BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8320

Length=854
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009765667.1|  PREDICTED: pentatricopeptide repeat-containi...    143   2e-35   Nicotiana sylvestris
ref|XP_009608994.1|  PREDICTED: pentatricopeptide repeat-containi...    139   4e-34   Nicotiana tomentosiformis
gb|EYU42022.1|  hypothetical protein MIMGU_mgv1a018881mg                129   1e-30   Erythranthe guttata [common monkey flower]
ref|XP_011095140.1|  PREDICTED: pentatricopeptide repeat-containi...    127   6e-30   
ref|XP_004246986.1|  PREDICTED: pentatricopeptide repeat-containi...    125   3e-29   
ref|XP_007140083.1|  hypothetical protein PHAVU_008G082800g             120   1e-27   Phaseolus vulgaris [French bean]
ref|XP_002323670.2|  hypothetical protein POPTR_0016s14370g             120   1e-27   
gb|KDP21868.1|  hypothetical protein JCGZ_00655                         119   5e-27   Jatropha curcas
ref|XP_012091050.1|  PREDICTED: putative pentatricopeptide repeat...    119   6e-27   
gb|KHN29504.1|  Pentatricopeptide repeat-containing protein, mito...    115   2e-26   Glycine soja [wild soybean]
ref|XP_010653334.1|  PREDICTED: pentatricopeptide repeat-containi...    117   3e-26   
ref|XP_008345572.1|  PREDICTED: pentatricopeptide repeat-containi...    116   5e-26   
ref|XP_007033528.1|  Pentatricopeptide repeat superfamily protein...    116   6e-26   
ref|XP_006587922.1|  PREDICTED: pentatricopeptide repeat-containi...    115   8e-26   Glycine max [soybeans]
ref|XP_011002598.1|  PREDICTED: putative pentatricopeptide repeat...    115   1e-25   Populus euphratica
gb|KJB27678.1|  hypothetical protein B456_005G004200                    109   1e-23   Gossypium raimondii
ref|XP_010109661.1|  hypothetical protein L484_006096                   110   2e-23   Morus notabilis
ref|XP_004305082.1|  PREDICTED: pentatricopeptide repeat-containi...    107   1e-22   Fragaria vesca subsp. vesca
ref|XP_008245346.1|  PREDICTED: pentatricopeptide repeat-containi...    106   2e-22   Prunus mume [ume]
ref|XP_008782664.1|  PREDICTED: pentatricopeptide repeat-containi...    105   6e-22   Phoenix dactylifera
ref|XP_007206949.1|  hypothetical protein PRUPE_ppb018157mg             100   7e-21   
ref|XP_010921153.1|  PREDICTED: pentatricopeptide repeat-containi...    102   8e-21   Elaeis guineensis
gb|ERN04164.1|  hypothetical protein AMTR_s00077p00087500             99.0    2e-20   Amborella trichopoda
ref|XP_009406874.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006481194.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    3e-20   
ref|XP_006429582.1|  hypothetical protein CICLE_v10013314mg           99.0    4e-20   
ref|XP_010253075.1|  PREDICTED: pentatricopeptide repeat-containi...    100   5e-20   
gb|KDO64095.1|  hypothetical protein CISIN_1g011714mg                 99.0    6e-20   Citrus sinensis [apfelsine]
ref|XP_006842489.2|  PREDICTED: pentatricopeptide repeat-containi...  99.0    8e-20   Amborella trichopoda
ref|XP_010683486.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    1e-19   
gb|KCW88349.1|  hypothetical protein EUGRSUZ_A00738                   97.1    2e-19   Eucalyptus grandis [rose gum]
ref|XP_003623623.1|  Pentatricopeptide repeat-containing protein      97.1    5e-19   
ref|XP_010043220.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    6e-19   
ref|XP_004492557.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  89.4    2e-16   
gb|ABR16388.1|  unknown                                               85.9    2e-15   Picea sitchensis
gb|EMT30207.1|  hypothetical protein F775_08031                       85.1    4e-15   
ref|XP_003557966.1|  PREDICTED: pentatricopeptide repeat-containi...  81.3    7e-14   Brachypodium distachyon [annual false brome]
gb|ACG44675.1|  hypothetical protein                                  80.9    1e-13   Zea mays [maize]
ref|NP_001130560.1|  uncharacterized protein LOC100191659             80.9    1e-13   
ref|XP_004984461.1|  PREDICTED: protein Rf1, mitochondrial-like       80.1    2e-13   Setaria italica
ref|NP_001050037.1|  Os03g0336000                                     77.4    1e-12   
gb|EAZ26836.1|  hypothetical protein OsJ_10752                        75.5    6e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KFK35778.1|  hypothetical protein AALP_AA4G035000                  71.2    1e-10   Arabis alpina [alpine rockcress]
ref|NP_001060800.1|  Os08g0107700                                     70.1    2e-10   
dbj|BAD09393.1|  putative PPR protein                                 70.5    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010248027.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    5e-10   Nelumbo nucifera [Indian lotus]
dbj|BAD13709.1|  PPR protein                                          67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010530432.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_010530346.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    1e-09   Tarenaya hassleriana [spider flower]
gb|ABG66168.1|  Rf1 protein, mitochondrial precursor, putative, e...  67.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD08212.1|  hypothetical protein                                 67.4    3e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAD13711.1|  PPR protein                                          67.4    3e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001064958.1|  Os10g0497300                                     67.4    3e-09   
dbj|BAD08211.1|  hypothetical protein                                 67.4    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009604022.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    4e-09   
dbj|BAD20284.1|  hypothetical protein                                 67.0    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_003623872.1|  Pentatricopeptide repeat-containing protein      66.6    5e-09   
ref|XP_010315244.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    5e-09   
dbj|BAD08213.1|  hypothetical protein                                 67.0    5e-09   Oryza sativa Indica Group [Indian rice]
gb|ABC42331.1|  PPR protein                                           66.2    6e-09   Oryza sativa Indica Group [Indian rice]
gb|AAL58263.1|AC068923_5  putative membrane-associated protein        66.6    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AES60450.2|  pentatricopeptide (PPR) repeat protein                65.9    8e-09   Medicago truncatula
gb|EEE51212.1|  hypothetical protein OsJ_32033                        66.2    9e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ACL53100.1|  unknown                                               65.9    9e-09   Zea mays [maize]
ref|NP_001064975.1|  Os10g0499500                                     65.9    9e-09   
gb|AIC74549.1|  truncated PPR protein PPR9-409-Z                      65.5    1e-08   Oryza sativa Indica Group [Indian rice]
dbj|BAD08216.1|  hypothetical protein                                 65.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003590199.1|  Pentatricopeptide repeat-containing protein      65.9    1e-08   
ref|XP_006346446.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    1e-08   Solanum tuberosum [potatoes]
sp|Q76C99.1|RF1_ORYSI  RecName: Full=Protein Rf1, mitochondrial; ...  65.5    1e-08   Oryza sativa Indica Group [Indian rice]
gb|ABC42330.1|  PPR protein                                           65.5    1e-08   Oryza sativa Indica Group [Indian rice]
gb|EAZ16561.1|  hypothetical protein OsJ_32034                        65.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AAL58260.1|AC068923_2  putative membrane-associated protein        65.1    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EPS61251.1|  hypothetical protein M569_13548                       65.1    2e-08   Genlisea aurea
gb|ACL53015.1|  unknown                                               65.1    2e-08   Zea mays [maize]
ref|XP_006651349.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-08   Oryza brachyantha
gb|KHN04861.1|  Pentatricopeptide repeat-containing protein, mito...  65.1    2e-08   Glycine soja [wild soybean]
ref|XP_002467904.1|  hypothetical protein SORBIDRAFT_01g036150        65.1    2e-08   Sorghum bicolor [broomcorn]
ref|XP_006572968.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    2e-08   
ref|XP_002512435.1|  pentatricopeptide repeat-containing protein,...  65.1    2e-08   
gb|AIC74551.1|  PPR protein PPR9-782-M                                65.1    2e-08   Oryza sativa Indica Group [Indian rice]
gb|AIC74550.1|  PPR protein PPR9-782-I                                65.1    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010458712.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-08   Camelina sativa [gold-of-pleasure]
gb|AES79447.2|  TCP-1/cpn60 chaperonin family protein                 65.1    2e-08   Medicago truncatula
ref|XP_010458689.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003623229.1|  Pentatricopeptide repeat-containing protein      64.7    2e-08   
ref|NP_001064949.1|  Os10g0495200                                     64.7    2e-08   
emb|CDP12725.1|  unnamed protein product                              64.7    3e-08   Coffea canephora [robusta coffee]
ref|XP_003620179.1|  Pentatricopeptide repeat-containing protein      64.3    3e-08   
ref|XP_011468486.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    3e-08   Fragaria vesca subsp. vesca
ref|XP_011009113.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    4e-08   Populus euphratica
ref|XP_007139919.1|  hypothetical protein PHAVU_008G069700g           63.9    4e-08   Phaseolus vulgaris [French bean]
gb|EEE68328.1|  hypothetical protein OsJ_26607                        63.9    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061364.1|  Os08g0248400                                     63.9    4e-08   
gb|KGN60996.1|  hypothetical protein Csa_2G034490                     61.2    4e-08   
ref|XP_001777347.1|  predicted protein                                63.9    5e-08   
ref|XP_010476252.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003527866.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    5e-08   Glycine max [soybeans]
gb|KHN09027.1|  Pentatricopeptide repeat-containing protein           63.5    5e-08   Glycine soja [wild soybean]
ref|XP_002967156.1|  hypothetical protein SELMODRAFT_144844           63.5    5e-08   
ref|XP_009802358.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    7e-08   Nicotiana sylvestris
gb|KJB45449.1|  hypothetical protein B456_007G306300                  63.2    7e-08   Gossypium raimondii
ref|XP_010530459.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    8e-08   
gb|AIC74547.1|  PPR protein PPR7-458-ZH                               63.2    8e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMT29222.1|  hypothetical protein F775_16585                       63.2    8e-08   
ref|XP_007141297.1|  hypothetical protein PHAVU_008G184000g           63.2    8e-08   Phaseolus vulgaris [French bean]
ref|NP_001176222.1|  Os10g0495400                                     62.8    8e-08   
ref|XP_010431726.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    9e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002960858.1|  hypothetical protein SELMODRAFT_75631            63.2    9e-08   
gb|AAM92824.1|  putative chloroplast RNA processing protein           63.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004296143.1|  PREDICTED: putative pentatricopeptide repeat...  61.6    1e-07   Fragaria vesca subsp. vesca
