLK  337

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            LL     + +  S+ +  G  +    LDDLA+D+P A T FG I+ + V  G ++ S
Sbjct  338  LLNEAASENLISSSQMVKGFSRLRESLDDLALDIPSARTKFGLIVPKAVSGGWLDAS  394


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S  L+ EA +CI EL  P +  EVVK+A+ +G++K    +  ++ 
Sbjct  576  EDAKDKISNLLEEYESSGLVSEACKCIHELGMPFFNHEVVKKALVMGMEKKKDKM--MLG  633

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+  F + +  +N +  G  +    L+DLA+D+P A   F D +      G ++ S + 
Sbjct  634  LLQESFSEGLITTNQMTKGFTRVKDGLEDLALDIPNAKEKFNDYVEYGKKNGWVSSSFLT  693

Query  639  EILK--NIG  619
             + +  N+G
Sbjct  694  SLTEDANVG  702



>ref|XP_010555527.1| PREDICTED: programmed cell death protein 4 [Tarenaya hassleriana]
 ref|XP_010555528.1| PREDICTED: programmed cell death protein 4 [Tarenaya hassleriana]
Length=701

 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S  ++ EA QCI EL  P +  EVVK+A+ + ++K     D ++ 
Sbjct  581  EDAKDKIWKLLEEYESSGVVSEACQCIRELGLPFFNHEVVKKALVMAMEKKN---DRMLD  637

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
            LL+  F + +  +N +  G  +    LDDLA+D+P A   F   +G     G ++ S V
Sbjct  638  LLQESFSEGLITTNQMTKGFTRVKDALDDLALDIPNAEEKFSVYVGHGQKNGWLSSSFV  696


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 66/118 (56%), Gaps = 3/118 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EE+K+K   LL EY   +   EA +CI EL    ++ EVVK+A+   ++   P  +P++ 
Sbjct  284  EEVKKKIAELLREYVDNKDTYEACRCIRELGVSFFHHEVVKKALITAME--IPTAEPLIF  341

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            KLL+   ++ +  S+ +  G  +    LDDLA+D+P A T FG I+   V  G ++ S
Sbjct  342  KLLKEAAKENLVSSSQMVKGFSRLGESLDDLALDIPSAKTLFGSIVSNAVSEGWLDAS  399



>ref|XP_011452508.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 3-like 
isoform X1 [Crassostrea gigas]
 ref|XP_011452509.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 3-like 
isoform X1 [Crassostrea gigas]
Length=1613

 Score = 67.4 bits (163),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 0/129 (0%)
 Frame = -2

Query  999   EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
             EE+++KT  +LDEY  ++ + EA+ C+EELKSP+     V  A++  L++S    +    
Sbjct  1252  EEMEKKTKTILDEYLHLQDIKEAILCVEELKSPSVMHTFVSSAVNYVLERSNIARNQTGL  1311

Query  819   LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             LL  L  K +    V   G  +     +D+ +D+PK    FG++IG +V  G +  + + 
Sbjct  1312  LLHDLVIKNVLSVPVYIQGLTEVIQYAEDMEIDIPKIWQYFGELIGPMVQDGSVPLNFLR  1371

Query  639   EILKNIGDN  613
             +  + + +N
Sbjct  1372  KAAEPLKEN  1380



>emb|CDY34313.1| BnaA01g14160D [Brassica napus]
Length=234

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 68/125 (54%), Gaps = 2/125 (2%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K + LL+EY S  L+ EA +CI EL  P +  EVVK+A+ + ++K    +  VV+
Sbjct  108  EDAKDKILNLLEEYESSGLVSEACKCIHELGMPFFNHEVVKKALVMAMEKKKDKI--VVE  165

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+  F + +   N +  G  +    L+DLA+D+P A   F + +      G ++ S V 
Sbjct  166  LLQESFGEGLITINQMTKGFTRVKDGLEDLALDIPNAKEKFSEYVEHAKKNGWVSSSFVT  225

Query  639  EILKN  625
             + ++
Sbjct  226  SLTED  230



>ref|XP_011452512.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 1-like 
isoform X3 [Crassostrea gigas]
 ref|XP_011452513.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 1-like 
isoform X3 [Crassostrea gigas]
 ref|XP_011452514.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 1-like 
isoform X3 [Crassostrea gigas]
Length=1580

