BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8339

Length=913
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          401   7e-134   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                401   7e-134   Ipomoea batatas [batate]
gb|AFY26882.1|  catalase                                                359   5e-122   Ipomoea batatas [batate]
emb|CAB56850.1|  catalase                                               330   4e-107   Prunus persica
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      332   6e-107   Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 330   5e-106   Elaeis guineensis
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 330   6e-106   Eucalyptus grandis [rose gum]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 329   1e-105   Prunus mume [ume]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                328   1e-105   Citrus sinensis [apfelsine]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             328   2e-105   Citrus clementina [clementine]
gb|AGC65520.1|  catalase                                                328   3e-105   Eriobotrya japonica [loquat]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             327   5e-105   Prunus persica
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      327   8e-105   Nicotiana sylvestris
gb|AIX10947.1|  putative catalase                                       327   9e-105   Gardenia jasminoides
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      326   2e-104   Eucalyptus grandis [rose gum]
emb|CAD42909.1|  catalase                                               325   3e-104   Prunus persica
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      325   3e-104   Elaeis guineensis
gb|AAB88173.1|  catalase                                                318   4e-104   Glycine max [soybeans]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      325   4e-104   Prunus mume [ume]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         325   5e-104   Tarenaya hassleriana [spider flower]
dbj|BAF91369.1|  catalase                                               325   5e-104   Capsicum annuum
emb|CAD42908.1|  catalase                                               324   6e-104   Prunus persica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             324   7e-104   Prunus persica
ref|XP_002306976.2|  catalase family protein                            324   8e-104   
gb|ABR15776.1|  catalase                                                317   1e-103   Litchi
ref|NP_001289779.1|  catalase isozyme 1                                 324   1e-103   Nelumbo nucifera [Indian lotus]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    324   1e-103   Gossypium raimondii
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      323   2e-103   Populus euphratica
emb|CDP07287.1|  unnamed protein product                                323   2e-103   Coffea canephora [robusta coffee]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 323   3e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    318   3e-103   Gossypium raimondii
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    323   3e-103   Capsicum annuum
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          323   3e-103   Avicennia marina
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      322   3e-103   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 322   4e-103   Nicotiana tomentosiformis
gb|AAA57551.1|  catalase                                                318   4e-103   Nicotiana sylvestris
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      322   4e-103   
gb|ABY19573.1|  catalase                                                314   4e-103   Manihot esculenta [manioc]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 322   7e-103   Vitis vinifera
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      322   7e-103   Phoenix dactylifera
emb|CAI43948.1|  catalase                                               322   8e-103   Populus deltoides
ref|XP_010061175.1|  PREDICTED: catalase-like                           322   8e-103   Eucalyptus grandis [rose gum]
ref|NP_001268098.1|  catalase                                           322   8e-103   Vitis vinifera
gb|AAX84671.1|  catalase CAT2                                           314   8e-103   Manihot esculenta [manioc]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      322   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      321   1e-102   Nelumbo nucifera [Indian lotus]
gb|AHF27428.1|  catalase                                                316   1e-102   Cucurbita moschata [ayote]
ref|XP_002301920.1|  catalase family protein                            321   1e-102   Populus trichocarpa [western balsam poplar]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               321   1e-102   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 321   2e-102   Nicotiana sylvestris
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 321   2e-102   Populus euphratica
gb|ACJ11733.1|  catalase                                                321   2e-102   Gossypium hirsutum [American cotton]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      320   2e-102   Nicotiana tomentosiformis
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           320   3e-102   
gb|ADC95629.1|  catalase                                                320   3e-102   Bruguiera gymnorhiza [Burma mangrove]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          320   3e-102   Solanum melongena [aubergine]
gb|AIS20825.1|  CAT                                                     320   3e-102   Pyrus x bretschneideri [bai li]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           320   3e-102   Sesamum indicum [beniseed]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      320   4e-102   
gb|AAM97542.1|  catalase 3                                              320   4e-102   Capsicum annuum
emb|CAC04509.1|  catalase                                               311   5e-102   Digitalis lanata [Grecian foxglove]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      320   5e-102   Nicotiana sylvestris
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    320   5e-102   Nicotiana tabacum [American tobacco]
ref|NP_001237571.1|  catalase-4                                         319   6e-102   Glycine max [soybeans]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             319   7e-102   Phaseolus vulgaris [French bean]
gb|KHG25152.1|  Catalase isozyme 1                                      319   7e-102   Gossypium arboreum [tree cotton]
gb|AGV54297.1|  peroxisomal catalase                                    319   8e-102   Phaseolus vulgaris [French bean]
gb|AJE26131.1|  catalase                                                319   8e-102   Salix matsudana [tortured willow]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     322   9e-102   Eucalyptus grandis [rose gum]
ref|NP_001240021.1|  catalase                                           318   1e-101   Glycine max [soybeans]
dbj|BAC79443.1|  catalase                                               318   1e-101   Acacia ampliceps
ref|NP_001291326.1|  catalase isozyme 1                                 318   1e-101   Sesamum indicum [beniseed]
gb|AAF19965.1|AF207906_1  catalase 1                                    318   1e-101   Zantedeschia aethiopica [arum-lily]
gb|AGE15298.2|  catalase 1                                              318   1e-101   Eriobotrya japonica [loquat]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             318   2e-101   Phaseolus vulgaris [French bean]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 318   2e-101   Phoenix dactylifera
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             318   3e-101   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                318   3e-101   Eutrema halophilum
gb|KJB14250.1|  hypothetical protein B456_002G115900                    318   3e-101   Gossypium raimondii
gb|ABM47415.1|  catalase                                                317   3e-101   Prunus avium [gean]
gb|AAR84578.1|  catalase 1a                                             317   4e-101   Lotus japonicus
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      317   4e-101   Cucumis melo [Oriental melon]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               317   5e-101   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AET97564.1|  catalase                                                317   5e-101   Ziziphus jujuba [Chinese jujube]
ref|NP_001237556.1|  catalase-1/2                                       317   5e-101   Glycine max [soybeans]
ref|XP_007018034.1|  Catalase 2                                         317   6e-101   
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          317   6e-101   Soldanella alpina
ref|XP_010530333.1|  PREDICTED: catalase-2                              316   9e-101   Tarenaya hassleriana [spider flower]
emb|CDP07288.1|  unnamed protein product                                316   9e-101   Coffea canephora [robusta coffee]
gb|ACJ76836.3|  catalase                                                316   1e-100   Dimocarpus longan [longan]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               316   1e-100   Cucurbita pepo
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      315   2e-100   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             315   2e-100   Citrus clementina [clementine]
gb|AEQ30070.1|  catalase                                                315   2e-100   Litchi chinensis [litchi]
gb|AIA61608.1|  catalase                                                315   2e-100   Gynostemma pentaphyllum [jiaogulan]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      315   2e-100   Solanum lycopersicum
dbj|BAQ21275.1|  catalase                                               315   2e-100   Citrus tamurana
emb|CDX76313.1|  BnaA08g10870D                                          315   2e-100   
ref|XP_011654267.1|  PREDICTED: catalase isozyme 1                      315   3e-100   Cucumis sativus [cucumbers]
gb|ACV92695.1|  catalase                                                315   3e-100   Brassica oleracea
ref|NP_001235974.1|  catalase-3                                         315   3e-100   Glycine max [soybeans]
ref|XP_010498496.1|  PREDICTED: catalase-3                              315   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006828714.1|  PREDICTED: catalase-1/2                            315   3e-100   Amborella trichopoda
gb|AFU90823.1|  catalase                                                313   3e-100   Populus x beijingensis
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      315   3e-100   
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               315   3e-100   Gossypium hirsutum [American cotton]
gb|ACJ73906.1|  CAT2                                                    309   3e-100   Solanum nigrum
gb|AFU90822.1|  catalase                                                315   3e-100   Populus tomentosa [Chinese white poplar]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             315   3e-100   
gb|AAC48918.1|  salicylic acid binding catalase                         315   3e-100   Nicotiana tabacum [American tobacco]
ref|XP_009110221.1|  PREDICTED: catalase-3                              315   4e-100   Brassica rapa
emb|CAA64220.1|  catalase                                               315   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              315   4e-100   
ref|NP_001031072.3|  catalase 3                                         311   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      315   4e-100   Vitis vinifera
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 314   5e-100   Solanum tuberosum [potatoes]
gb|AAD37788.1|AF149283_1  catalase 1                                    312   5e-100   Phaseolus vulgaris [French bean]
gb|AAB86582.2|  catalase                                                314   5e-100   Raphanus sativus
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              314   5e-100   Cicer arietinum [garbanzo]
gb|AAK96854.1|  catalase                                                314   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             314   5e-100   Capsella rubella
emb|CAA45564.1|  catalase                                               314   5e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AAF71742.1|AF248491_1  catalase                                      314   5e-100   Raphanus sativus
prf||1906388A  catalase                                                 314   5e-100
gb|AAD17935.1|  catalase                                                314   5e-100   Brassica juncea [brown mustard]
ref|NP_195235.1|  catalase 2                                            314   6e-100   Arabidopsis thaliana [mouse-ear cress]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          314   7e-100   Helianthus annuus
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          314   7e-100   Vigna radiata var. radiata [golden gram]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      314   8e-100   Elaeis guineensis
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     315   8e-100   Sesamum indicum [beniseed]
prf||2104177A  catalase                                                 314   8e-100
emb|CDY40645.1|  BnaA03g53180D                                          313   9e-100   Brassica napus [oilseed rape]
ref|XP_009138342.1|  PREDICTED: catalase-2                              313   1e-99    Brassica rapa
emb|CDY29519.1|  BnaA06g14510D                                          313   1e-99    Brassica napus [oilseed rape]
emb|CDY31488.1|  BnaC05g15970D                                          314   1e-99    Brassica napus [oilseed rape]
gb|KFK30147.1|  catalase                                                313   1e-99    Arabis alpina [alpine rockcress]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         313   1e-99    Brassica rapa
gb|AAD17936.1|  catalase                                                313   1e-99    Brassica juncea [brown mustard]
gb|ACA50528.1|  putative catalase 2                                     313   1e-99    Brassica napus [oilseed rape]
emb|CDY17510.1|  BnaC03g65530D                                          313   2e-99    Brassica napus [oilseed rape]
gb|KHG12976.1|  Catalase isozyme 2                                      313   2e-99    Gossypium arboreum [tree cotton]
emb|CCP37650.1|  catalase-1                                             313   2e-99    Nicotiana tabacum [American tobacco]
ref|NP_001234827.1|  catalase isozyme 1                                 313   2e-99    Solanum lycopersicum
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         313   2e-99    Tarenaya hassleriana [spider flower]
emb|CDY33636.1|  BnaC08g19360D                                          313   2e-99    Brassica napus [oilseed rape]
gb|AFU48609.1|  catalase 1                                              313   2e-99    Nicotiana benthamiana
ref|XP_009149539.1|  PREDICTED: catalase-3                              314   2e-99    Brassica rapa
gb|AFW69584.1|  catalase1                                               308   2e-99    
gb|ACL27272.1|  catalase                                                313   2e-99    Nicotiana benthamiana
dbj|BAH20307.1|  AT1G20620                                              311   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094556.1|  Catalase isozyme 1                                 313   2e-99    Morus notabilis
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          313   3e-99 
emb|CDY01364.1|  BnaA07g11370D                                          314   3e-99    
gb|AAB62892.1|  catalase-1                                              312   3e-99    Nicotiana glutinosa
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             312   3e-99    
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      312   4e-99    