ref|XP_008809556.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-07   Phoenix dactylifera
ref|XP_009596549.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    1e-07   Nicotiana tomentosiformis
dbj|BAQ15370.1|  pentatricopeptide repeat-containing protein          62.8    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010475835.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002871729.1|  pentatricopeptide repeat-containing protein      62.4    1e-07   
gb|KFK30719.1|  hypothetical protein AALP_AA6G018600                  62.4    1e-07   Arabis alpina [alpine rockcress]
ref|XP_009117967.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  62.4    1e-07   
ref|XP_004492691.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    1e-07   Cicer arietinum [garbanzo]
gb|KHN08231.1|  Pentatricopeptide repeat-containing protein           62.0    1e-07   Glycine soja [wild soybean]
gb|EYU42661.1|  hypothetical protein MIMGU_mgv1a020055mg              62.4    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_004515689.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-07   Cicer arietinum [garbanzo]
ref|XP_007023868.1|  Pentatricopeptide repeat (PPR) superfamily p...  62.0    2e-07   
gb|AAM92820.1|  hypothetical protein                                  62.0    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011014424.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-07   Populus euphratica
ref|XP_003523769.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    2e-07   Glycine max [soybeans]
ref|XP_003630734.1|  Pentatricopeptide repeat-containing protein      62.0    2e-07   Medicago truncatula
ref|XP_007137661.1|  hypothetical protein PHAVU_009G145100g           62.0    2e-07   Phaseolus vulgaris [French bean]
gb|KCW88273.1|  hypothetical protein EUGRSUZ_A00652                   62.0    2e-07   Eucalyptus grandis [rose gum]
ref|XP_008806452.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   
ref|XP_006662452.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   
ref|XP_010417523.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010472747.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010429780.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011003803.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    2e-07   Populus euphratica
ref|XP_009419261.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008378619.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   
ref|XP_004492420.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    2e-07   
gb|AIC74548.1|  PPR protein PPR8-780-M                                62.0    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010530347.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-07   
ref|XP_012064995.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    2e-07   Jatropha curcas
ref|XP_010921699.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    2e-07   Elaeis guineensis
gb|KEH26904.1|  pentatricopeptide (PPR) repeat protein                61.2    3e-07   Medicago truncatula
ref|XP_010040584.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-07   Eucalyptus grandis [rose gum]
ref|XP_012085339.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-07   Jatropha curcas
ref|XP_002889775.1|  pentatricopeptide repeat-containing protein      61.6    3e-07   Arabidopsis lyrata subsp. lyrata
gb|EYU21622.1|  hypothetical protein MIMGU_mgv1a019624mg              61.6    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_006828862.2|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-07   
gb|ERM96278.1|  hypothetical protein AMTR_s00001p00165480             61.6    3e-07   Amborella trichopoda
ref|XP_010424275.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    3e-07   
ref|XP_006465352.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    3e-07   Citrus sinensis [apfelsine]
ref|XP_010936288.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  61.2    3e-07   
ref|XP_009613976.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-07   
ref|XP_010524658.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    3e-07   Tarenaya hassleriana [spider flower]
gb|AIC74546.1|  PPR protein PPR7-458-Z                                61.2    3e-07   Oryza sativa Indica Group [Indian rice]
gb|AES89466.2|  PPR containing plant-like protein                     61.6    3e-07   Medicago truncatula
gb|ERN18787.1|  hypothetical protein AMTR_s00067p00076830             61.2    3e-07   Amborella trichopoda
ref|XP_003619805.1|  Pentatricopeptide repeat-containing protein      61.2    3e-07   Medicago truncatula
ref|XP_002515077.1|  pentatricopeptide repeat-containing protein,...  60.1    3e-07   
ref|XP_009362528.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    4e-07   
ref|XP_010428258.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003607269.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...  61.2    4e-07   
gb|KEH26866.1|  pentatricopeptide (PPR) repeat protein                60.8    4e-07   Medicago truncatula
ref|XP_012080261.1|  PREDICTED: putative pentatricopeptide repeat...  61.2    4e-07   
ref|XP_008243715.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-07   Prunus mume [ume]
ref|XP_010908081.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-07   
ref|XP_003558747.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-07   Brachypodium distachyon [annual false brome]
ref|XP_008243718.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    4e-07   Prunus mume [ume]
ref|XP_002967974.1|  hypothetical protein SELMODRAFT_88078            60.5    5e-07   
ref|XP_002298371.2|  hypothetical protein POPTR_0001s24340g           60.8    5e-07   
ref|XP_011099967.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-07   Sesamum indicum [beniseed]
ref|XP_009366374.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-07   
ref|XP_008792873.1|  PREDICTED: uncharacterized protein LOC103709351  61.2    5e-07   
ref|XP_002531694.1|  pentatricopeptide repeat-containing protein,...  60.8    5e-07   
ref|XP_006857320.2|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-07   
ref|XP_010092441.1|  hypothetical protein L484_019198                 60.8    5e-07   
ref|XP_006826435.2|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-07   
ref|XP_008338987.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    5e-07   
gb|EYU40636.1|  hypothetical protein MIMGU_mgv1a021322mg              60.8    5e-07   Erythranthe guttata [common monkey flower]
gb|AIC74544.1|  PPR protein PPR7-454-M                                60.5    5e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_007131603.1|  hypothetical protein PHAVU_011G027200g           60.8    5e-07   Phaseolus vulgaris [French bean]
ref|XP_002963945.1|  hypothetical protein SELMODRAFT_82351            60.5    5e-07   
ref|XP_010654769.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-07   Vitis vinifera
ref|XP_009618145.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-07   Nicotiana tomentosiformis
emb|CBI36294.3|  unnamed protein product                              60.5    6e-07   Vitis vinifera
gb|AIC74545.1|  PPR protein PPR7-458-I                                60.5    6e-07   Oryza sativa Indica Group [Indian rice]
gb|KDO45230.1|  hypothetical protein CISIN_1g018782mg                 60.1    6e-07   Citrus sinensis [apfelsine]
ref|XP_002313262.2|  hypothetical protein POPTR_0009s07380g           60.5    6e-07   
ref|XP_009381144.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    6e-07   
ref|XP_003551657.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-07   Glycine max [soybeans]
ref|XP_010530461.1|  PREDICTED: putative pentatricopeptide repeat...  60.5    6e-07   Tarenaya hassleriana [spider flower]
ref|NP_172461.1|  pentatricopeptide repeat-containing protein         60.5    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472193.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-07   Citrus sinensis [apfelsine]
gb|KCW90149.1|  hypothetical protein EUGRSUZ_A02340                   60.5    6e-07   Eucalyptus grandis [rose gum]
ref|XP_009801387.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-07   Nicotiana sylvestris
ref|XP_004144813.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    6e-07   Cucumis sativus [cucumbers]
gb|ERM93672.1|  hypothetical protein AMTR_s00004p00168920             60.5    6e-07   Amborella trichopoda
ref|XP_006433532.1|  hypothetical protein CICLE_v10003346mg           60.5    6e-07   
ref|XP_008360647.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.1    7e-07   
ref|XP_006427239.1|  hypothetical protein CICLE_v100269871mg          60.1    7e-07   
ref|XP_010530356.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    7e-07   
gb|KEH26900.1|  pentatricopeptide (PPR) repeat protein                60.1    7e-07   Medicago truncatula
ref|XP_011004426.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    7e-07   Populus euphratica
ref|XP_004505699.1|  PREDICTED: putative pentatricopeptide repeat...  60.5    8e-07   Cicer arietinum [garbanzo]
ref|XP_010492577.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006592041.1|  PREDICTED: putative pentatricopeptide repeat...  60.5    8e-07   Glycine max [soybeans]
ref|XP_010024947.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-07   Eucalyptus grandis [rose gum]
gb|KDO66019.1|  hypothetical protein CISIN_1g048778mg                 60.5    8e-07   Citrus sinensis [apfelsine]
ref|XP_006443536.1|  hypothetical protein CICLE_v10018778mg           60.5    8e-07   Citrus clementina [clementine]
ref|XP_010492576.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010544054.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-07   Tarenaya hassleriana [spider flower]
gb|KDO49128.1|  hypothetical protein CISIN_1g004231mg                 60.1    8e-07   Citrus sinensis [apfelsine]
ref|XP_006423060.1|  hypothetical protein CICLE_v10028118mg           60.1    8e-07   
ref|XP_009618149.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-07   Nicotiana tomentosiformis
ref|XP_006480134.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    8e-07   Citrus sinensis [apfelsine]
gb|KHN05463.1|  Putative pentatricopeptide repeat-containing protein  60.5    8e-07   Glycine soja [wild soybean]
gb|EPS74565.1|  hypothetical protein M569_00187                       60.1    8e-07   Genlisea aurea
gb|AJG06104.1|  restorer-of-fertility                                 60.1    8e-07   Raphanus sativus
gb|KFK43289.1|  hypothetical protein AALP_AA1G104700                  60.1    9e-07   Arabis alpina [alpine rockcress]
ref|XP_010540327.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-07   Tarenaya hassleriana [spider flower]
ref|XP_010494656.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010530350.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    9e-07   
ref|XP_007215907.1|  hypothetical protein PRUPE_ppa004160mg           59.7    9e-07   Prunus persica
ref|XP_008805876.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    9e-07   
gb|KDP44205.1|  hypothetical protein JCGZ_05672                       60.1    9e-07   Jatropha curcas
ref|XP_004152353.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Cucumis sativus [cucumbers]
dbj|BAR42903.1|  RFL6                                                 57.4    1e-06   Rapistrum rugosum [wild turnip]