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 0/129 (0%)
 Frame = -2

Query  999   EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
             EE+++KT  +LDEY  ++ + EA+ C+EELKSP+     V  A++  L++S    +    
Sbjct  1219  EEMEKKTKTILDEYLHLQDIKEAILCVEELKSPSVMHTFVSSAVNYVLERSNIARNQTGL  1278

Query  819   LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             LL  L  K +    V   G  +     +D+ +D+PK    FG++IG +V  G +  + + 
Sbjct  1279  LLHDLVIKNVLSVPVYIQGLTEVIQYAEDMEIDIPKIWQYFGELIGPMVQDGSVPLNFLR  1338

Query  639   EILKNIGDN  613
             +  + + +N
Sbjct  1339  KAAEPLKEN  1347



>emb|CAB41120.1| putative protein [Arabidopsis thaliana]
 emb|CAB79390.1| putative protein [Arabidopsis thaliana]
Length=942

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (54%), Gaps = 1/117 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+K+K   +L+EY       EA +C+ EL    ++ EVVK+A+   L+       PV+K
Sbjct  279  EEVKKKIADILNEYVETGETYEACRCVRELGVSFFHHEVVKRALVTALENHAAEA-PVLK  337

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            LL     + +  S+ +  G  +    LDDLA+D+P A T FG I+ + V  G ++ S
Sbjct  338  LLNEAASENLISSSQMVKGFSRLRESLDDLALDIPSARTKFGLIVPKAVSGGWLDAS  394


 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 2/105 (2%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S  L+ EA +CI EL  P +  EVVK+A+ +G++K    +  ++ 
Sbjct  576  EDAKDKISNLLEEYESSGLVSEACKCIHELGMPFFNHEVVKKALVMGMEKKKDKM--MLD  633

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDII  685
            LL+  F + +  +N +  G  +    L+DLA+D+P A   F D +
Sbjct  634  LLQESFSEGLITTNQMTKGFTRVKDGLEDLALDIPNAKEKFNDYV  678



>ref|XP_011452510.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 1-like 
isoform X2 [Crassostrea gigas]
Length=1597

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 0/129 (0%)
 Frame = -2

Query  999   EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
             EE+++KT  +LDEY  ++ + EA+ C+EELKSP+     V  A++  L++S    +    
Sbjct  1236  EEMEKKTKTILDEYLHLQDIKEAILCVEELKSPSVMHTFVSSAVNYVLERSNIARNQTGL  1295

Query  819   LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             LL  L  K +    V   G  +     +D+ +D+PK    FG++IG +V  G +  + + 
Sbjct  1296  LLHDLVIKNVLSVPVYIQGLTEVIQYAEDMEIDIPKIWQYFGELIGPMVQDGSVPLNFLR  1355

Query  639   EILKNIGDN  613
             +  + + +N
Sbjct  1356  KAAEPLKEN  1364



>ref|XP_009537690.1| hypothetical protein PHYSODRAFT_356091 [Phytophthora sojae]
 gb|EGZ06926.1| hypothetical protein PHYSODRAFT_356091 [Phytophthora sojae]
Length=407

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 1/113 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVD-PVV  823
            EELK     L  EY   R L+EA +C+ EL  P ++ EVVK+ I+  L++        + 
Sbjct  281  EELKVAIDQLTKEYLLSRDLEEAARCVRELNVPHFHHEVVKRGITNSLEEGGEANSAAMA  340

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAG  664
             LL YL   ++  +  L  G ++F  +LDD+A+D+P A   F D + R V  G
Sbjct  341  SLLAYLVSHEVVSTGQLIKGFERFKLVLDDVALDIPNAAALFQDTVARGVSDG  393


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 1/111 (1%)
 Frame = -2

Query  1002  PEELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV  823
             P E+K++ + +L+EYF+    DE L  + +L  P +  EVVK+AI++ +DK+    +   
Sbjct  121   PPEIKKRIIEILEEYFTSGDADEVLSSLNDLDEPEFNYEVVKRAITMAMDKNDKERELAS  180