gb|AAD50974.1|AF170272_1  catalase CAT1                                 312   4e-99    Manihot esculenta [manioc]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         312   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      312   4e-99    Phoenix dactylifera
gb|AAB71764.1|  catalase 1                                              312   4e-99    Nicotiana tabacum [American tobacco]
dbj|BAJ87148.1|  predicted protein                                      305   5e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010437527.1|  PREDICTED: catalase-2                              312   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009106100.1|  PREDICTED: catalase-2                              311   5e-99    Brassica rapa
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               311   5e-99    Gossypium hirsutum [American cotton]
ref|NP_564120.1|  catalase 3                                            311   5e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             311   5e-99    Populus trichocarpa [western balsam poplar]
gb|AAM65021.1|  unknown                                                 311   6e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CDY31878.1|  BnaC07g15280D                                          311   6e-99    Brassica napus [oilseed rape]
gb|ABQ44283.1|  catalase                                                306   7e-99    Saccharum hybrid cultivar NCo 376
emb|CDX72514.1|  BnaC07g45360D                                          311   7e-99    
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    311   9e-99    Arabis alpina [alpine rockcress]
gb|AAY59707.1|  catalase                                                311   9e-99    Oryza sativa Indica Group [Indian rice]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    311   1e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_011022275.1|  PREDICTED: catalase-like                           310   1e-98    Populus euphratica
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 311   1e-98    Oryza brachyantha
gb|ADZ45555.1|  catalase                                                311   1e-98    Vigna radiata [mung bean]
dbj|BAA34205.1|  catalase                                               311   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 311   1e-98    Cucumis melo [Oriental melon]
ref|NP_001048861.1|  Os03g0131200                                       311   1e-98    
gb|AAG43363.1|AF151368_1  catalase                                      310   1e-98    Hevea brasiliensis [jebe]
gb|ABC01913.1|  catalase isozyme 1-like protein                         310   2e-98    Solanum tuberosum [potatoes]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              310   2e-98    Populus euphratica
gb|ACB11496.1|  catalase                                                310   2e-98    Pinus sylvestris [Scotch pine]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      310   2e-98    Nicotiana sylvestris
gb|AIU99479.1|  catalase                                                310   2e-98    Saccharum arundinaceum
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                310   2e-98    Erythranthe guttata [common monkey flower]
dbj|BAA05494.1|  catalase                                               310   3e-98    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA34204.1|  catalase                                               310   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              310   3e-98    Populus euphratica
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             310   3e-98    Capsella rubella
gb|AAO17721.1|  catalase                                                310   3e-98    Hypericum perforatum
ref|NP_001058635.1|  Os06g0727200                                       310   3e-98    
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               310   3e-98    Ricinus communis
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         310   3e-98    Camelina sativa [gold-of-pleasure]
gb|ADZ45556.1|  catalase                                                310   4e-98    Vigna radiata [mung bean]
ref|NP_001274863.1|  catalase isozyme 1                                 310   4e-98    Solanum tuberosum [potatoes]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      309   4e-98    Nicotiana tomentosiformis
gb|AAR14052.2|  catalase                                                309   4e-98    Solanum tuberosum [potatoes]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               309   5e-98    Solanum tuberosum [potatoes]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    309   5e-98    Gossypium raimondii
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 309   5e-98    Tarenaya hassleriana [spider flower]
ref|XP_012065377.1|  PREDICTED: catalase-2                              309   6e-98    Jatropha curcas
gb|AAC19397.1|  leaf catalase                                           309   6e-98    Mesembryanthemum crystallinum
ref|XP_007046520.1|  Catalase 2                                         309   6e-98    Theobroma cacao [chocolate]
gb|AAR97905.1|  catalase                                                309   6e-98    Solanum tuberosum [potatoes]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              309   6e-98    
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         309   6e-98    Tarenaya hassleriana [spider flower]
gb|ABK24453.1|  unknown                                                 309   7e-98    Picea sitchensis
emb|CAA85470.1|  catalase                                               309   7e-98    Solanum tuberosum [potatoes]
ref|NP_001241808.1|  catalase isozyme B                                 309   7e-98    Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             309   7e-98    Zea mays [maize]
gb|AIM43584.1|  catalase                                                309   7e-98    Saccharum hybrid cultivar Yacheng05-179
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               309   7e-98    Solanum tuberosum [potatoes]
gb|AIU99484.1|  catalase                                                308   8e-98    Saccharum arundinaceum
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               308   9e-98    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AIU99485.1|  catalase                                                308   1e-97    Saccharum spontaneum [fodder cane]
gb|AAD17933.1|  catalase                                                308   1e-97    Brassica juncea [brown mustard]
gb|AAD30291.2|AF139538_1  catalase 2                                    308   1e-97    Raphanus sativus
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         308   1e-97    Oryza brachyantha
ref|XP_010692544.1|  PREDICTED: catalase-like                           308   1e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU99481.1|  catalase                                                308   1e-97    Saccharum spontaneum [fodder cane]
gb|AAD30292.1|AF139539_1  catalase 3                                    308   1e-97    Raphanus sativus
gb|AIU99488.1|  catalase                                                308   1e-97    Saccharum hybrid cultivar ROC22
ref|XP_012073649.1|  PREDICTED: catalase isozyme 2                      308   1e-97    
gb|AFN81243.1|  catalase 1                                              308   2e-97    Brassica rapa subsp. pekinensis [bai cai]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               308   2e-97    Ricinus communis
emb|CDP01803.1|  unnamed protein product                                308   2e-97    Coffea canephora [robusta coffee]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          308   2e-97    
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       305   2e-97    Cucumis sativus [cucumbers]
gb|AAC17729.1|  catalase 1                                              305   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      308   2e-97    Brachypodium distachyon [annual false brome]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      307   2e-97    Solanum tuberosum [potatoes]
ref|XP_006828715.1|  PREDICTED: catalase-1/2                            307   3e-97    Amborella trichopoda
gb|AAC49807.1|  catalase 3                                              307   3e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AIU99480.1|  catalase                                                307   3e-97    Saccharum spontaneum [fodder cane]
gb|AHF21552.1|  catalase                                                307   3e-97    Hylocereus undatus [dragon fruit]
gb|KEH36312.1|  catalase heme-binding enzyme                            307   4e-97    Medicago truncatula
ref|XP_011654421.1|  PREDICTED: catalase isozyme 1-like                 305   6e-97    Cucumis sativus [cucumbers]
emb|CDX69111.1|  BnaC01g03420D                                          306   6e-97    
gb|ACL35349.1|  catalase                                                306   7e-97    Picea glauca
gb|AHF27433.1|  catalase                                                306   9e-97    Cucurbita maxima [Boston marrow]
ref|XP_012073648.1|  PREDICTED: catalase isozyme 1                      306   1e-96    Jatropha curcas
gb|AIU99482.1|  catalase                                                306   1e-96    Saccharum hybrid cultivar ROC22
gb|AIU99486.1|  catalase                                                306   1e-96    Saccharum spontaneum [fodder cane]
gb|AHF27430.1|  catalase                                                306   1e-96    Cucurbita moschata [ayote]
gb|AHA50082.1|  catalase                                                305   1e-96    Eleutherococcus senticosus
emb|CAG23920.1|  catalase                                               305   2e-96    Festuca arundinacea [tall fescue]
gb|AAM97541.1|  catalase 2                                              305   2e-96    Capsicum annuum
gb|AFR53082.1|  CAT                                                     305   2e-96    Anthurium andraeanum [flamingo-lily]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               305   2e-96    Hordeum vulgare [barley]
gb|AAL00886.1|  catalase                                                298   2e-96    Suaeda salsa
gb|AAF61732.1|AF243517_1  catalase 2                                    305   2e-96    Helianthus annuus
gb|EPS69543.1|  catalase                                                305   2e-96    Genlisea aurea
gb|ACN36234.1|  unknown                                                 300   2e-96    Zea mays [maize]
emb|CAE82295.1|  catalase                                               305   3e-96    Homogyne alpina
ref|XP_003558892.1|  PREDICTED: catalase-1                              305   3e-96    Brachypodium distachyon [annual false brome]
gb|EMT05040.1|  Catalase-1                                              305   3e-96    
gb|AIU99487.1|  catalase                                                304   4e-96    Saccharum hybrid cultivar ROC22
ref|NP_001234186.1|  catalase isozyme 2                                 304   4e-96    
ref|NP_001105415.1|  catalase isozyme 1                                 304   5e-96    
gb|AAF61733.1|AF243518_1  catalase 3                                    304   5e-96    Helianthus annuus
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         304   5e-96    Setaria italica
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 305   6e-96    
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       303   7e-96    Triticum aestivum [Canadian hard winter wheat]
gb|AIU99483.1|  catalase                                                303   1e-95    Saccharum hybrid cultivar ROC22
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             304   1e-95    Eutrema salsugineum [saltwater cress]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      303   1e-95    Cucumis melo [Oriental melon]
dbj|BAJ90861.1|  predicted protein                                      303   2e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC17731.1|  catalase 1                                              303   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            303   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                302   2e-95    Erythranthe guttata [common monkey flower]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               302   2e-95    Cucurbita pepo
gb|AAF61734.1|AF243519_1  catalase 4                                    302   3e-95    Helianthus annuus
ref|XP_002521709.1|  catalase, putative                                 302   3e-95    Ricinus communis
ref|XP_004144240.2|  PREDICTED: catalase isozyme 3                      302   3e-95    
dbj|BAJ88747.1|  predicted protein                                      303   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADM96039.1|  catalase                                                302   4e-95    Cucumis sativus [cucumbers]
gb|ADU56198.1|  catalase                                                301   5e-95    Musa acuminata AAA Group [Cavendish banana]
emb|CDP01802.1|  unnamed protein product                                301   5e-95    Coffea canephora [robusta coffee]
gb|AIP93616.1|  CAT1                                                    301   5e-95    
gb|AHF27429.1|  catalase                                                300   9e-95    
gb|AAC19398.1|  root catalase                                           301   9e-95    
gb|AHF27432.1|  catalase                                                300   1e-94    
gb|AIZ77475.1|  catalase                                                300   1e-94    
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      300   1e-94    
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         300   1e-94    
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      300   2e-94    
gb|AAK67359.2|AF390210_1  catalase                                      300   2e-94    
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    300   2e-94    
gb|ADU56199.1|  catalase                                                300   2e-94    
gb|ABB72796.1|  catalase isozyme 1-like protein                         300   3e-94    
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               299   3e-94    
tpg|DAA43177.1|  TPA: catalase2                                         299   4e-94    
ref|XP_009103333.1|  PREDICTED: catalase-1                              299   4e-94    
emb|CDY01363.1|  BnaA07g11360D                                          299   4e-94    
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               299   4e-94    
ref|XP_010692546.1|  PREDICTED: catalase                                299   5e-94    
emb|CDY31877.1|  BnaC07g15270D                                          299   5e-94    
gb|AAG61140.2|AF332973_1  catalase 2                                    299   5e-94    
prf||1803522A  catalase                                                 299   5e-94 
gb|AAF79625.1|AC027665_26  F5M15.5                                      311   6e-94    
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    298   7e-94    
ref|NP_001105310.1|  catalase isozyme 2                                 298   8e-94    
dbj|BAH37035.1|  catalase 1                                             298   8e-94    
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             298   1e-93    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             298   1e-93    
gb|ADN94253.1|  catalase                                                298   1e-93    
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               298   1e-93    
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      298   1e-93    
gb|AFD29285.1|  catalase                                                298   2e-93    
tpg|DAA43178.1|  TPA: catalase2                                         298   3e-93    
gb|ABV55108.1|  catalase 2                                              297   3e-93    