gb|EYU28385.1|  hypothetical protein MIMGU_mgv1a003336mg              59.7    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_002305285.2|  pentatricopeptide repeat-containing family p...  59.7    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010107145.1|  hypothetical protein L484_019627                 59.7    1e-06   Morus notabilis
ref|XP_004512803.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Cicer arietinum [garbanzo]
ref|XP_006417237.1|  hypothetical protein EUTSA_v10007258mg           59.7    1e-06   
gb|KDP23717.1|  hypothetical protein JCGZ_23550                       59.7    1e-06   Jatropha curcas
ref|XP_004512700.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Cicer arietinum [garbanzo]
ref|NP_001136745.1|  hypothetical protein                             59.7    1e-06   
ref|XP_012089335.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   
ref|XP_009767090.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Nicotiana sylvestris
gb|KHN39972.1|  Pentatricopeptide repeat-containing protein           59.7    1e-06   Glycine soja [wild soybean]
ref|XP_010453827.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_012089334.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Jatropha curcas
gb|EEC67240.1|  hypothetical protein OsI_34171                        59.3    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_011627875.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  59.7    1e-06   Amborella trichopoda
gb|KJB49640.1|  hypothetical protein B456_008G131000                  59.3    1e-06   Gossypium raimondii
ref|XP_010490447.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Camelina sativa [gold-of-pleasure]
gb|KHN32303.1|  Putative pentatricopeptide repeat-containing protein  59.7    1e-06   Glycine soja [wild soybean]
ref|XP_011038920.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Populus euphratica
ref|XP_003620148.1|  Pentatricopeptide repeat-containing protein      59.3    1e-06   Medicago truncatula
ref|XP_009118082.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-06   
emb|CDP10983.1|  unnamed protein product                              59.7    1e-06   Coffea canephora [robusta coffee]
gb|ADE76539.1|  unknown                                               59.3    1e-06   Picea sitchensis
ref|XP_011036957.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    1e-06   Populus euphratica
ref|XP_010462107.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-06   Camelina sativa [gold-of-pleasure]
gb|ABN08713.1|  Pentatricopeptide repeat                              59.3    1e-06   Medicago truncatula
ref|XP_008367381.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  59.3    1e-06   
ref|XP_009400405.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010689086.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-06   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY65904.1|  BnaA06g01860D                                        59.3    1e-06   Brassica napus [oilseed rape]
ref|XP_011091469.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-06   
ref|XP_002962532.1|  hypothetical protein SELMODRAFT_404389           59.7    1e-06   
gb|KJB50891.1|  hypothetical protein B456_008G192600                  59.3    1e-06   Gossypium raimondii
ref|XP_007157301.1|  hypothetical protein PHAVU_002G058500g           59.3    1e-06   Phaseolus vulgaris [French bean]
ref|XP_009147672.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-06   Brassica rapa
ref|XP_007037323.1|  Pentatricopeptide repeat (PPR) superfamily p...  59.3    1e-06   
ref|XP_010270410.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_009118081.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Brassica rapa
ref|XP_010530355.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_011090619.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    2e-06   Sesamum indicum [beniseed]
ref|XP_008235421.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Prunus mume [ume]
ref|XP_009767096.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Nicotiana sylvestris
ref|XP_004288876.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Fragaria vesca subsp. vesca
ref|XP_009767095.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Nicotiana sylvestris
ref|XP_007139019.1|  hypothetical protein PHAVU_009G258200g           58.9    2e-06   Phaseolus vulgaris [French bean]
ref|XP_010673763.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE67913.1|  hypothetical protein OsJ_25766                        59.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002872129.1|  predicted protein                                59.3    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010500873.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   Camelina sativa [gold-of-pleasure]
gb|EPS71710.1|  hypothetical protein M569_03047                       58.9    2e-06   Genlisea aurea
gb|KFK25884.1|  hypothetical protein AALP_AA8G174800                  58.9    2e-06   Arabis alpina [alpine rockcress]
ref|XP_004490467.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   
ref|XP_010479776.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
gb|ERM97665.1|  hypothetical protein AMTR_s00130p00090930             59.3    2e-06   
ref|NP_175673.1|  pentatricopeptide repeat-containing protein         58.9    2e-06   
ref|XP_010520854.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   
ref|XP_010530351.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    2e-06   
gb|KEH26908.1|  pentatricopeptide (PPR) repeat protein                58.9    2e-06   
ref|XP_011000284.1|  PREDICTED: putative pentatricopeptide repeat...  59.3    2e-06   
gb|KFK25885.1|  hypothetical protein AALP_AA8G174800                  58.9    2e-06   
dbj|BAD09394.1|  putative PPR protein                                 58.9    2e-06   
ref|XP_006389923.1|  hypothetical protein EUTSA_v10018334mg           58.9    2e-06   
ref|XP_006596392.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
ref|XP_004514199.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    2e-06   
ref|XP_004138384.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
ref|XP_003626608.1|  Pentatricopeptide repeat-containing protein      58.9    2e-06   
ref|XP_002462039.1|  hypothetical protein SORBIDRAFT_02g013138        59.3    2e-06   
ref|XP_004292451.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
ref|XP_006850819.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
gb|EMT20833.1|  Putative pentatricopeptide repeat-containing protein  58.9    2e-06   
ref|XP_003619751.1|  Pentatricopeptide repeat-containing protein      58.9    2e-06   
gb|EMT09091.1|  hypothetical protein F775_12904                       58.9    2e-06   
tpg|DAA53112.1|  TPA: hypothetical protein ZEAMMB73_920038            58.9    2e-06   
gb|KEH15755.1|  pentatricopeptide (PPR) repeat protein                58.2    2e-06   
ref|XP_004983977.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
ref|XP_011078791.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
ref|XP_006590792.1|  PREDICTED: putative pentatricopeptide repeat...  58.9    2e-06   
ref|XP_006389305.1|  hypothetical protein POPTR_0030s00250g           58.9    2e-06   
ref|XP_008357006.1|  PREDICTED: pentatricopeptide repeat-containi...  58.9    2e-06   
ref|NP_177597.1|  pentatricopeptide repeat-containing protein         58.9    2e-06   
ref|XP_010917143.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    2e-06   
gb|EYU41700.1|  hypothetical protein MIMGU_mgv1a001713mg              58.9    2e-06   
emb|CDX87409.1|  BnaA07g34640D                                        58.5    3e-06   
ref|XP_002518803.1|  pentatricopeptide repeat-containing protein,...  58.9    3e-06   
ref|XP_006382397.1|  hypothetical protein POPTR_0005s01750g           58.5    3e-06   
gb|EMS58658.1|  Protein Rf1, mitochondrial                            58.5    3e-06   
ref|XP_006836883.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-06   
ref|XP_011000283.1|  PREDICTED: putative pentatricopeptide repeat...  58.5    3e-06   
ref|XP_006384843.1|  hypothetical protein POPTR_0004s21560g           58.5    3e-06   
ref|XP_006420675.1|  hypothetical protein CICLE_v10004591mg           58.5    3e-06   
ref|XP_007199147.1|  hypothetical protein PRUPE_ppa019612mg           58.5    3e-06   
ref|XP_004236781.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-06   
ref|XP_006380898.1|  hypothetical protein POPTR_0006s01700g           58.5    3e-06   
ref|NP_197167.1|  pentatricopeptide repeat-containing protein         58.5    3e-06   
ref|XP_009372209.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-06   
ref|XP_008444287.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-06   
ref|XP_010691160.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_003533421.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-06   
gb|KDO81684.1|  hypothetical protein CISIN_1g047648mg                 58.2    3e-06   
ref|XP_002985064.1|  hypothetical protein SELMODRAFT_424099           58.5    3e-06   
ref|XP_008444958.1|  PREDICTED: pentatricopeptide repeat-containi...  58.5    3e-06   
ref|XP_011653982.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_011649703.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_006361415.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_010530458.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
gb|AAL59047.1|AC087182_30  putative membrane-associated salt-indu...  58.2    3e-06   
ref|XP_002969716.1|  hypothetical protein SELMODRAFT_92207            58.2    3e-06   
ref|XP_002981321.1|  hypothetical protein SELMODRAFT_114398           58.2    3e-06   
ref|XP_009106628.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_010458708.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_011004498.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_010650040.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    3e-06   
ref|XP_003620127.1|  Pentatricopeptide repeat-containing protein      57.8    4e-06   
ref|XP_007051427.1|  Pentatricopeptide repeat-containing protein,...  58.2    4e-06   
ref|NP_001064888.1|  Os10g0484300                                     58.2    4e-06   
ref|XP_010458709.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    4e-06   
gb|KEH26918.1|  pentatricopeptide (PPR) repeat protein                58.2    4e-06   
ref|XP_002464340.1|  hypothetical protein SORBIDRAFT_01g016560        58.2    4e-06   
gb|EAY82302.1|  hypothetical protein OsI_37513                        58.2    4e-06   
ref|XP_006845595.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    4e-06   
gb|KEH31931.1|  PPR containing plant-like protein                     58.2    4e-06   
gb|EPS72780.1|  hypothetical protein M569_01977                       58.2    4e-06   
ref|XP_007049305.1|  Pentatricopeptide repeat-containing protein,...  58.2    4e-06   
ref|XP_010659874.1|  PREDICTED: putative pentatricopeptide repeat...  58.2    4e-06   
ref|XP_006491485.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    4e-06   
ref|XP_007031149.1|  Pentatricopeptide repeat (PPR-like) superfam...  57.8    4e-06   
ref|XP_010420363.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-06   
dbj|BAR42871.1|  RFL4                                                 55.5    4e-06   
ref|XP_002986246.1|  hypothetical protein SELMODRAFT_123660           58.2    4e-06   
ref|XP_008445101.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    4e-06   
ref|XP_006287556.1|  hypothetical protein CARUB_v10000768mg           57.8    4e-06   
ref|XP_011018741.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    4e-06   