Query  822   KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVL  670
             +LL  L+   +    VL  G ++   L  DL +D+P A         R V+
Sbjct  181   RLLSALYLDGLTAGQVL-MGFRRVLLLAGDLQIDIPTAKNMLAIFCARAVV  230



>ref|XP_011032678.1| PREDICTED: eukaryotic translation initiation factor 4G-like [Populus 
euphratica]
Length=1898

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 2/130 (2%)
 Frame = -2

Query  999   EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
             E+L+  ++  + E++S R   E   CI++L SP+++P ++   ++   +++ P  D + K
Sbjct  1709  EQLRAMSMVTIKEFYSARDEKEVALCIKDLNSPSFHPSMISIWVTDSFERNKPDRDFLAK  1768

Query  819   LLEYLFEKK--IFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSI  646
             LL  L   +  I DSN L  G +   + L+D   D PKAP   G I+GR+V+   +    
Sbjct  1769  LLASLTRSQDCILDSNQLVKGFESVLTTLEDAVTDAPKAPEFLGQILGRVVVENVVPLEE  1828

Query  645   VNEILKNIGD  616
             +  +L   G+
Sbjct  1829  IGRLLLEGGE  1838



>ref|XP_011452515.1| PREDICTED: eukaryotic translation initiation factor 4 gamma 1-like 
isoform X4 [Crassostrea gigas]
Length=1554

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 0/129 (0%)
 Frame = -2

Query  999   EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
             EE+++KT  +LDEY  ++ + EA+ C+EELKSP+     V  A++  L++S    +    
Sbjct  1193  EEMEKKTKTILDEYLHLQDIKEAILCVEELKSPSVMHTFVSSAVNYVLERSNIARNQTGL  1252

Query  819   LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             LL  L  K +    V   G  +     +D+ +D+PK    FG++IG +V  G +  + + 
Sbjct  1253  LLHDLVIKNVLSVPVYIQGLTEVIQYAEDMEIDIPKIWQYFGELIGPMVQDGSVPLNFLR  1312

Query  639   EILKNIGDN  613
             +  + + +N
Sbjct  1313  KAAEPLKEN  1321



>ref|XP_004236309.1| PREDICTED: programmed cell death protein 4-like [Solanum lycopersicum]
Length=709

 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 69/118 (58%), Gaps = 3/118 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDP-VV  823
            EE+K++   LL EY     + EA +CI +L+ P +Y EVVK+A+ L ++      +P ++
Sbjct  290  EEVKKRIADLLREYVESGDIAEACRCIRQLELPFFYHEVVKRALVLAMEIQ--SAEPLIL  347

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            KLL+   E+ +  S+ +  G  + A  +DDL++D+P A  +F  I+ R +  G ++ S
Sbjct  348  KLLKEAAEEGLISSSQMVKGFSRMAESIDDLSLDIPSAKMSFQSIVPRAISEGWLDAS  405


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+E+ S  +L EA  CI EL  P +  EVVK+A+ + ++K     D ++ 
Sbjct  589  EDAKDKIQKLLEEFESSGVLSEACHCIRELGMPFFNHEVVKKALVMAMEKKN---DRMLD  645

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + +   N +  G  +    L+DLA+D+P A   F
Sbjct  646  LLQACFSEGLITINQMTKGFGRINDGLEDLALDIPNAKDKF  686



>gb|EKC31981.1| Eukaryotic translation initiation factor 4 gamma 3 [Crassostrea 
gigas]
Length=1538

 Score = 67.0 bits (162),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 0/129 (0%)
 Frame = -2

Query  999   EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
             EE+++KT  +LDEY  ++ + EA+ C+EELKSP+     V  A++  L++S    +    
Sbjct  1177  EEMEKKTKTILDEYLHLQDIKEAILCVEELKSPSVMHTFVSSAVNYVLERSNIARNQTGL  1236

Query  819   LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
             LL  L  K +    V   G  +     +D+ +D+PK    FG++IG +V  G +  + + 
Sbjct  1237  LLHDLVIKNVLSVPVYIQGLTEVIQYAEDMEIDIPKIWQYFGELIGPMVQDGSVPLNFLR  1296