gb|ABY21704.1|  catalase-1 precursor                                    296   3e-93    
gb|ADK25939.1|  catalase                                                288   4e-93    
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             296   4e-93    
ref|XP_002510677.1|  catalase, putative                                 308   5e-93    
ref|XP_002890395.1|  F5M15.5                                            308   5e-93    
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      296   6e-93    
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             296   9e-93    
gb|AHB72694.1|  catalase                                                295   2e-92    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   298   3e-92    
gb|AAB07026.1|  catalase 1                                              294   5e-92    
gb|KHG21219.1|  Catalase isozyme 1                                      291   7e-92    
gb|ACH63223.1|  catalase                                                293   1e-91    
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            291   4e-91    
ref|NP_001031073.1|  catalase 3                                         291   6e-91    
emb|CDY52649.1|  BnaAnng11640D                                          288   3e-90    
gb|ACL81498.1|  catalase                                                288   7e-90    
gb|AJF34884.1|  catalase                                                286   4e-89    
emb|CDY31490.1|  BnaC05g15990D                                          285   1e-88    
ref|XP_009149540.1|  PREDICTED: catalase-1                              285   1e-88    
emb|CDY29518.1|  BnaA06g14520D                                          285   1e-88    
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         285   1e-88    
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              283   3e-88    
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         283   6e-88    
ref|XP_010105996.1|  Catalase isozyme 1                                 279   7e-88    
ref|XP_001779509.1|  predicted protein                                  283   1e-87    
ref|NP_001031791.1|  catalase 2                                         282   1e-87    
dbj|BAH19523.1|  AT4G35090                                              282   1e-87    
ref|XP_010477308.1|  PREDICTED: catalase-1                              282   2e-87    
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             282   3e-87    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 281   4e-87    
ref|XP_001752315.1|  predicted protein                                  279   2e-86    
gb|AAC17730.1|  catalase 2                                              276   3e-86    
dbj|BAJ92414.1|  predicted protein                                      278   6e-86    
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      278   6e-86    
emb|CAH61266.1|  catalase                                               277   1e-85    
gb|EMS51034.1|  Catalase isozyme 2                                      278   1e-85    
gb|ADY02963.1|  catalase                                                277   1e-85    
dbj|BAH56915.1|  AT1G20620                                              277   2e-85    
ref|XP_001784759.1|  predicted protein                                  276   2e-85    
gb|ACV30589.1|  catalase                                                266   2e-85    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               276   3e-85    
ref|NP_001045673.1|  Os02g0115700                                       276   3e-85    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          276   4e-85    
gb|ABN71233.2|  catalase                                                276   4e-85    
gb|AAX88799.1|  catalase                                                275   5e-85    
gb|EMS61345.1|  Catalase isozyme 1                                      279   7e-85    
gb|ABK24449.1|  unknown                                                 275   8e-85    
gb|AGI65617.1|  catalase                                                274   1e-84    
gb|ACJ73905.1|  CAT1                                                    263   2e-84    
gb|ADQ28492.1|  catalase                                                273   4e-84    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      273   4e-84    
gb|AAZ29552.1|  catalase-C                                              272   2e-83    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      271   2e-83    
gb|EMT06167.1|  Catalase isozyme 2                                      276   2e-83    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          270   4e-83    
gb|ABR16304.1|  unknown                                                 268   2e-82    
gb|AII23739.1|  catalase                                                268   2e-82    
gb|AGT16203.1|  catalase                                                269   2e-82    
gb|ABK24543.1|  unknown                                                 268   3e-82    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    267   2e-81    
emb|CAA43814.1|  catalase                                               266   2e-81    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           266   2e-81 
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          266   3e-81    
ref|XP_005645077.1|  catalase                                           265   5e-81    
gb|AGT16310.1|  catalase                                                260   6e-79    
gb|AGT16054.1|  catalase                                                259   7e-79    
gb|AGT15888.1|  catalase                                                259   7e-79    
gb|AGT16188.1|  catalase                                                259   7e-79    
gb|ABK41476.1|  catalase                                                259   2e-78    
gb|AHZ13843.1|  catalase                                                258   2e-78    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              256   9e-78    
gb|AFW66787.1|  catalase3                                               256   1e-77    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               256   1e-77    
gb|EMS35721.1|  Catalase isozyme 1                                      249   4e-77    
gb|KIY96954.1|  catalase                                                249   8e-77    
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     252   4e-76    
gb|AFW66785.1|  catalase3 isoform 1                                     256   2e-75    
gb|AEY70510.1|  catalase                                                244   2e-75    
ref|XP_011396830.1|  Catalase isozyme 2                                 248   2e-74    
dbj|BAH20283.1|  AT1G20620                                              236   3e-74    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      248   3e-74    
ref|XP_002950455.1|  catalase                                           246   1e-73    
dbj|BAA34714.1|  catalase                                               245   3e-73    
ref|XP_001696763.1|  catalase/peroxidase                                244   5e-73    
ref|NP_001105416.1|  catalase isozyme 3                                 242   5e-72    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        242   5e-72    
gb|AFR42410.1|  catalase                                                230   5e-72    
gb|AFW66789.1|  catalase3                                               236   6e-72    
emb|CAA73663.1|  catalase                                               241   1e-71    
gb|AAB70006.1|  catalase                                                240   2e-71    
gb|AFR42412.1|  catalase                                                226   1e-70    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             236   3e-70    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            237   4e-70 
ref|XP_005708279.1|  catalase                                           236   9e-70    
gb|AFW66788.1|  catalase3                                               235   2e-69    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              235   3e-69    
gb|AAR84577.1|  catalase 1b                                             233   5e-69    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      232   4e-68    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    229   1e-67    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    227   8e-67    
dbj|BAD07937.1|  catalase catA-like protein                             215   6e-66    
gb|AKA94107.1|  catalase                                                221   6e-64    
gb|KDD77132.1|  catalase                                                216   6e-62    
gb|AID50071.1|  catalase                                                204   1e-61    
gb|ABB88582.1|  catalase                                                213   4e-61    
emb|CAA10286.1|  catalase                                               200   3e-60    
gb|AAP57673.1|  catalase                                                201   2e-59    
gb|AGS17821.1|  catalase 2                                              204   4e-59    
gb|AFH53190.1|  catalase                                                200   6e-59    
gb|AFH53189.1|  catalase                                                200   7e-59    
gb|AFH53187.1|  catalase                                                199   1e-58    
gb|ABB51561.1|  truncated catalase 2                                    204   2e-58    
gb|AFI48111.1|  catalase isozyme B                                      194   4e-58    
gb|ABY68162.1|  catalase                                                193   8e-58    
gb|ABY68159.1|  catalase                                                193   9e-58    
ref|XP_005536240.1|  catalase                                           204   1e-57    
gb|ABY68158.1|  catalase                                                193   1e-57    
gb|ABY68164.1|  catalase                                                192   1e-57    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             201   3e-57    
gb|AFI48054.1|  catalase isozyme B                                      192   3e-57    
gb|ABY68160.1|  catalase                                                191   4e-57    
gb|ABY68161.1|  catalase                                                191   5e-57    
gb|AFI48101.1|  catalase isozyme B                                      190   1e-56    
gb|AFI48068.1|  catalase isozyme B                                      190   1e-56    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 199   4e-56    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      198   5e-56    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 199   5e-56    
gb|AFI48131.1|  catalase isozyme B                                      187   1e-55    
gb|AFI48098.1|  catalase isozyme B                                      187   2e-55    
gb|ACU23083.1|  unknown                                                 189   4e-55    
gb|AFI48130.1|  catalase isozyme B                                      185   1e-54    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             194   2e-54    
gb|AAO16182.1|  catalase-1                                              183   5e-54    
emb|CBI29556.3|  unnamed protein product                                179   2e-52    
gb|KEH36313.1|  catalase heme-binding enzyme                            186   3e-51    
gb|AEA86295.1|  putative catalase                                       177   4e-51    
ref|XP_005712277.1|  unnamed protein product                            185   1e-50    
gb|ABS89000.1|  catalase                                                176   2e-50    
emb|CDP22058.1|  unnamed protein product                                175   3e-50    
ref|NP_973873.1|  catalase 3                                            183   3e-50    
gb|AFK46618.1|  unknown                                                 171   2e-49    
gb|AAR25790.1|  catalase                                                169   1e-48    
dbj|BAD94702.1|  catalase                                               169   1e-48    
gb|AFA36510.1|  catalase                                                171   1e-47    
gb|ABY68163.1|  catalase                                                167   1e-47    
gb|ACJ71245.1|  catalase 2                                              169   2e-45    
gb|ACY30463.1|  catalase                                                167   3e-45    
gb|ACJ71244.1|  catalase 2                                              167   2e-44    
ref|XP_004366029.2|  catalase isozyme 2                                 169   2e-44    
gb|KJE89728.1|  catalase isozyme 2                                      169   2e-44    
gb|AAZ03546.1|  Catalase                                                159   6e-44    
gb|ADR01107.1|  catalase 3                                              164   1e-43    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     164   2e-43    
gb|ABN79860.2|  catalase                                                159   1e-42    
ref|XP_005644653.1|  catalase-domain-containing protein                 164   1e-42    
gb|AAY22485.1|  catalase                                                154   2e-41    
gb|AAG23803.1|  catalase                                                149   3e-40    
gb|AFV96158.1|  catalase                                                148   1e-39    
ref|XP_005647994.1|  catalase-domain-containing protein                 155   2e-39    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             153   2e-39    
ref|WP_032664185.1|  catalase                                           154   3e-39    
ref|WP_032632526.1|  catalase                                           154   3e-39    
gb|KGS11078.1|  catalase                                                149   4e-39    
ref|WP_043304355.1|  catalase                                           154   5e-39    
gb|KIQ35234.1|  catalase                                                154   5e-39    
gb|AAT68776.1|  catalase                                                149   6e-39    
ref|WP_004887231.1|  catalase                                           154   6e-39    
ref|WP_015881004.1|  catalase                                           153   7e-39    
ref|XP_005642928.1|  catalase                                           153   8e-39    
ref|WP_032610664.1|  catalase                                           153   9e-39    
ref|WP_026826608.1|  catalase                                           153   9e-39    
gb|EGH29791.1|  catalase                                                147   9e-39    
ref|WP_043193175.1|  catalase                                           152   1e-38    
ref|WP_032632922.1|  catalase                                           151   3e-38    
ref|WP_038401366.1|  catalase                                           151   3e-38    
gb|AHG41775.1|  catalase                                                151   4e-38    
ref|WP_032622880.1|  catalase                                           150   6e-38    
ref|WP_029723487.1|  catalase                                           150   8e-38    
ref|WP_016429054.1|  hypothetical protein                               150   8e-38    
ref|WP_032606634.1|  catalase                                           150   9e-38    
ref|WP_044323073.1|  catalase                                           150   9e-38    
ref|WP_031421259.1|  catalase                                           150   1e-37    
ref|WP_044321845.1|  catalase                                           150   1e-37    
gb|EGH10006.1|  catalase                                                149   1e-37    
ref|WP_004665787.1|  MULTISPECIES: catalase                             149   2e-37    
ref|WP_005734719.1|  catalase                                           149   2e-37    
ref|WP_010214971.1|  catalase                                           149   2e-37    
ref|WP_041924592.1|  catalase                                           149   2e-37    