ref|XP_010464347.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    4e-06   
ref|XP_002962761.1|  hypothetical protein SELMODRAFT_165305           58.2    4e-06   
ref|XP_008454493.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    4e-06   
ref|XP_006846078.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    4e-06   
ref|XP_007049304.1|  Pentatricopeptide repeat-containing protein,...  58.2    4e-06   
ref|XP_002887547.1|  pentatricopeptide repeat-containing protein      57.8    5e-06   
ref|XP_004489202.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_006658491.1|  PREDICTED: pentatricopeptide repeat-containi...  58.2    5e-06   
ref|XP_010934489.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_009112927.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_008453581.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
emb|CBI26377.3|  unnamed protein product                              57.8    5e-06   
ref|XP_010494565.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_003620129.1|  Pentatricopeptide repeat-containing protein      57.8    5e-06   
ref|XP_003620319.1|  Pentatricopeptide repeat-containing protein      57.8    5e-06   
ref|XP_010486276.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_008219211.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_009781730.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    5e-06   
ref|XP_009595961.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
gb|KJB09314.1|  hypothetical protein B456_001G134400                  57.8    5e-06   
gb|AES76347.2|  pentatricopeptide (PPR) repeat protein                57.8    5e-06   
ref|XP_009348775.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    5e-06   
gb|KEH26914.1|  pentatricopeptide (PPR) repeat protein                57.4    5e-06   
ref|XP_009365209.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_008445100.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    5e-06   
ref|XP_006847909.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    6e-06   
ref|XP_004496165.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-06   
ref|NP_187385.1|  pentatricopeptide repeat-containing protein         57.8    6e-06   
ref|XP_010464348.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    6e-06   
ref|XP_009589444.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-06   
gb|KEH26907.1|  pentatricopeptide (PPR) repeat protein                57.4    6e-06   
gb|ERN18052.1|  hypothetical protein AMTR_s00046p00202770             57.4    6e-06   
emb|CDY40142.1|  BnaC06g05470D                                        57.4    6e-06   
ref|XP_006287361.1|  hypothetical protein CARUB_v10000559mg           57.4    6e-06   
emb|CDX88504.1|  BnaC06g39480D                                        57.4    6e-06   
ref|XP_007031148.1|  Pentatricopeptide repeat (PPR-like) superfam...  57.4    6e-06   
ref|XP_008233059.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-06   
ref|XP_002285611.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-06   
ref|XP_009402131.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-06   
ref|XP_003600422.1|  Pentatricopeptide repeat-containing protein      57.4    6e-06   
ref|XP_010106002.1|  hypothetical protein L484_001609                 57.4    6e-06   
ref|XP_002530894.1|  pentatricopeptide repeat-containing protein,...  57.4    6e-06   
emb|CAN61988.1|  hypothetical protein VITISV_026694                   57.4    6e-06   
ref|XP_010108224.1|  hypothetical protein L484_005698                 57.4    6e-06   
ref|XP_010661498.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  57.8    6e-06   
ref|XP_007142404.1|  hypothetical protein PHAVU_008G277600g           57.8    6e-06   
gb|KJB22791.1|  hypothetical protein B456_004G065800                  57.4    6e-06   
ref|XP_006363010.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    6e-06   
gb|KFK42287.1|  hypothetical protein AALP_AA2G236000                  57.4    6e-06   
ref|XP_010099594.1|  hypothetical protein L484_004026                 57.4    6e-06   
gb|KHN16401.1|  Pentatricopeptide repeat-containing protein, mito...  57.4    6e-06   
ref|XP_007219416.1|  hypothetical protein PRUPE_ppa021922mg           57.4    6e-06   
ref|XP_006298951.1|  hypothetical protein CARUB_v10015076mg           57.4    7e-06   
gb|AFK48607.1|  unknown                                               57.4    7e-06   
ref|XP_010671063.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
gb|KHN38886.1|  Pentatricopeptide repeat-containing protein           57.4    7e-06   
ref|XP_002275680.2|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_011076945.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_010436574.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_007018302.1|  Pentatricopeptide repeat (PPR-like) superfam...  57.4    7e-06   
ref|XP_003620177.1|  Pentatricopeptide repeat-containing protein      57.4    7e-06   
ref|XP_002971208.1|  hypothetical protein SELMODRAFT_94745            57.4    7e-06   
gb|KEH17004.1|  pentatricopeptide (PPR) repeat protein                57.4    7e-06   
ref|XP_006842237.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_010422124.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
gb|KEH16141.1|  pentatricopeptide (PPR) repeat protein                57.4    7e-06   
ref|XP_004492340.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_006378827.1|  hypothetical protein POPTR_0010s24920g           57.0    7e-06   
ref|XP_006486600.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_010470870.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_012088880.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    7e-06   
ref|XP_009802081.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    7e-06   
gb|EMT25747.1|  hypothetical protein F775_02713                       57.4    7e-06   
emb|CBI24780.3|  unnamed protein product                              57.4    7e-06   
ref|XP_002521858.1|  pentatricopeptide repeat-containing protein,...  57.0    8e-06   
ref|XP_010650766.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    8e-06   
emb|CAN83683.1|  hypothetical protein VITISV_017537                   57.4    8e-06   
ref|XP_010493846.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    8e-06   
emb|CAN80799.1|  hypothetical protein VITISV_019809                   57.4    8e-06   
ref|XP_003576808.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    8e-06   
ref|XP_003637828.1|  Pentatricopeptide repeat-containing protein      57.0    8e-06   
gb|AES76395.2|  pentatricopeptide (PPR) repeat protein                57.0    8e-06   
ref|XP_008351720.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    8e-06   
ref|NP_188886.1|  pentatricopeptide repeat-containing protein         57.0    8e-06   
gb|KJB64079.1|  hypothetical protein B456_010G032500                  57.0    8e-06   
emb|CDX94933.1|  BnaC05g07380D                                        57.0    8e-06   
ref|XP_010645293.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    8e-06   
ref|XP_006405387.1|  hypothetical protein EUTSA_v10028208mg           57.0    8e-06   
ref|XP_002452757.1|  hypothetical protein SORBIDRAFT_04g031880        57.0    8e-06   
emb|CDP12316.1|  unnamed protein product                              57.0    8e-06   
ref|XP_009767473.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
ref|XP_004246847.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
ref|XP_006444724.1|  hypothetical protein CICLE_v10023955mg           56.6    9e-06   
gb|KJB64077.1|  hypothetical protein B456_010G032500                  57.0    9e-06   
gb|KDO86622.1|  hypothetical protein CISIN_1g012126mg                 57.0    9e-06   
dbj|BAB01462.1|  unnamed protein product                              57.0    9e-06   
gb|ABF99334.1|  expressed protein                                     57.0    9e-06   
ref|NP_001051548.2|  Os03g0795400                                     57.0    9e-06   
dbj|BAR42883.1|  RFL5                                                 54.7    9e-06   
ref|XP_010904671.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
ref|XP_008809744.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
ref|XP_004497786.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
ref|XP_008382589.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
emb|CDO98642.1|  unnamed protein product                              56.6    9e-06   
gb|AAT76414.1|  putative PPR repeat containing protein                57.0    9e-06   
gb|KEH17452.1|  pentatricopeptide (PPR) repeat protein                57.0    9e-06   
ref|XP_002320901.2|  hypothetical protein POPTR_0014s10150g           56.6    9e-06   
ref|XP_006300886.1|  hypothetical protein CARUB_v10019976mg           57.0    9e-06   
ref|XP_010454809.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
ref|XP_010547211.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    9e-06   
gb|KJB39444.1|  hypothetical protein B456_007G014100                  57.0    9e-06   
gb|KJB61396.1|  hypothetical protein B456_009G354800                  57.0    9e-06   
emb|CBI35592.3|  unnamed protein product                              57.0    9e-06   
ref|XP_008454928.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.0    1e-05   
ref|XP_004504486.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-05   
ref|XP_009612668.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
ref|XP_006445470.1|  hypothetical protein CICLE_v10018805mg           57.0    1e-05   
ref|XP_010462657.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
ref|XP_010430495.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-05   
ref|XP_008463091.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
ref|XP_010323884.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-05   
ref|XP_010548990.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-05   
ref|XP_010645291.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-05   
ref|XP_004489566.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
ref|NP_001183938.1|  PPR-814a                                         57.0    1e-05   
ref|XP_006464385.1|  PREDICTED: pentatricopeptide repeat-containi...  57.0    1e-05   
ref|XP_007208650.1|  hypothetical protein PRUPE_ppa020258mg           56.6    1e-05   
ref|XP_006656649.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  57.0    1e-05   
gb|KHG04533.1|  hypothetical protein F383_29163                       57.0    1e-05   
ref|XP_006470947.1|  PREDICTED: putative pentatricopeptide repeat...  57.0    1e-05   
gb|ERM99735.1|  hypothetical protein AMTR_s00099p00108370             56.2    1e-05   
ref|XP_002535907.1|  pentatricopeptide repeat-containing protein,...  54.3    1e-05   
gb|EYU19809.1|  hypothetical protein MIMGU_mgv1a005320mg              56.6    1e-05   
ref|XP_010104578.1|  hypothetical protein L484_025557                 56.6    1e-05   
ref|XP_010462662.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
ref|XP_006836882.2|  PREDICTED: pentatricopeptide repeat-containi...  56.2    1e-05   
ref|XP_008659282.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
gb|KEH25393.1|  PPR containing plant-like protein                     56.6    1e-05   
ref|XP_006848380.1|  PREDICTED: pentatricopeptide repeat-containi...  56.6    1e-05   
emb|CBI35192.3|  unnamed protein product                              57.0    1e-05   
emb|CDP00950.1|  unnamed protein product                              56.6    1e-05   