Query  639   EILKNIGDN  613
             +  + + +N
Sbjct  1297  KAAEPLKEN  1305



>gb|AEX12248.1| hypothetical protein 0_7685_01, partial [Pinus taeda]
 gb|AEX12250.1| hypothetical protein 0_7685_01, partial [Pinus taeda]
 gb|AEX12251.1| hypothetical protein 0_7685_01, partial [Pinus taeda]
 gb|AEX12252.1| hypothetical protein 0_7685_01, partial [Pinus taeda]
Length=142

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = -2

Query  954  SIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVKLLEYLFEKK--IFDS  781
            S+R  DEA  C++ELK+P ++  +V Q ++   D++    D + KLL YL +KK  +   
Sbjct  1    SVRDEDEAALCMDELKAPWFHSNMVSQWVTDSFDRNNVERDLLAKLLIYLCDKKPNLLSH  60

Query  780  NVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVNEILKNIGDNFYLK  601
              L  G Q   S L+D  +D P+AP   G IIG+LV+A  ++ +    I+K  G+  +L 
Sbjct  61   EQLLMGLQISLSSLEDTVVDAPRAPEFIGVIIGKLVVAEILSLAESARIIK--GETGHLL  118

Query  600  DVFSAIMRVVS  568
            ++  A+  + S
Sbjct  119  EIGLALDVITS  129



>ref|XP_002302506.2| hypothetical protein POPTR_0002s14110g [Populus trichocarpa]
 gb|EEE81779.2| hypothetical protein POPTR_0002s14110g [Populus trichocarpa]
Length=1896

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 51/165 (31%), Positives = 83/165 (50%), Gaps = 11/165 (7%)
 Frame = -2

Query  1002  PEE-LKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPV  826
             PEE L+  + A + E++S R   E   CI+EL SP+++P ++   ++   ++     D +
Sbjct  1705  PEERLRDMSTAAIKEFYSARDEKEVSLCIKELNSPSFHPSMISIWVTDSFERKDLERDLL  1764

Query  825   VKLLEYLFEKK--IFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINF  652
              KLL  L   +  I DSN L  G +   + L+D   D PKAP   G IIGR+V+   +  
Sbjct  1765  AKLLVSLARSQNGILDSNQLIKGFESILTTLEDAVNDAPKAPEFLGRIIGRVVVENVVPL  1824

Query  651   SIVNEILKNIGDN--FYLK-----DVFSAIMRVVSSSPSGNAILD  538
             S +  +L   G+     LK     DV  +I+ ++     G A+L+
Sbjct  1825  SEIGPLLHEGGEEPGSLLKLGLAGDVLGSILEMIKVE-KGEAVLN  1868



>ref|XP_006351448.1| PREDICTED: uncharacterized protein LOC102604631 isoform X1 [Solanum 
tuberosum]
Length=709

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 7/130 (5%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDP-VV  823
            EE+K++   LL EY       EA +CI +L+ P +Y EVVK+A+ L ++      +P ++
Sbjct  290  EEVKKRIADLLREYVESGDTVEACRCIRQLEVPFFYHEVVKRALVLAMEMQ--SAEPLIL  347

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
            KLL+   E+ +  S+ +  G  + A  +DDL++D+P   T+F  I+ + +  G ++ S  
Sbjct  348  KLLKEAAEEGLISSSQMVKGFSRMAESIDDLSLDIPSVKTSFQSIVPQAISEGWLDAS--  405

Query  642  NEILKNIGDN  613
               LK  G+N
Sbjct  406  --SLKATGEN  413


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+E+ S  +L EA +CI EL  P +  EVVK+A+ + ++K     D ++ 
Sbjct  589  EDAKDKIQKLLEEFESSGVLSEACRCIRELGMPFFNHEVVKKALVMAMEKKN---DRMLD  645

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + +   N +  G  +    L+DLA+D+P A   F
Sbjct  646  LLQACFSEGLITINQMTKGFGRINDGLEDLALDIPNANDKF  686



>ref|XP_006351449.1| PREDICTED: uncharacterized protein LOC102604631 isoform X2 [Solanum 
tuberosum]
Length=613