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   401 bits (1031),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/194 (97%), Positives = 194/194 (100%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RD
Sbjct  359  NYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSL
Sbjct  419  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRLNIRPTM
Sbjct  479  GQKVASRLNIRPTM  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   401 bits (1030),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/194 (97%), Positives = 194/194 (100%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENEM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RD
Sbjct  359  NYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSL
Sbjct  419  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRLNIRPTM
Sbjct  479  GQKVASRLNIRPTM  492



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   359 bits (921),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = -1

Query  850  EMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDG  671
            EM+AMDPAHIVPGIYFSDDKMLQAR+FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDG
Sbjct  1    EMLAMDPAHIVPGIYFSDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDG  60

Query  670  YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWA  491
            YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWA
Sbjct  61   YMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWA  120

Query  490  PDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  332
            PDRQDRFINRWVK+LSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  121  PDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGP
Sbjct  230  PLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGP  289

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+
Sbjct  290  NYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKRE  349

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  350  KCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSL  409

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  410  GQKLASRLNVRPSI  423



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P PLR++TG+RD
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC++EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLNIRPTM
Sbjct  479  GQKIASRLNIRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+
Sbjct  359  NYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WISY +Q DRSL
Sbjct  419  KCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++P+M
Sbjct  479  GQKIATRLNVKPSM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKN+DNFFAENE +A +PA +VPGIY+S+DK+LQARIFAY+DTHR+RLGP
Sbjct  299  PLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTHRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P P +IVTG+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K +IEKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WISY TQAD+SL
Sbjct  419  KVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL+ RP+M
Sbjct  479  GQKLASRLSARPSM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A +PAH+VPG+Y+SDDKMLQ RIFAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+ G+R+
Sbjct  359  NYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGP
Sbjct  284  PLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGP  343

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+
Sbjct  344  NYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRRE  403

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSL
Sbjct  404  KACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSL  463

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  464  GQKLASRLNVRPSI  477



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENEM+A +P  +VPGIY+S+DKMLQ RIFAY DT RHRLGP
Sbjct  300  PLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQRHRLGP  359

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P  ++TGRR+
Sbjct  360  NYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRRE  419

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+SY +QADRSL
Sbjct  420  KACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSL  479