>ref|XP_009765667.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like 
[Nicotiana sylvestris]
Length=512

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+DAY+VF+RM+ R++VV+   YELVIEA C+GKE+DKAL SL E+VRIGYSP  FTF 
Sbjct  359  LLKDAYQVFERMQSRRLVVDPVGYELVIEAFCSGKELDKALESLHEVVRIGYSPKAFTFS  418

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            NVIR LC +GKVD AL V  LM +  +      P+++LI ELN+QG+ L A  +Y  ALK
Sbjct  419  NVIRVLCLEGKVDKALLVFILMLKVGKSTSSV-PFSLLINELNQQGKPLTACYLYGVALK  477

Query  469  RGLLVPRKKP  440
             G +VPR KP
Sbjct  478  SG-VVPRNKP  486



>ref|XP_009608994.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=500

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 91/130 (70%), Gaps = 17/130 (13%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+DAY+VF+RMR R++VV+   YELVIEALC+GKE+DKAL SL E+VRIGYSP  FTF 
Sbjct  363  LLKDAYQVFERMRSRRLVVDPIGYELVIEALCSGKELDKALESLYEVVRIGYSPKAFTFS  422

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            NVIR LC +GKVD A                F P+++LI ELN+QG+ L A  +Y  ALK
Sbjct  423  NVIRVLCLEGKVDKA----------------FVPFSLLINELNQQGKPLTACYLYGVALK  466

Query  469  RGLLVPRKKP  440
             G +VPR KP
Sbjct  467  SG-VVPRNKP  475



>gb|EYU42022.1| hypothetical protein MIMGU_mgv1a018881mg, partial [Erythranthe 
guttata]
Length=441

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+D + VF+ MR+R   V   AY+LV+EALC+G+E++K    L EM+ IGYSP  FTF 
Sbjct  306  LLKDVHNVFEEMRQRNYTVCPDAYDLVVEALCSGREMEKGFEILNEMITIGYSPKTFTFN  365

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             VI++LC  G+VD AL++  LMH ++R   G  P+N LI +LNR+GR L+AR VYA ALK
Sbjct  366  IVIKSLCGIGEVDRALAIFKLMH-KNRDPRGI-PFNALINQLNRRGRLLEARFVYAVALK  423

Query  469  RGLLVPRKKPIQF  431
            RG +VP+ KP ++
Sbjct  424  RG-VVPKSKPSKY  435



>ref|XP_011095140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Sesamum indicum]
Length=488

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 4/141 (3%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+D   VF+ MR     +    ++LV+EA CNGKE ++A     EMV+IGYSP  FTF 
Sbjct  346  LLKDVSNVFEEMRNGNYTIYPGVFDLVVEAFCNGKETNRAFQIFNEMVKIGYSPKTFTFN  405

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             VI +LC  G+VD AL+VL LMH + R   G  P+NILI ELN+QGR+L+A  VY  ALK
Sbjct  406  IVIHSLCCVGEVDKALAVLMLMH-KDRKPSGI-PFNILIDELNQQGRSLEACRVYGVALK  463

Query  469  RGLLVPRKKPIQFSAKAQAPH  407
            RG +VP +KP  +    Q PH
Sbjct  464  RG-VVPTRKP-TYCLAEQRPH  482



>ref|XP_004246986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62670, 
mitochondrial-like [Solanum lycopersicum]
Length=461

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+DAY+VF +MR RK+VV+   YELVIEA C+G ++DKAL +L EM+RIGYSP  FTF 
Sbjct  323  LLQDAYQVFVKMRSRKLVVDPVGYELVIEAFCSGNKLDKALENLYEMIRIGYSPKAFTFS  382

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            N+IR LC +G+V+ AL V   M +  +      P+N+LI ELN++   L+A  +Y  ALK
Sbjct  383  NLIRVLCLEGEVEKALLVFVPMMKNGKSPSKV-PFNLLINELNQKEMILNACYLYGVALK  441

Query  469  RGLLVPRKKPI  437
             G +V R KP+
Sbjct  442  CG-VVTRNKPV  451



>ref|XP_007140083.1| hypothetical protein PHAVU_008G082800g [Phaseolus vulgaris]
 gb|ESW12077.1| hypothetical protein PHAVU_008G082800g [Phaseolus vulgaris]
Length=514

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 93/134 (69%), Gaps = 10/134 (7%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+DAY+VF++M+ER  VV+ R +E++++ALC G   D+A A+L EMV +GYSP   TF 
Sbjct  371  LLQDAYDVFEKMKERGSVVDQRTFEVMVQALCVGMRFDQAFAALNEMVGLGYSPEVVTFD  430

Query  649  NVIRALCADGKVDGALSVLSLMHRR----SRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             VI  LCA+G+VD A+S L L+H      SRF      Y++LIKELN++G+   A N++ 
Sbjct  431  KVILGLCAEGRVDDAVSTLVLLHASGGIPSRF-----SYDVLIKELNKEGKLFCACNLFG  485

Query  481  AALKRGLLVPRKKP  440
            AALK G +VP ++P
Sbjct  486  AALKLG-VVPNREP  498



>ref|XP_002323670.2| hypothetical protein POPTR_0016s14370g [Populus trichocarpa]
 gb|EEF05431.2| hypothetical protein POPTR_0016s14370g [Populus trichocarpa]
Length=424

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AYEVF++M++R  V+E   Y LVI+AL   K+VD A  +L +MVR+GY P   T  NVIR
Sbjct  299  AYEVFEKMKKRGFVIEQSTYALVIQALWVAKKVDDAFINLHQMVRLGYIPRLITINNVIR  358

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            ALC  GKVD A  VL LM+  S+       Y++LI ELNRQ R L A NVY AAL RG +
Sbjct  359  ALCVGGKVDKAFYVLVLMYENSKIPSRM-SYDLLIHELNRQERTLGACNVYGAALVRG-V  416

Query  457  VPRKKP  440
            VP KKP
Sbjct  417  VPHKKP  422



>gb|KDP21868.1| hypothetical protein JCGZ_00655 [Jatropha curcas]
Length=442

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DAY+VFD+M +R  V++H  Y LVI+A   GK+VD AL SL +M++ GY P   T  
Sbjct  306  LLEDAYQVFDKMTKRAFVMDHSTYNLVIQAFSMGKKVDDALVSLQKMIKFGYIPSLTTIN  365