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 7/130 (5%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDP-VV  823
            EE+K++   LL EY       EA +CI +L+ P +Y EVVK+A+ L ++      +P ++
Sbjct  194  EEVKKRIADLLREYVESGDTVEACRCIRQLEVPFFYHEVVKRALVLAMEMQ--SAEPLIL  251

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
            KLL+   E+ +  S+ +  G  + A  +DDL++D+P   T+F  I+ + +  G ++ S  
Sbjct  252  KLLKEAAEEGLISSSQMVKGFSRMAESIDDLSLDIPSVKTSFQSIVPQAISEGWLDAS--  309

Query  642  NEILKNIGDN  613
               LK  G+N
Sbjct  310  --SLKATGEN  317


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+E+ S  +L EA +CI EL  P +  EVVK+A+ + ++K     D ++ 
Sbjct  493  EDAKDKIQKLLEEFESSGVLSEACRCIRELGMPFFNHEVVKKALVMAMEKKN---DRMLD  549

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + +   N +  G  +    L+DLA+D+P A   F
Sbjct  550  LLQACFSEGLITINQMTKGFGRINDGLEDLALDIPNANDKF  590



>ref|XP_006413383.1| hypothetical protein EUTSA_v10024556mg [Eutrema salsugineum]
 ref|XP_006413384.1| hypothetical protein EUTSA_v10024556mg [Eutrema salsugineum]
 gb|ESQ54836.1| hypothetical protein EUTSA_v10024556mg [Eutrema salsugineum]
 gb|ESQ54837.1| hypothetical protein EUTSA_v10024556mg [Eutrema salsugineum]
Length=703

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 68/125 (54%), Gaps = 2/125 (2%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K + LL+EY S  L+ EA +CI EL  P +  EVVK+A+ + ++K    +  V+ 
Sbjct  580  EDAKDKILNLLEEYESSGLVSEACKCIRELGMPFFNHEVVKKALVMAMEKKNDKM--VLD  637

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+  F + +  +N +  G  +    L+DLA+D+P A   F D +      G ++ S V 
Sbjct  638  LLQECFGEGLITTNQMTKGLTRVKDGLEDLALDIPNAKEKFKDYVEHAKKNGWVSSSFVT  697

Query  639  EILKN  625
             + ++
Sbjct  698  SLTED  702


 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 65/119 (55%), Gaps = 5/119 (4%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDK--SPPCVDPV  826
            EE+K+K   +L EY       EA +CI EL    ++ EVVK+A+  G++   S P V   
Sbjct  283  EEVKKKITDILKEYVETGDTYEACRCIRELGVSFFHHEVVKRALITGMESYTSEPLV---  339

Query  825  VKLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFS  649
            +KLL+    + + +S+ +  G  +    LDDLA+D+P A T F  ++ + +  G ++ S
Sbjct  340  LKLLKEAASENLINSSQMVKGFSRLRESLDDLALDIPSAKTKFDLLVPKAIAGGWLDAS  398



>ref|XP_008239378.1| PREDICTED: programmed cell death protein 4-like [Prunus mume]
Length=704

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 9/131 (7%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLD--KSPPCVDPV  826
            EE+K+K   LL EY       EA +CI EL    ++ EVVK+A+ L +D   S P +   
Sbjct  284  EEMKKKIAGLLREYVENGDTFEACRCIRELGVSFFHHEVVKRALILAMDIRTSEPLI---  340

Query  825  VKLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSI  646
            +KLL+   E+ +  S+ +  G  + A  LDDLA+D+P A T F  ++ + +  G ++ S 
Sbjct  341  MKLLKEAAEEGLISSSQMVKGFSRLAETLDDLALDIPSANTLFESLVPKAISEGWLDAS-  399

Query  645  VNEILKNIGDN  613
                LK+ G++
Sbjct  400  ---FLKSSGED  407


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+EY S  ++ EA QCI +L  P +  EVVK+A+ + ++K     D ++ 
Sbjct  581  EDAKDKIAKLLEEYESGGVVSEACQCIRDLGMPFFNHEVVKKALVMAMEKKN---DRMLH  637

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + +   N +  G  +    LDDLA+D+P A   F
Sbjct  638  LLQECFNEGLITINQMTKGFTRIKDGLDDLALDIPNAREKF  678