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  480  GQKLASRLNVRPSI  493



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A +PA +VPG+Y+S+DKMLQ R+FAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP P  I+TG+RD
Sbjct  359  NYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WISY +QADRS 
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RP++
Sbjct  479  GQKLATRLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   327 bits (838),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A +PAH+VPGIY+SDDKMLQ RIFAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+
Sbjct  359  NYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ SRLN+RP++
Sbjct  479  GQKLLSRLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   327 bits (837),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG+RD
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD++L
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RPTM
Sbjct  479  GQKIASRLNVRPTM  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   327 bits (837),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A +PAH+VPGIY+S+DK+LQ RIFAY+DTHRHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAYSDTHRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN YDGYMN +HRDEE+DYFPS++D  R+AER P P R++TGRR+
Sbjct  359  NYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + VIEKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A RLN+RPTM
Sbjct  479  GQKIAFRLNVRPTM  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+N+DNFFAENE +A +PA +VPGIYFS+DK+LQARIFAY+DTHR+RLGP
Sbjct  299  PLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P P +IVTG+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + +IEKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WISY TQAD+S+
Sbjct  419  RVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSI  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS L+ RP+M
Sbjct  479  GQKLASSLSARPSM  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A +PAH+VPGIY+SDDK+LQ RIFAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P  I++G+R+
Sbjct  359  NYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ SRLN+RP++
Sbjct  479  GQKLLSRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI+TGRR+
Sbjct  359  NYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WISY +Q D+SL
Sbjct  419  KCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++P M
Sbjct  479  GQKIATRLNVKPCM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  115  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGP  174

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+
Sbjct  175  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRRE  234

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  235  KCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSL  294

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL++RP +
Sbjct  295  GQKIASRLSMRPNI  308



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP P  I++G+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE VA  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+P  I +GRR+
Sbjct  359  NYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP+ 
Sbjct  479  GQKLASRLNVRPSF  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  KCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   324 bits (831),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I++G+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   324 bits (831),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNVRPSV  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   317 bits (812),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGP
Sbjct  98   PLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGP  157

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+
Sbjct  158  NYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKRE  217

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SL
Sbjct  218  KACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSL  277

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  278  GQKIASRLNVRPNI  291



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P +I TG+R+
Sbjct  359  NYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P+M
Sbjct  479  GQKLASRLNVKPSM  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ R+F+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI+Y +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P  + +GRR+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNVRPSI  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P  +++G+RD
Sbjct  359  NYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WISY +QAD+SL
Sbjct  419  KCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RPTM
Sbjct  479  GQKIATRLNVRPTM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFF ENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P  +VTGRR+
Sbjct  359  NYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WISY +Q D+SL
Sbjct  419  KSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++PTM
Sbjct  479  GQKIATRLNVKPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  151  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  210

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+
Sbjct  211  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRRE  270

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+
Sbjct  271  KCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSV  330

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  331  GQKLASRLNVRPSI  344



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WISYL+QAD+S 
Sbjct  419  KCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGRMVLNKNIDNFFAENEM+A  P  IVPGI FS+DKMLQ RIFAY DT RHRLGP
Sbjct  299  PLIPVGRMVLNKNIDNFFAENEMLAFSPHMIVPGINFSNDKMLQTRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P P  ++TGRRD
Sbjct  359  NYLLLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+SY +QAD+S 
Sbjct  419  RRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RPTM
Sbjct  479  GQKLASRLNVRPTM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS 
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   322 bits (826),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P P RI+TG+RD
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WISY +QAD+SL
Sbjct  419  RCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            G+K+ASRLN+RPTM
Sbjct  479  GEKIASRLNVRPTM  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  190  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGP  249

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+
Sbjct  250  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRRE  309

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S 
Sbjct  310  MCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSC  369

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  370  GQKVASRLTLKPTM  383



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   322 bits (826),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WISY +QADRS 
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQ +GR+VLN+NIDN+FAENEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGP
Sbjct  68   PLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGP  127

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+
Sbjct  128  NYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRRE  187

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SL
Sbjct  188  KCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSL  247

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP  
Sbjct  248  GQKLASRLNVRPNF  261



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+
Sbjct  359  NYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSL
Sbjct  419  KVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRP  338
            GQK+ASRLN++P
Sbjct  479  GQKLASRLNVKP  490



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRM+LNKNIDNFF+ENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP P  ++TGRR+
Sbjct  359  NYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WISY +Q DRSL
Sbjct  419  KCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++P+M
Sbjct  479  GQKIATRLNVKPSM  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD
Sbjct  359  NYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SL
Sbjct  419  RCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP+M
Sbjct  479  GQKIASCLNVRPSM  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENEM+A +PA +VPGIY+++DKMLQ RIFAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P  I  G+R+
Sbjct  359  NYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WISY +QADRSL
Sbjct  419  KVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRP  338
            GQK+ASRLN++P
Sbjct  479  GQKLASRLNVKP  490



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQ +GR+VLN+NIDN+FAENEM+A DP H+VPGI++S+DK+ Q R FAYADT RHRLGP
Sbjct  77   PLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQRHRLGP  136

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I++GRR+
Sbjct  137  NYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRRE  196

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+SY +Q D+SL
Sbjct  197  KCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSL  256

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP  
Sbjct  257  GQKLASRLNVRPNF  270



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFF ENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP P R++TG+R+
Sbjct  359  NYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WISY +Q D+SL
Sbjct  419  KCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
             QK+A+RL+++P+M
Sbjct  479  SQKLATRLSVKPSM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P  +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P RI TG+R+
Sbjct  359  NYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++P+M
Sbjct  479  GQKLATRLNVKPSM  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  151  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGP  210

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R+
Sbjct  211  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRE  270

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSL
Sbjct  271  RCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSL  330

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  331  GQKLASHLNVRPSI  344



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y SDDK+LQ RIF+Y+D  RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  ++TG+RD
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W SY +QAD++L
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RPTM
Sbjct  479  GQKIASRLNVRPTM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P P RI+TG+RD
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WISY +QAD+SL
Sbjct  419  RCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            G+K+ASRLN+RPTM
Sbjct  479  GEKIASRLNVRPTM  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S 
Sbjct  419  MCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRG  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SL
Sbjct  419  KICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP M
Sbjct  479  GQKLASRLNVRPAM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP P  + TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WISY TQ D+ L
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RP++
Sbjct  479  GQKLATRLNVRPSI  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  KCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLLVKPTM  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS 
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P  +++G+R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRG  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+SY +QAD+SL
Sbjct  419  KICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RPTM
Sbjct  479  GQKLASHLNVRPTM  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I TG+R+
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WISY +QADRS 
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P R++ G+RD
Sbjct  359  NYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+I+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+SY +QAD+SL
Sbjct  419  RCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++PTM
Sbjct  479  GQKLASRLNVKPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   311 bits (798),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  72   PLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  131

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P   + G+RD
Sbjct  132  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRD  191

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +  IEKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+SY TQAD+SL
Sbjct  192  RICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSL  251

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLNIRPTM
Sbjct  252  GQKLASRLNIRPTM  265



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S 
Sbjct  419  MCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTLKPTM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S 
Sbjct  419  MCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTLKPTM  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   319 bits (818),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P  I +GRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS L+ RP +
Sbjct  479  GQKIASHLSTRPNI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   319 bits (818),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  479  GQKIASHLNMRPNI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   319 bits (818),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P  I +GRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  479  GQKIASHLNMRPNI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   322 bits (824),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ+RIF+YADT RHRLGP
Sbjct  391  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQRHRLGP  450

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P  ++ G+RD
Sbjct  451  NYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRD  510

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WISY TQAD+SL
Sbjct  511  RCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSL  570

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP+M
Sbjct  571  GQKIASCLNVRPSM  584



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  I +GRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL++RP +
Sbjct  479  GQKIASRLSMRPNI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFFAENE +A  P+ +VPGIYFSDDK+LQARIFAY DT RHR+GP
Sbjct  299  PLQPVGRLVLNRNIDNFFAENEQLAFSPSLVVPGIYFSDDKVLQARIFAYGDTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP P   + GRRD
Sbjct  359  NYLQLPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + +IEKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WISYL+QADRSL
Sbjct  419  RRIIEKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWISYLSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQKVAS LN+RP++
Sbjct  479  GQKVASHLNMRPSI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P P  +++G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  KRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RPTM
Sbjct  479  GQKLASRLNVRPTM  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P RI+ G R+
Sbjct  359  NYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI+Y +Q D+ L
Sbjct  419  KCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLNI+PT+
Sbjct  479  GQKLASRLNIKPTL  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP P  I+TG+RD
Sbjct  359  NYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WISY +QADRS 
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RP++
Sbjct  479  GQKLATRLNVRPSI  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+
Sbjct  359  NYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSL
Sbjct  419  KCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN++P++
Sbjct  479  GQKIASHLNLKPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQ VGRMVLNKNIDNFFAENE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQAVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P RI+TGRR+
Sbjct  359  NYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WISY +Q D+SL
Sbjct  419  KCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            G+K+A+RLN++P+M
Sbjct  479  GRKIATRLNVKPSM  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+
Sbjct  419  KCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSV  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A +PA +VPGIY+SDDK+LQ RIFAY+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP P  I+TG+R+
Sbjct  359  NYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + VIEKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WISY +QAD+SL
Sbjct  419  RRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RP++
Sbjct  479  GQKIATRLNVRPSI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPGI +SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I TG R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C IEKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWISY +QADRSL
Sbjct  419  RCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKIASHLNLRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+
Sbjct  419  RCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSV  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++ GRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WISYL+QAD+S 
Sbjct  419  MCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTLKPTM  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  I  G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P P RI+ G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN++P++
Sbjct  479  GQKIASHLNLKPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP P  + +GRR+
Sbjct  359  NYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QA +SL
Sbjct  419  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P +
Sbjct  479  GQKLASRLNVKPNI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TG+RD
Sbjct  359  NYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WISY TQAD+SL
Sbjct  419  RCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RPTM
Sbjct  479  GQKLASRLNVRPTM  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I +GRR+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDN+FAE E +A +PA +VPGIY+++DK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P P  ++ G+RD
Sbjct  359  NYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WISY +QAD+SL
Sbjct  419  RCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RPTM
Sbjct  479  GQKMATRLNVRPTM  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+
Sbjct  359  NYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRICSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+SY +QAD+SL
Sbjct  419  KACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKIASRLNVRPNI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WISY +QADRSL
Sbjct  419  RCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+
Sbjct  359  NYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SL
Sbjct  419  KCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+
Sbjct  359  NYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SL
Sbjct  419  KCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQP GR+VLN+NIDNFF ENE +A +P  +VPGIY+SDDKMLQ RIFAY DT RHRLGP
Sbjct  294  PLQPAGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQRHRLGP  353