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            +VIRA C  G+V+ A+ VL LM+   +       Y+++I+ELNRQ R L A NVY +AL 
Sbjct  366  SVIRAFCTKGRVEKAILVLVLMYETHKI-PNTTSYDLMIQELNRQRRFLGASNVYGSALV  424

Query  469  RGLLVPRKKPIQ  434
            RG +VP + P+ 
Sbjct  425  RG-VVPNQMPLH  435



>ref|XP_012091050.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g09680 [Jatropha curcas]
Length=494

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DAY+VFD+M +R  V++H  Y LVI+A   GK+VD AL SL +M++ GY P   T  
Sbjct  358  LLEDAYQVFDKMTKRAFVMDHSTYNLVIQAFSMGKKVDDALVSLQKMIKFGYIPSLTTIN  417

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            +VIRA C  G+V+ A+ VL LM+   +       Y+++I+ELNRQ R L A NVY +AL 
Sbjct  418  SVIRAFCTKGRVEKAILVLVLMYETHKI-PNTTSYDLMIQELNRQRRFLGASNVYGSALV  476

Query  469  RGLLVPRKKPIQ  434
            RG +VP + P+ 
Sbjct  477  RG-VVPNQMPLH  487



>gb|KHN29504.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=310

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 8/133 (6%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+ A EVF++M+ER +VV+   +E++++ALC GK  D+ALA+L EMVR+GYSP    F 
Sbjct  173  LLQGAGEVFEKMKERGLVVDQGTFEVIVQALCEGKRFDQALANLYEMVRLGYSPEVIAFD  232

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAA  479
             VI+ LC +G+VD A+S L L+H       G P    Y++LIKEL  +GR   A N++ A
Sbjct  233  KVIQGLCDEGRVDDAVSALVLLHANG----GVPNRVSYDVLIKELIEEGRLFCASNLFCA  288

Query  478  ALKRGLLVPRKKP  440
            A+K G +VP ++P
Sbjct  289  AVKLG-VVPNREP  300



>ref|XP_010653334.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Vitis vinifera]
Length=545

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 3/142 (2%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF-  659
            E +L++A+EVF++M      +    Y LVI+ LC  KEVDKAL  L EMV  GY P R  
Sbjct  403  EGLLKNAHEVFEKMINAGCAIYPNTYGLVIQTLCVAKEVDKALMYLNEMVGFGYFPPRMI  462

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAA  479
            TF +VIRALC++G+VD ALS+L LM    R       YN+LI E N+QGR L A  VY A
Sbjct  463  TFNSVIRALCSEGRVDEALSILVLMCEGRRIPSRI-CYNLLIDEFNQQGRWLSACTVYGA  521

Query  478  ALKRGLLVPRKKPIQFSAKAQA  413
            ALKRG ++P K+P + S++  A
Sbjct  522  ALKRG-VIPHKRPGKSSSRKNA  542



>ref|XP_008345572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Malus domestica]
 ref|XP_008355736.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Malus domestica]
Length=506

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DA++VF++M+     ++   Y L+I++LC GK++D++L SL  MVR G+SP   TF 
Sbjct  377  LLEDAHQVFEKMQSGHSGIDASTYGLMIQSLCMGKKMDESLVSLQXMVRTGHSPWIVTFN  436

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            NVI+ LC +GKV  AL VLS+M    R   G   YN +I+ELNRQG  L A +VY AALK
Sbjct  437  NVIQGLCVEGKVFEALLVLSIMFEGGR-ATGRVSYNPVIQELNRQGSFLGACSVYGAALK  495

Query  469  RGLLVPRKKPIQ  434
            RG ++P KKP Q
Sbjct  496  RG-VIPNKKPQQ  506



>ref|XP_007033528.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY04454.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=523

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 7/143 (5%)
 Frame = -2

Query  850  GXGMNEW----VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  683
            G  M  W    + +DAY+VF++M    IV +H  Y  VI  LC GK++++AL  L +M+R
Sbjct  368  GLCMKSWTEKDLAQDAYQVFEKMSSVSIV-DHTTYGFVIRTLCVGKKMEEALDHLQQMIR  426

Query  682  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRAL  503
            +GY P   TF NVI+ALC +GK+  AL VL +M+   +       Y+IL+KE N QGR L
Sbjct  427  MGYIPRTITFNNVIQALCTEGKIREALVVLVIMYESGKI-PSRTSYDILVKEFNHQGRLL  485

Query  502  DARNVYAAALKRGLLVPRKKPIQ  434
             A NVY AALK+G +VP + P++
Sbjct  486  GASNVYGAALKQG-VVPHRIPLR  507



>ref|XP_006587922.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial-like [Glycine max]
Length=507

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 90/133 (68%), Gaps = 8/133 (6%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L+ A EVF++M+ER +VV+   +E++++ALC GK  D+ALA+L EMVR+GYSP    F 
Sbjct  370  LLQGAGEVFEKMKERGLVVDQGTFEVIVQALCEGKRFDQALANLYEMVRLGYSPEVIAFD  429

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAA  479
             VI+ LC +G+VD A+S L L+H       G P    Y++LIKEL  +GR   A N++ A
Sbjct  430  KVIQGLCDEGRVDDAVSALVLLHANG----GVPNRVSYDVLIKELIEEGRLFCASNLFCA  485

Query  478  ALKRGLLVPRKKP  440
            A+K G +VP ++P
Sbjct  486  AVKLG-VVPNREP  497



>ref|XP_011002598.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g16710, mitochondrial [Populus euphratica]
Length=536

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AYEVF++M++R  V+E   Y LVI+AL   K+VD A  +L  MVR+GY P   T  NVIR
Sbjct  411  AYEVFEKMKKRGFVIEQSTYALVIQALWVAKKVDDAFINLHLMVRLGYFPRLITINNVIR  470

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            ALC  GKVD A  VL LM+  S+       Y++LI ELN+Q R L A NVY AAL RG +
Sbjct  471  ALCVAGKVDEAFYVLVLMYENSKIPSRM-SYDLLIHELNQQERTLCACNVYGAALVRG-V  528

Query  457  VPRKKP  440
            VP KKP
Sbjct  529  VPHKKP  534



>gb|KJB27678.1| hypothetical protein B456_005G004200 [Gossypium raimondii]
Length=480

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 90/144 (63%), Gaps = 6/144 (4%)
 Frame = -2

Query  850  GXGMNEW----VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  683
            G  M  W    +++DAY+VFD+MR++  +++H +Y  +I  LC  +++++A+  L EM+ 
Sbjct  338  GLCMKSWEEKDLVQDAYQVFDKMRKKDSIIDHSSYGFMIRTLCMVRKMEEAVYHLKEMIG  397

Query  682  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRAL  503
            +GY P   TF NVI+ LC +GK+  AL VL  M+   +       Y++L+KE NRQG  L
Sbjct  398  MGYIPRTITFNNVIQGLCIEGKIHEALVVLVTMYENGKI-PSRTSYDMLVKEFNRQGLLL  456

Query  502  DARNVYAAALKRGLLVPRKKPIQF  431
             A NVY AALK+G +V  + PI+ 
Sbjct  457  GACNVYGAALKQG-VVQHRIPIRL  479



>ref|XP_010109661.1| hypothetical protein L484_006096 [Morus notabilis]
 gb|EXC23833.1| hypothetical protein L484_006096 [Morus notabilis]
Length=618

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A++VF++M+    V++   Y+++I ALC GK+ D A   L +M+R+GYSP   TF  
Sbjct  490  LENAHQVFEKMKHEDSVIDPSTYDVMIGALCMGKKTDDASVYLQKMIRMGYSPRMVTFNG  549

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            VIRALC + KV  ALS+L L++   R       YN+LI ELN+ G  L A NVY AALKR
Sbjct  550  VIRALCLEEKVIEALSILVLLNEEGRI-PSRTCYNLLIDELNQHGSLLGASNVYGAALKR  608

Query  466  GLLVPRKKPIQ  434
            G ++P   P+Q
Sbjct  609  G-VIPTMMPLQ  618



>ref|XP_004305082.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DA E+F++++     ++   Y L+I++LC GK++D A+ +L +M+ +GYSP   TF 
Sbjct  380  LLEDACELFEKLQNGVSDIDASTYGLMIQSLCMGKKIDDAMINLKQMLTVGYSPRMITFN  439

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            NVI++LCA+ K+  AL VL   ++  R       YN+LI++LN+ G  L+A  VY AALK
Sbjct  440  NVIQSLCAEEKMIDALLVLGTAYKFDRV-ASRVSYNLLIQKLNQHGSMLEACTVYGAALK  498

Query  469  RGLLVPRKKPIQ  434
            RG L+P KKP Q
Sbjct  499  RG-LIPNKKPQQ  509



>ref|XP_008245346.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial-like [Prunus mume]
Length=523

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (64%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DA+EVF++M+   + ++   + L+I+  C  K++D A+  L EM+ +GYSP   TF 
Sbjct  394  LLEDAHEVFEKMQNGVLGIDASTFGLMIQTHCMEKKMDAAVVCLQEMIGMGYSPWIITFN  453

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            NVI+ LC +GKV  AL VLS+M+   R   G   YN LI  LNR+G  L A +VY AALK
Sbjct  454  NVIKTLCVEGKVTEALLVLSIMYEGGRGTNGI-SYNPLIHGLNRRGSFLGACSVYGAALK  512