>ref|XP_002964316.1| hypothetical protein SELMODRAFT_80912, partial [Selaginella moellendorffii]
 gb|EFJ34649.1| hypothetical protein SELMODRAFT_80912, partial [Selaginella moellendorffii]
Length=648

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KRK   LL EY       EA +CI EL  P ++ EVVK+A++L ++K       +V 
Sbjct  211  EEVKRKITDLLKEYVESGDQAEARRCIRELNVPFFHHEVVKKALTLVIEKKSAEA-GIVS  269

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+   ++ +  SN +  G  +    L+DL++D+P+A     D+  + + AG ++ S V 
Sbjct  270  LLQECADEGLISSNQMSKGFSRVFDALEDLSLDVPQAREILEDLAAKAMSAGWLSSSFVT  329


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++ K K   LL+E+ S   + EA QC+ +L  P ++ EVVK+A+ + +++      P+  
Sbjct  524  DDAKDKIAKLLEEFESGGDMGEACQCVRDLAMPYFHHEVVKRALVMAMERK--SARPLCF  581

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            L E   E  I  S ++  G  + A  +DDLA+D+P A + F
Sbjct  582  LRECSSEGLITTSQMV-KGFGRVADYIDDLALDIPDAKSKF  621



>ref|XP_002967718.1| hypothetical protein SELMODRAFT_88306, partial [Selaginella moellendorffii]
 gb|EFJ31065.1| hypothetical protein SELMODRAFT_88306, partial [Selaginella moellendorffii]
Length=648

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            EE+KRK   LL EY       EA +CI EL  P ++ EVVK+A++L ++K       +V 
Sbjct  211  EEVKRKITDLLKEYVESGDQAEARRCIRELNVPFFHHEVVKKALTLVIEKKSAEA-GIVS  269

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIVN  640
            LL+   ++ +  SN +  G  +    L+DL++D+P+A     D+  + + AG ++ S V 
Sbjct  270  LLQECADEGLISSNQMSKGFSRVFDALEDLSLDVPQAREILEDLAAKAMSAGWLSSSFVT  329


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            ++ K K   LL+E+ S   + EA QC+ +L  P ++ EVVK+A+ + +++      P+  
Sbjct  524  DDAKDKIAKLLEEFESGGDMGEACQCVRDLAMPYFHHEVVKRALVMAMERK--SARPLCF  581

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            L E   E  I  S ++  G  + A  +DDLA+D+P A + F
Sbjct  582  LRECSSEGLITTSQMV-KGFGRVADYIDDLALDIPDAKSKF  621



>ref|XP_009613162.1| PREDICTED: uncharacterized protein LOC104106342 [Nicotiana tomentosiformis]
Length=703

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVV-  823
            EE+K++   LL EY       EA +CI +L+   +Y EVVK+A+ L ++   P  +P++ 
Sbjct  285  EEVKKRIADLLREYVESGDTAEACRCIRKLEVSFFYHEVVKRALVLAMEM--PSAEPLIL  342

Query  822  KLLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNFGDIIGRLVLAGGINFSIV  643
            KLL+   E+ +  S+ +  G  + A  +DDL +D+P A T F  I+ R V  G ++ S +
Sbjct  343  KLLKKAAEEGLISSSQMVKGFSRLAESIDDLCLDIPSAKTLFQSIVPRAVSDGWLDASFL  402


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 56/101 (55%), Gaps = 3/101 (3%)
 Frame = -2

Query  999  EELKRKTVALLDEYFSIRLLDEALQCIEELKSPAYYPEVVKQAISLGLDKSPPCVDPVVK  820
            E+ K K   LL+E+ S  ++ EA QCI ++  P +  EVVK+A+ + ++K     D ++ 
Sbjct  584  EDAKDKIQKLLEEFESGGVISEACQCIRDIGMPFFNHEVVKKALVMAMEKKN---DRMLD  640

Query  819  LLEYLFEKKIFDSNVLGSGCQKFASLLDDLAMDLPKAPTNF  697
            LL+  F + +   N +  G  +    LDDLA+D+P A   F
Sbjct  641  LLQECFNEGLITINQITKGFGRIKDGLDDLALDIPNAKDKF  681



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2502572571944