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P RI +G+R+
Sbjct  354  NYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKRE  413

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+SY +QAD+SL
Sbjct  414  KACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSL  473

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  474  GQKIASRLNVRPNI  487



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R+
Sbjct  359  NYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRS+
Sbjct  419  RCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSV  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNMRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P P R++TG+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K +IEKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WISY +QAD+SL
Sbjct  419  KVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLNIRPTM
Sbjct  479  GQKLASRLNIRPTM  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGP
Sbjct  283  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGP  342

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+
Sbjct  343  NYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRRE  402

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WISY +QA +SL
Sbjct  403  KCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSL  462

Query  373  GQKVASRLNIRPTM  332
            GQK+ +RLN+RP++
Sbjct  463  GQKLTARLNVRPSI  476



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  284  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  343

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  344  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  403

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  404  RCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  463

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  464  GQKLASRLNVRPSI  477



>ref|XP_011654267.1| PREDICTED: catalase isozyme 1 [Cucumis sativus]
 gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI+Y +QADRS+
Sbjct  419  RCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSV  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP N+PKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P R + G+R+
Sbjct  359  NYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN++P++
Sbjct  479  GQKIASHLNLKPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  419  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006828714.1| PREDICTED: catalase-1/2 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLN+NIDNFF ENE +A +P  +VPGIY+SDDK LQAR FAY DT RHRLGP
Sbjct  299  PLQPVGRMVLNRNIDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P P ++V+G+R+
Sbjct  359  NYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WISY +Q D+SL
Sbjct  419  RCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLNI+P M
Sbjct  479  GQKIATRLNIKPHM  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  257  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGP  316

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+
Sbjct  317  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRE  376

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  377  RCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSL  436

Query  373  GQKVASRLNI  344
            GQK+ASRLN+
Sbjct  437  GQKLASRLNV  446



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+S+DK+LQ RIF+YADT RHRLGP
Sbjct  319  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQRHRLGP  378

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP  I  GRR+
Sbjct  379  NYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRRE  438

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WISY +QA +SL
Sbjct  439  KCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSL  498

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  499  GQKLASRLNVRPNI  512



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P  + TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+S+
Sbjct  419  KCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSV  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASLLNVRPSI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  122  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  181

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNNS DG MNF+HRDEEVDY PS+FD  R AE++P P  ++ G R 
Sbjct  182  NYMQLPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRT  241

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CV  KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WISYL+QAD+S 
Sbjct  242  MCVTPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWISYLSQADKSC  301

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++P M
Sbjct  302  GQKVASRLTVKPPM  315



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  298  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQRHRLGP  357

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P  + +G+R+
Sbjct  358  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRE  417

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  418  KCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSL  477

Query  373  GQKVASRLNI  344
            GQK+ASRLN+
Sbjct  478  GQKLASRLNV  487



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  296  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGLYYSEDKLLQTRIFAYADTQRHRIGP  355

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P R++TGRR+
Sbjct  356  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRRE  415

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI  L+QAD+S 
Sbjct  416  MCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSC  475

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  476  GQKVASRLTLKPTM  489



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   315 bits (806),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  419  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   315 bits (806),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   315 bits (806),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  300  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGP  359

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R+
Sbjct  360  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRE  419

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSL
Sbjct  420  RCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSL  479

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  480  GQKIASHLNMRPSI  493



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  184  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  243

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R 
Sbjct  244  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRT  303

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  304  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSL  363

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  364  GQKLASRLNVRPSI  377



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   315 bits (806),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFFAENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  I+TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SL
Sbjct  419  KCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P P R++TG+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K +IEKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WISY +QAD+SL
Sbjct  419  KVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLNIRPTM
Sbjct  479  GQKLASRLNIRPTM  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YAD+ RHRLGP
Sbjct  240  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQRHRLGP  299

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P RI+ G+R+
Sbjct  300  NYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKRE  359

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WISY +QADRSL
Sbjct  360  KCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSL  419

Query  373  GQKVASRLN  347
            GQK+AS LN
Sbjct  420  GQKIASHLN  428



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  298  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  357

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  358  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  417

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  418  RCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  477

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  478  GQKLASRLNVRPSI  491



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP   ++G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WISY +QADRSL
Sbjct  419  RCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKIASHLNMRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   314 bits (805),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  419  RCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RD
Sbjct  359  NYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSL  478

Query  373  GQKVASRLNIRP  338
            GQK+ASRLN++P
Sbjct  479  GQKIASRLNVKP  490



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  + +GRR+
Sbjct  359  NYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  479  GQKIASHLNMRPNI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P R++TG+R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI+Y +Q D+SL
Sbjct  419  KCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RP+M
Sbjct  479  GQKLATRLNMRPSM  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+N+DNFFAENEM+A  P+ IVPGIYFS+DKMLQ RIFAYADT RHR+GP
Sbjct  320  PLMPVGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAYADTQRHRIGP  379

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP P  +++G+R 
Sbjct  380  NYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRV  439

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VIEKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+SY TQAD+SL
Sbjct  440  KTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSL  499

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP M
Sbjct  500  GQKLASRLNVRPAM  513



>prf||2104177A catalase
Length=492

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P   ++G+RD
Sbjct  359  NYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+SY +QAD+SL
Sbjct  419  KCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSL  478

Query  373  GQKVASRLNIRP  338
            GQK+ASRLN++P
Sbjct  479  GQKIASRLNVKP  490



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   313 bits (803),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  292  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  351

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  352  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  411

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  412  RCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  471

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  472  GQKLASRLNVRPNI  485



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  419  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  307  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  366

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  367  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  426

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  427  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  486

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  487  GQKLASRLNVRPSI  500



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  419  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  I +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN+RP++
Sbjct  479  GQKLANRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WISY TQAD+SL
Sbjct  419  RCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSL  478

Query  373  GQKVASRLNIRP  338
            GQK+ASRLN+RP
Sbjct  479  GQKLASRLNVRP  490



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  284  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  343

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  344  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  403

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD++L
Sbjct  404  RCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  463

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  464  GQKLASHLNVRPSI  477



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKIASRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  419  KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR 
Sbjct  359  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  NCVIPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKN+DNFFAE EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNVDNFFAETEMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  I +G R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAICSGERV  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WISYL+Q+D+SL
Sbjct  419  KCVIEKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWISYLSQSDKSL  478

Query  373  GQKVASRLNIRPTM  332
            G KVA+RLN+RP+ 
Sbjct  479  GMKVANRLNVRPSF  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ +DNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTVDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  419  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  298  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  357

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  358  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  417

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  418  KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  477

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  478  GQKLASRLNVRPSI  491



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  350  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  409

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  410  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  469

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  470  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  529

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  530  GQKLASRLNVRPSI  543



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKN+DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  160  PLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  219

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  220  NYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCRE  279

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +L
Sbjct  280  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAAL  339

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P+M
Sbjct  340  GQKLASRLNLKPSM  353



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  419  KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  265  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  324

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R 
Sbjct  325  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRT  384

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  385  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSL  444

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  445  GQKLASRLNVRPSI  458



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P  I TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + VI+KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  RTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPG+Y+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGVYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P  ++TGRR+
Sbjct  359  NYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  KCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRL  350
            GQKVASRL
Sbjct  479  GQKVASRL  486



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  363  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  422

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  423  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  482

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QADRSL
Sbjct  483  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSL  542

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  543  GQKLASRLNVRPSI  556



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  KCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  297  PLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  356

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+
Sbjct  357  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKRE  416

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SL
Sbjct  417  KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSL  476

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  477  GQKLASHLNMRPSI  490



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFFAENE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFAENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+
Sbjct  359  NYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SL
Sbjct  419  KIVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSL  478

Query  373  GQKVASRLNIRPTM  332
            GQKVA+RLN++P+M
Sbjct  479  GQKVANRLNVKPSM  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQ +GR+VLN+NIDN+FAENEM+A DP HIVPGI++S+DK+ Q R FAYADT RHRLGP
Sbjct  299  PLQQIGRLVLNRNIDNWFAENEMLAFDPGHIVPGIHYSNDKLFQLRTFAYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY +LPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P  I +GRR+
Sbjct  359  NYKMLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIPNAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+SY ++ D SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVSYWSKCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFFAENE +A  P  +VPGIY+SDDKMLQ R+FAYADT R+RLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFAENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYADTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P R+VTG+R+
Sbjct  359  NYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+YLTQ D SL
Sbjct  419  KTVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSL  478

Query  373  GQKVASRLNIRPTM  332
            GQKVA+RLN++P+M
Sbjct  479  GQKVANRLNVKPSM  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WISY +QAD+SL
Sbjct  419  KCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  109  PLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGP  168