Query  469  RGLLVPRKKPIQ  434
            RG ++P  KP Q
Sbjct  513  RG-VIPNTKPQQ  523



>ref|XP_008782664.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Phoenix dactylifera]
Length=587

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 90/149 (60%), Gaps = 1/149 (1%)
 Frame = -2

Query  841  MNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  662
            +N  +L+DA E+F+++ E         Y L+++AL  G E+D+ALA L EMVR GYSP  
Sbjct  419  INGELLKDAKELFEKVMEMDFGPSPYTYCLMVQALAVGGEIDEALAHLHEMVRAGYSPRM  478

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             T+  ++R LC +G+V+ AL +L LM +R +    F  + +L+ EL+RQGR LDA  VYA
Sbjct  479  MTYNVILRTLCEEGRVNDALGILVLMIKRGKIPSRF-SFRVLLNELSRQGRLLDAFGVYA  537

Query  481  AALKRGLLVPRKKPIQFSAKAQAPHIANG  395
            AA+KR ++        +  + +  HI  G
Sbjct  538  AAIKRNVISNWTPQKDWQNEEELKHIQGG  566


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 57/114 (50%), Gaps = 9/114 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
               A  +F  +  R +  +  ++ ++I++LC   E D+A   L +MV+ G+ P   TF +
Sbjct  174  FESAVSLFSELPSRGLSPDSLSFSIMIQSLCKKNEPDEAKQVLDDMVQSGFRPNIITFTD  233

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDA  497
            ++ +LC  G++  A  V  +M++     VG  P    YN LI  L   GR  +A
Sbjct  234  LVNSLCKRGRLKKAFEVFEIMNQ-----VGCEPTIRTYNCLIGGLCYVGRLEEA  282



>ref|XP_007206949.1| hypothetical protein PRUPE_ppb018157mg [Prunus persica]
 gb|EMJ08148.1| hypothetical protein PRUPE_ppb018157mg [Prunus persica]
Length=412

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 81/132 (61%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +  DA+EVF++M+   + +    Y L+I+ LC  K++  A+  L +M+ +GYSP   TF 
Sbjct  283  LFEDAHEVFEKMQNGILGINASTYGLMIQTLCMEKKMYAAVFCLQQMIGMGYSPWIITFN  342

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            NVI+ LC +GKV  AL VLS+M+   R   G   Y  LI  LNR+G  L A +VY AALK
Sbjct  343  NVIKTLCVEGKVTEALLVLSIMYEGGRGTNGI-SYKPLIHGLNRRGSFLGACSVYGAALK  401

Query  469  RGLLVPRKKPIQ  434
            RG ++P  KP Q
Sbjct  402  RG-VIPNTKPQQ  412



>ref|XP_010921153.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Elaeis guineensis]
Length=703

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -2

Query  841  MNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  662
            +N  +++DA E+F+++ E         Y L+++AL  G E+D+ALA L EMVR GYSP  
Sbjct  536  INSELIKDAKELFEKVMEMDFGPSPYTYCLMVQALAIGGEIDEALALLHEMVRAGYSPRM  595

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             T+  ++R LC +G+V+ AL +L LM +R +    F  + +L+ EL+RQGR LDA  VYA
Sbjct  596  MTYNVILRTLCEEGRVNDALGILVLMIKREKIPSRF-SFRVLLNELSRQGRLLDAFGVYA  654

Query  481  AALKRGLL  458
            AA+KR ++
Sbjct  655  AAIKRNVI  662


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 55/114 (48%), Gaps = 9/114 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
               A  +F  +R   +  +  ++ ++I+ LC   + D+A   L EMV+ G+ P   TF  
Sbjct  291  FESAVSLFSELRSHGLSPDSLSFSIMIQCLCKKNDPDEAKQVLDEMVQSGFRPNIITFTA  350

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDA  497
            V+ +LC  G++  A  V  +M++     VG  P    YN LI  L   GR  +A
Sbjct  351  VVNSLCKRGRLKKAFEVFEIMNQ-----VGCEPTIRTYNCLISGLCYVGRLEEA  399



>gb|ERN04164.1| hypothetical protein AMTR_s00077p00087500 [Amborella trichopoda]
Length=334

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L D   VF  +RE   V     Y L+I +L    E++KAL+ L EM+  G+ P R T
Sbjct  189  EISLGDVERVFRSIRELGYVPSPHTYCLMIHSLSTRGEMEKALSILTEMIENGHPPKRMT  248

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  +I+ LC+ G+VD A+ VL LM  R         YNILI+E N+ GR  DA  +YA A
Sbjct  249  YNTLIKGLCSKGRVDDAMDVLKLMFERET-SPSKAAYNILIREFNQSGRVFDASRLYAKA  307

Query  475  LKRGLLVPRKKPIQFSAK  422
            LKRG +VP ++P +   K
Sbjct  308  LKRG-VVPHQQPAEILVK  324



>ref|XP_009406874.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=613

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 83/145 (57%), Gaps = 1/145 (1%)
 Frame = -2

Query  841  MNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  662
            ++E VL DA E+ D + E         Y L+++AL  G E+DKAL  L EMVRIGY P  
Sbjct  465  IDEKVLNDAMELLDAITEIGHNPSVYTYCLMVKALAIGGEIDKALFHLQEMVRIGYCPRM  524

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             T+  V+R LC  G+ D AL VL LM  R     G   + IL+ EL +QGR LDA  VYA
Sbjct  525  MTYNVVLRVLCGGGRGDDALDVLVLMIERGTIPSG-SSFGILLGELCQQGRVLDAFGVYA  583

Query  481  AALKRGLLVPRKKPIQFSAKAQAPH  407
            AA+KRG+++  K    F+ +    H
Sbjct  584  AAIKRGVVLHWKPNKGFNVQTVIQH  608



>ref|XP_006481194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Citrus sinensis]
Length=387

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = -2

Query  850  GXGMNEW----VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  683
            G  M  W    +L DAY+VF++M ++  V +   Y +VI  L  GK+ D+AL  L   + 
Sbjct  247  GLCMKSWEEKDLLEDAYQVFEKMTKKVSVTDPGTYGIVIRTLGKGKKTDEALIHLHHAIE  306

Query  682  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRAL  503
            +G+ P   TF NVI+ALC +GK+D AL +L LM+  ++       Y++LI +L++  ++ 
Sbjct  307  MGHIPRTITFNNVIQALCGEGKIDKALLLLFLMYEHAKI-PSRTSYDMLITKLDQLEKSY  365

Query  502  DARNVYAAALKRGLLVPRKKP  440
            DA  +Y AALK+G ++P++KP
Sbjct  366  DACALYGAALKQG-VIPQRKP  385



>ref|XP_006429582.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina]
 gb|ESR42822.1| hypothetical protein CICLE_v10013314mg, partial [Citrus clementina]
Length=438

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = -2

Query  850  GXGMNEW----VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  683
            G  M  W    +L DAY+VF++M ++  V +   Y +VI  L  GK+ D+AL  L   + 
Sbjct  298  GLCMKSWEEKDLLEDAYQVFEKMTKKVSVTDPGTYGIVIRTLGKGKKTDEALIHLHHAIE  357

Query  682  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRAL  503
            +G+ P   TF NVI+ALC +GK+D AL +L LM+  ++       Y++LI +L++  ++ 
Sbjct  358  MGHIPRTITFNNVIQALCGEGKIDKALLLLFLMYEHAKI-PSRTSYDMLITKLDQLEKSY  416

Query  502  DARNVYAAALKRGLLVPRKKP  440
            DA  +Y AALK+G ++P++KP
Sbjct  417  DACALYGAALKQG-VIPQRKP  436



>ref|XP_010253075.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, 
mitochondrial-like [Nelumbo nucifera]
Length=623

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = -2

Query  838  NEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  659
            +E +L DA EVF+R+++         Y ++I AL    E++KALA+L EM+ +GY P   
Sbjct  471  DEELLIDALEVFERIKKFSYTPHSYTYGMMIHALSIRGEIEKALANLHEMLSLGYHPRMI  530

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAA  479
            TF  VI+ALC  G++D AL +L  M  R R        N+LI  LN+QGR LDA  +Y A
Sbjct  531  TFNTVIQALCRAGRIDEALLLLVHMF-RGRTTPSRISCNLLIDNLNKQGRLLDACKIYGA  589

Query  478  ALKRGLLVPRKKPIQ  434
            ALKRG + P +KP Q
Sbjct  590  ALKRG-VTPHQKPKQ  603



>gb|KDO64095.1| hypothetical protein CISIN_1g011714mg [Citrus sinensis]
Length=479

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 87/141 (62%), Gaps = 6/141 (4%)
 Frame = -2

Query  850  GXGMNEW----VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  683
            G  M  W    +L DAY+VF++M ++  V +   Y +VI  L  GK+ D+AL  L   + 
Sbjct  339  GLCMKSWEEKDLLEDAYQVFEKMTKKVSVTDPGTYGIVIRTLGKGKKTDEALIHLHHAIE  398

Query  682  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRAL  503
            +G+ P   TF NVI+ALC +GK+D AL +L LM+  ++       Y++LI +L++  ++ 
Sbjct  399  MGHIPRTITFNNVIQALCGEGKIDKALLLLFLMYEHAKI-PSRTSYDMLITKLDQLEKSY  457