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+
Sbjct  169  NYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCRE  228

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SL
Sbjct  229  KCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASL  288

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL I+P M
Sbjct  289  GQKLASRLKIKPNM  302



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNF AENE +A  PA IVPGIY+SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQP+GRMVLNKNIDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKIASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  419  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   311 bits (798),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKLASHLNMRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  419  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  419  KCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   306 bits (784),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLN+NIDNFFAENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  146  PLQPVGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  205

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P P   +TGRRD
Sbjct  206  NYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRD  265

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+S  +QADRSL
Sbjct  266  KTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSL  325

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL+ +P+M
Sbjct  326  GQKLASRLSAKPSM  339



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFF ENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  287  PLQPVGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  346

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  347  NYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  406

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  407  RCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSL  466

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  467  GQKLASRLNVRPSI  480



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   311 bits (797),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  + PGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVPPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  419  KCVIKKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   311 bits (797),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SL
Sbjct  419  KCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SL
Sbjct  419  KCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  283  PLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  342

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+
Sbjct  343  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKRE  402

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SL
Sbjct  403  KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSL  462

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  463  GQKLASHLNMRPGI  476



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WISY +Q D SL
Sbjct  419  KCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+
Sbjct  359  NYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS L++RP +
Sbjct  479  GQKIASHLSMRPNI  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+
Sbjct  359  NYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSL
Sbjct  419  KVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL+ +P+M
Sbjct  479  GQKLASRLSAKPSM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P P  + TG+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SL
Sbjct  419  RCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSL  478

Query  373  GQKVASRLNIR  341
            GQK+ASRLN++
Sbjct  479  GQKLASRLNVK  489



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+
Sbjct  359  NYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+SY +QADRSL
Sbjct  419  KVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL+ +P+M
Sbjct  479  GQKLASRLSAKPSM  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P  +VPGI +S+DK+LQ RIF+Y+DT RHRLG 
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSYSDTQRHRLGS  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP P  I +GRRD
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WISY TQ DRSL
Sbjct  419  KCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A RLN+RP++
Sbjct  479  GQKLAFRLNVRPSI  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR 
Sbjct  359  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  NCVIPKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SL
Sbjct  419  KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  479  GQKLASHLNMRPGI  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  P  IVPG+Y+++DK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    TG+R+
Sbjct  359  NYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WISY +Q D+SL
Sbjct  419  KCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++  M
Sbjct  479  GQKIAARLNMKANM  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  419  KCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A+ PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P  +VPG+++SDDKMLQ RIF+Y+D+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSYSDSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  +++G+RD
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C IEKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RPTM
Sbjct  479  GQKLASRLNVRPTM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SL
Sbjct  419  KCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SL
Sbjct  419  KCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT RHRLGP
Sbjct  318  PLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGP  377

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P  I TG+R+
Sbjct  378  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKRE  437

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WISY +QAD+SL
Sbjct  438  KCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSL  497

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  498  GQKLASHLNMRPGI  511



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P    TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WISY +QADRSL
Sbjct  419  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA +VPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++ GRR+
Sbjct  359  NYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++Y  QAD+SL
Sbjct  419  KCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP M
Sbjct  479  GQKLASRLNVRPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WISY +Q D SL
Sbjct  419  KCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDN+FAENEM+A +PAH+VPG+Y+S+DK+ Q R+FAY+DT RHRLG 
Sbjct  299  PLHPVGRLVLNRNIDNWFAENEMLAFNPAHVVPGVYYSNDKLFQLRLFAYSDTQRHRLGT  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P  I +GRR+
Sbjct  359  NYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S+ TQ D+SL
Sbjct  419  KCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P  + +G R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD  RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADPQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  I +GRR+
Sbjct  359  NYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS L++RP +
Sbjct  479  GQKIASHLSMRPNI  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR 
Sbjct  359  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  NCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  419  KCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  282  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  341

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+
Sbjct  342  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKRE  401

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  402  KCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  461

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  462  GQKLASRLNVRPSI  475



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P  ++ GRR 
Sbjct  359  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIPACVLNGRRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  NCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  P+ IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WISY +QAD+SL
Sbjct  419  KCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKIASRLNVRPSI  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKN+DNFFAE EM+A +P  +VPGIY+S DK+LQARIFAY DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNVDNFFAETEMLAFNPGLVVPGIYYSQDKLLQARIFAYGDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P  + +G R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERI  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WISYL+Q+D+SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWISYLSQSDKSL  478

Query  373  GQKVASRLNIRPTM  332
            G KVA+RLN+RP+ 
Sbjct  479  GMKVANRLNVRPSF  492



>ref|XP_012065377.1| PREDICTED: catalase-2 [Jatropha curcas]
 gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   309 bits (792),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLN+NIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P  ++TGRR+
Sbjct  359  NYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WISY +QAD+SL
Sbjct  419  KTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RPTM
Sbjct  479  GQKIASHLNMRPTM  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P  +VPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P P  ++ G RD
Sbjct  359  NYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            + +I+KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WISY +QAD+S+
Sbjct  419  RQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSV  478

Query  373  GQKVASRLNIRPTM  332
            G K+ASRLN+RPTM
Sbjct  479  GMKLASRLNVRPTM  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P+ IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P  I +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY ++AD+SL
Sbjct  419  KCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL++RP++
Sbjct  479  GQKLASRLSVRPSI  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR 
Sbjct  359  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  NCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 176/198 (89%), Gaps = 4/198 (2%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQA  386
            +CVIEKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+PR+THEIRS WISY +QA
Sbjct  419  RCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQA  478

Query  385  DRSLGQKVASRLNIRPTM  332
            D++LGQK+ASRLN+RP++
Sbjct  479  DKTLGQKLASRLNVRPSI  496



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNID+FFAENE +A  P  IVPGI++SDDK+LQ R+F+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P  + +GRR+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+IEKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  419  RCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASR+N+RP +
Sbjct  479  GQKLASRMNVRPNI  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+
Sbjct  359  NYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WISY +Q+D+SL
Sbjct  419  KCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++  M
Sbjct  479  GQKIAARLNMKANM  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  298  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  357

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR 
Sbjct  358  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRT  417

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  418  NCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSC  477

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  478  GQKVASRLTVKPTM  491



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKN+DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +L
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAAL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P+M
Sbjct  479  GQKLASRLNLKPSM  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKN+DNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WISY +Q D +L
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAAL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P+M
Sbjct  479  GQKLASRLNLKPSM  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLN+NIDNFFAENE +A +P HIVPGIY+S+DK+LQ RIFAYADT RHR+GP
Sbjct  299  PLIPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P  ++ GRR 
Sbjct  359  NYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPACVLNGRRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
             CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WISYL+QAD+S 
Sbjct  419  NCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWISYLSQADKSC  478

Query  373  GQKVASRLNIRPTM  332
            GQKVASRL ++PTM
Sbjct  479  GQKVASRLTVKPTM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNF  ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  292  PLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  351

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P  + TG+R+
Sbjct  352  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKRE  411

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  412  KCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSL  471

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  472  GQKLASRLNVRPSI  485



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 177/198 (89%), Gaps = 4/198 (2%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRSTWISYLTQA  386
            +CVIEKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIRS WISY +QA
Sbjct  419  RCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQA  478

Query  385  DRSLGQKVASRLNIRPTM  332
            D++LGQK+ASRLN+RP++
Sbjct  479  DKTLGQKLASRLNVRPSI  496



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WISY +QADRSL
Sbjct  419  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLN+NIDNFF+ENE +A  P  IVPGIY+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P   +TGRR+
Sbjct  359  NYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVNLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI KENNFKQPG+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+SY +QADRSL
Sbjct  419  KTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL+ +P+M
Sbjct  479  GQKLASRLSAKPSM  492



>ref|XP_010692544.1| PREDICTED: catalase-like [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKN+DNFF ENE +A DPAH+VPGIYFS+DKMLQAR FAYADTHR+RLG 
Sbjct  299  PLQPVGRLVLNKNVDNFFTENEQLAFDPAHVVPGIYFSNDKMLQARTFAYADTHRYRLGI  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC + N   DG MN VHRDEE+DYFPS+FD  R AERFP P  I+ GRR+
Sbjct  359  NYLQLPVNAPKCPHTNMHRDGAMNMVHRDEEIDYFPSRFDPLREAERFPIPTAIIHGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K +I KENNFK+PG RYRSW P RQDRF+ R+VK+LS+PR+T+EIRS W+SYLTQAD+SL
Sbjct  419  KQIIPKENNFKEPGVRYRSWDPARQDRFVGRFVKALSDPRLTYEIRSIWVSYLTQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            G KVASRLNIRPTM
Sbjct  479  GMKVASRLNIRPTM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P +  TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WISY +QAD SL
Sbjct  419  KCIIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>ref|XP_012073649.1| PREDICTED: catalase isozyme 2 [Jatropha curcas]
 gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQP+GR+VLN+NIDN+FAENEM+A +PAH+VPGI++S+DK+ Q R FAY+DT RHRLGP
Sbjct  299  PLQPIGRLVLNRNIDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTFAYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM LPVNAPKC +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P P  I++GRR+
Sbjct  359  NYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAIISGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+SY +Q D+SL
Sbjct  419  KCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSYWSQCDQSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP +
Sbjct  479  GQKLASRLNVRPNI  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP  + +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI Y +QAD++ 
Sbjct  419  RCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTF  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  P  +VPG+ +S+DK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P  I +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WISY  Q D+SL
Sbjct  419  KCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++P++
Sbjct  479  GQKLATRLNVKPSI  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFF ENE +A  PA +VPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P P  ++TGRR+
Sbjct  359  NYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WISY +QAD+SL
Sbjct  419  KTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLNIRP++
Sbjct  479  GQKLASRLNIRPSI  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 170/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD TR+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQ G+R+RS+ P RQDRFI RWV +LS+PRVTHE  + WI+Y +Q D SL
Sbjct  419  KCIIEKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWINYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT R+RLGP
Sbjct  212  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRYRLGP  271

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCAYHNN +DG+MNF+ RDEE++YFPS+ D TR+AER+P P  + TG+R+
Sbjct  272  NYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRE  331

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SL
Sbjct  332  RCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSL  391

Query  373  GQKVASRLNIR  341
            G K+AS  N++
Sbjct  392  GHKLASHFNLK  402



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  205  PLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGP  264

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+
Sbjct  265  NYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCRE  324

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SL
Sbjct  325  KCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASL  384

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL I+P M
Sbjct  385  GQKLASRLKIKPNM  398



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRM+LNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD TR+A+++P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQ G+RYRS+ P RQDRFI RWV +LS+ RVTHEI+  WISY +Q D SL
Sbjct  419  KCIIEKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWISYWSQCDTSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ SRL  +P M
Sbjct  479  GQKLGSRLKAKPNM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+
Sbjct  359  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI+Y +QAD+SL
Sbjct  419  KCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>ref|XP_006828715.1| PREDICTED: catalase-1/2 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL  VGRMVLN+NIDNFF ENE +A  PA +VPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLLLVGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP P +I +G+R+
Sbjct  359  NYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WISY +Q D+SL
Sbjct  419  KCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+ LN++P M
Sbjct  479  GQKLATHLNLKPNM  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+ IDNFF E E +A +P  +VPGIY+SDDK+LQ RIFAY DT RHRLGP
Sbjct  299  PLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP    TG R 
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRT  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W SY  +ADRSL
Sbjct  419  KCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTSYWLKADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  479  GQKLASRLNVRPSI  492



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+N+DNFFAENE +A  P  +VPGIY+SDDK+LQ R+FAY D  R+RLG 
Sbjct  299  PLQPVGRLVLNRNVDNFFAENEQLAFSPGVVVPGIYYSDDKLLQCRVFAYGDAQRYRLGA  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NYM+LPVNAPKCA+HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P   ++ TG+R+
Sbjct  359  NYMMLPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPILTKVYTGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VI KENNFKQPGDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+SYL+Q DRSL
Sbjct  419  KTVIPKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSL  478

Query  373  GQKVASRLNIRPTM  332
            G KVA+RLN+RPTM
Sbjct  479  GMKVATRLNMRPTM  492



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDKMLQ RIF+YAD+ RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE+ P P    +  R+
Sbjct  359  NYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTANFSACRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC I K+NNFKQPG+RYRSWAPDRQDRF+ RWV +LS+PRVTHEIRS WISY +QADRSL
Sbjct  419  KCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWISYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP++
Sbjct  479  GQKIASHLNMRPSI  492



>ref|XP_011654421.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=431

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPGIY+SDDK+LQ RIF+YADT R+RLGP
Sbjct  238  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRYRLGP  297

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCAYHNN +DG+MNF+ RDEE++YFPS+ D TR+AER+P P  + TG+R+
Sbjct  298  NYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRE  357

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WISY +QAD+SL
Sbjct  358  RCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSL  417

Query  373  GQKVASRLNIR  341
            G K+AS  N++
Sbjct  418  GHKLASHFNLK  428



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA IVPGI++SDDK+LQ R+F+YADT RHRLGP
Sbjct  287  PLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQRHRLGP  346

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+++  R+AE++PTP  +  G+R+
Sbjct  347  NYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRE  406

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +CVIEKENNFK+PG+RYR + P+RQ+RFI RW+++LS+PR+THEIRS WISY +QAD+SL
Sbjct  407  RCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSL  466

Query  373  GQKVASRLNIRPTM  332
            GQK+AS LN+RP +
Sbjct  467  GQKLASHLNVRPNI  480



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA +VPGIY+++DK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P    +G R+
Sbjct  359  NYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WI Y +Q+D+SL
Sbjct  419  KCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFYWSQSDKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A+RLN++  M
Sbjct  479  GQKIAARLNMKANM  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   306 bits (783),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENEM+A   + +VPGI++SDDKMLQAR FAYADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEMLAFSMS-LVPGIHYSDDKMLQARSFAYADTQRHRLGP  357

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R+
Sbjct  358  NYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRE  417

Query  553  KCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRS  377
            +CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRS
Sbjct  418  RCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRS  477

Query  376  LGQKVASRLNIRPTM  332
            LGQK+ASRLN+RP +
Sbjct  478  LGQKIASRLNVRPNI  492



>ref|XP_012073648.1| PREDICTED: catalase isozyme 1 [Jatropha curcas]
Length=492

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PL PVGR+VLNKNIDNFFAENEM+A  P  +VPG+ +S+DK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLHPVGRLVLNKNIDNFFAENEMLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R++E FP P  I +G+R+
Sbjct  359  NYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHSEAFPFPATICSGKRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KCVI KENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PRVTHEI S WI+Y TQ DRSL
Sbjct  419  KCVIPKENNFKQPGERYRSWAPDRQERFLNRIVGCLSDPRVTHEICSIWINYFTQCDRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P++
Sbjct  479  GQKLASRLNVKPSI  492



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPV+APKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R+ TG R+
Sbjct  359  NYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVQTGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE VA  PA IVPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P R++TG  +
Sbjct  359  NYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCGE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WISY +Q D SL
Sbjct  419  KCIIQKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEHHTIWISYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P M
Sbjct  479  GQKLASRLNLKPNM  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENEM+A   + +VPGI++SDDKMLQAR FAYADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEMLAFSMS-LVPGIHYSDDKMLQARSFAYADTQRHRLGP  357

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P  ++TG+R+
Sbjct  358  NYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRE  417

Query  553  KCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRS  377
            +CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WISY +QADRS
Sbjct  418  RCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRS  477

Query  376  LGQKVASRLNIRPTM  332
            LGQK+ASRLN+RP +
Sbjct  478  LGQKIASRLNVRPNI  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLNKNIDNFFAENE +A  PA IVPG+Y+SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P  ++TGRRD
Sbjct  359  NYLQLPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPLPPPMLTGRRD  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            +C+++KENNFKQPG+RYRS++ DRQ+RFI+R V +LS+PRVTHEIRS WISY TQA +SL
Sbjct  419  RCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWISYWTQACKSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN++P++
Sbjct  479  GQKLASRLNVKPSI  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFFAENE +A  P  IVPG+Y+SDDK+LQ RIF+Y+DT RHRLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+LLP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P P R + GRR+
Sbjct  359  NYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRTLNGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+SY +QADRSL
Sbjct  419  KMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWSQADRSL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+A RL+++P+M
Sbjct  479  GQKLAGRLSVKPSM  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQP+GR+VLNKNIDNFF ENE +A  P+ +VPG+Y+SDDKMLQ RIF+Y+DT R+RLGP
Sbjct  291  PLQPLGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQRYRLGP  350

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P  + +G+R+
Sbjct  351  NYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTVCSGKRE  410

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNF+QPG+RYRS++ DRQ+RFI RWV++LS+PR+T+EIRS WISY +QAD+SL
Sbjct  411  KCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSL  470

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRLN+RP++
Sbjct  471  GQKLASRLNVRPSI  484



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGR+VLN+NIDNFF+ENE +A  P  +VPGIY+SDDKMLQ R FAY DT R+RLGP
Sbjct  299  PLQPVGRLVLNRNIDNFFSENEQLAFSPGIVVPGIYYSDDKMLQCRTFAYGDTQRYRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+ N+ YDG MNF+HRDEEV+YFPS+ D  R+AER+P   RIVTGRR+
Sbjct  359  NYLMLPVNAPKCAHKNSHYDGLMNFMHRDEEVNYFPSRHDPLRHAERYPINNRIVTGRRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+IEK+N+FKQPGDRYRSWA DRQ+RF+ RWV++L+ P+V+HE+RS W+SYL+++D SL
Sbjct  419  KCIIEKQNDFKQPGDRYRSWAHDRQERFVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSL  478

Query  373  GQKVASRLNIRPTM  332
            GQKVA+RLN++P+M
Sbjct  479  GQKVANRLNMKPSM  492



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = -1

Query  913  PLQPVGRMVLNKNIDNFFAENEMVAMDPAHIVPGIYFSDDKMLQARIFAYADTHRHRLGP  734
            PLQPVGRMVLNKNIDNFFAENE +A  PA  VPGI++SDDK+LQ RIF+YADT RHRLGP
Sbjct  299  PLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQRHRLGP  358

Query  733  NYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRD  554
            NY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P R+++G R+
Sbjct  359  NYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCRE  418

Query  553  KCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSL  374
            KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+SY +Q D SL
Sbjct  419  KCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASL  478

Query  373  GQKVASRLNIRPTM  332
            GQK+ASRL I+P M
Sbjct  479  GQKLASRLKIKPNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2118266961610