Query  502  DARNVYAAALKRGLLVPRKKP  440
            DA  +Y AALK+G ++P++KP
Sbjct  458  DACALYGAALKQG-VIPQRKP  477



>ref|XP_006842489.2| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, 
mitochondrial [Amborella trichopoda]
Length=502

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 2/138 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L D   VF  +RE   V     Y L+I +L    E++KAL+ L EM+  G+ P R T
Sbjct  357  EISLGDVERVFRSIRELGYVPSPHTYCLMIHSLSTRGEMEKALSILTEMIENGHPPKRMT  416

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  +I+ LC+ G+VD A+ VL LM  R         YNILI+E N+ GR  DA  +YA A
Sbjct  417  YNTLIKGLCSKGRVDDAMDVLKLMFERET-SPSKAAYNILIREFNQSGRVFDASRLYAKA  475

Query  475  LKRGLLVPRKKPIQFSAK  422
            LKRG +VP ++P +   K
Sbjct  476  LKRG-VVPHQQPAEILVK  492



>ref|XP_010683486.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, 
chloroplastic-like [Beta vulgaris subsp. vulgaris]
Length=547

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 6/142 (4%)
 Frame = -2

Query  850  GXGMNEW----VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR  683
            G   N W    +L++ +E+F++++     +    Y L+I   C GKEVD AL +L EMV 
Sbjct  401  GLCRNSWEENELLKNVHEIFEKIKSWDYSIFPETYGLLIHTFCIGKEVDMALITLHEMVE  460

Query  682  IGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRAL  503
             GY P   T   ++R LC +GK+  AL VL L+    +F      +N LI+E NRQG  L
Sbjct  461  AGYFPRMVTINRIVRRLCDEGKISQALLVLVLVFEAGKFPSKI-SFNFLIEEFNRQGNVL  519

Query  502  DARNVYAAALKRGLLVPRKKPI  437
             A NVY AALK G ++P + P+
Sbjct  520  GACNVYGAALKVG-VIPHQMPL  540



>gb|KCW88349.1| hypothetical protein EUGRSUZ_A00738 [Eucalyptus grandis]
Length=409

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 10/133 (8%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DAY++F +MR     ++  +Y  +I+ L  G   ++AL ++  M+ +G+SP   +  
Sbjct  271  LLDDAYQMFKKMRSTGCAIDESSYGFIIQTLSVGNRNEEALFNMEHMMTMGHSPKMISLA  330

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP---YNILIKELNRQGRALDARNVYAA  479
             V+RALC +GK+  ALSV  LM  R    +G P    YN++I E NRQGR L A NVY  
Sbjct  331  RVLRALCREGKLGKALSV--LMDER----LGHPSKEVYNVIINEFNRQGRWLCACNVYGM  384

Query  478  ALKRGLLVPRKKP  440
            ALK+G +VP KKP
Sbjct  385  ALKQG-VVPEKKP  396



>ref|XP_003623623.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES79841.1| PPR containing plant-like protein [Medicago truncatula]
Length=583

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 82/139 (59%), Gaps = 1/139 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DA EVF++M+ER +VV+ R  E+++EAL  G++ D+AL +L +MVR GYS     F 
Sbjct  376  LLEDACEVFEKMKERGLVVDKRTVEVMVEALFRGEKFDEALVNLNDMVRWGYSLEGIAFE  435

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             VI  LC  G+VD A+S L L+     F +    + +L+ ELN  GR   A  ++  ALK
Sbjct  436  EVIEGLCGQGRVDEAVSTLLLLQANGGF-LDRVSFGVLVNELNAHGRVFCASFLFGVALK  494

Query  469  RGLLVPRKKPIQFSAKAQA  413
             G+++   K +Q   K  A
Sbjct  495  HGVVLVLNKELQADRKELA  513



>ref|XP_010043220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Eucalyptus grandis]
Length=540

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (61%), Gaps = 10/133 (8%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DAY++F +MR     ++  +Y  +I+ L  G   ++AL ++  M+ +G+SP   +  
Sbjct  402  LLDDAYQMFKKMRSTGCAIDESSYGFIIQTLSVGNRNEEALFNMEHMMTMGHSPKMISLA  461

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP---YNILIKELNRQGRALDARNVYAA  479
             V+RALC +GK+  ALSV  LM  R    +G P    YN++I E NRQGR L A NVY  
Sbjct  462  RVLRALCREGKLGKALSV--LMDER----LGHPSKEVYNVIINEFNRQGRWLCACNVYGM  515

Query  478  ALKRGLLVPRKKP  440
            ALK+G +VP KKP
Sbjct  516  ALKQG-VVPEKKP  527



>ref|XP_004492557.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g41170, mitochondrial-like [Cicer arietinum]
Length=560

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 82/132 (62%), Gaps = 2/132 (2%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            ++ DA EVF++M++R +VV+ R  E++++A C   + D+ALA+L +MVR GYS     F 
Sbjct  373  LIHDADEVFEKMKDRGLVVDKRTVEVMVQAYCWRDKFDEALANLNDMVRWGYSLEAIEFE  432

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             VI   C  G+VD ALS L L+H      V    Y +L+ ELN +GR   A  ++  ALK
Sbjct  433  KVIEGFCGQGRVDDALSSLLLLHANGGI-VDRVCYEVLVNELNARGRVFCASFLFGVALK  491

Query  469  RG-LLVPRKKPI  437
            +G +LVP K+P+
Sbjct  492  QGVVLVPNKEPM  503


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 55/114 (48%), Gaps = 1/114 (1%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            +F ++   ++V +   Y ++I   C   +V++A   L  ++  G  P   T   +I +LC
Sbjct  127  MFTKLSSFQLVPDCCTYSIIIRCHCEKNDVEEAKGVLFTVLENGLQPDSATITVLINSLC  186

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
              GKV  A+ V   M RR    +G  PYN L+K L+  GR  +A  +     KR
Sbjct  187  KRGKVKKAMEVFEFM-RRKGLKLGVQPYNCLLKGLSYIGRVDEAIEILMGMKKR  239



>gb|ABR16388.1| unknown [Picea sitchensis]
Length=700

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (54%), Gaps = 9/134 (7%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            +DA   + RM++R        Y L I  L    E+++A A L EM+  GYSP   T+  +
Sbjct  550  KDASIFYRRMKDRGFAYSASDYYLAIHCLSTAGEMEEAQALLYEMINKGYSPNLTTYNTM  609

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAA  476
            I+  C  G++D A ++L+ M        G  P    YNILIKE + QGR  DA  +YA A
Sbjct  610  IKGFCRQGRLDDADAMLNFMIEN-----GIGPDTGSYNILIKEFHNQGRTQDADQLYATA  664

Query  475  LKRGLLVPRKKPIQ  434
            L+RG+++  K  IQ
Sbjct  665  LERGVVLNPKPVIQ  678


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 9/126 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + DA ++ D M +     +   Y +VI ALC  K +++A   L +M   G  P  +T+  
Sbjct  339  MEDAMKLLDDMIQNNYAPDVVTYTIVISALCKRKMIEQAYGVLQKMRENGCEPNIYTYNA  398

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I+ LCA  + + AL +++LM +      G PP    Y IL   L +  R   A+ ++  
Sbjct  399  LIQGLCAVRRPEEALELVTLMEQG-----GVPPNIYTYTILTHGLCKLRRLDRAKEMFNE  453

Query  478  ALKRGL  461
            AL RGL
Sbjct  454  ALARGL  459



>gb|EMT30207.1| hypothetical protein F775_08031 [Aegilops tauschii]
Length=539

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            VLRDA EVF ++           Y L+ +AL  G EVD A+A L +MVR GY+  +  + 
Sbjct  395  VLRDAKEVFGKVVAAGHEPVSYTYCLMAQALARGGEVDAAVAILDDMVRKGYALRKRAYT  454

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            +V+RALC   +   AL VL+ +  +  F  G   ++ L++EL+RQGR  DA  VYAAA+K
Sbjct  455  DVVRALCDRSRTHAALRVLAAVITKD-FVPGRNAFDALLEELSRQGRWPDAMAVYAAAVK  513

Query  469  RGLLVPRKKPIQFSAKAQAP  410
            RG++V  K+ ++ +   ++P
Sbjct  514  RGVVVSLKRHVKEALARESP  533



>ref|XP_003557966.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like 
[Brachypodium distachyon]
Length=538

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 78/132 (59%), Gaps = 1/132 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
             LRDA EVF ++           Y L+ +AL  G EVD A+A L +M R GY+  +  + 
Sbjct  390  ALRDAKEVFGKLVSSGHEPVSYTYCLMAQALARGGEVDAAVAILDDMARKGYALRKRAYT  449

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            +V+RALC   +   A+ VL+++  R  F  G   ++ L+ EL+RQGR  DA  VYAAA+K
Sbjct  450  DVVRALCDRSRTSEAVRVLAVVIARD-FVPGRNAFDALLGELSRQGRWPDAMAVYAAAVK  508

Query  469  RGLLVPRKKPIQ  434
            RG++V  K+ I+
Sbjct  509  RGVVVSLKRHIK  520



>gb|ACG44675.1| hypothetical protein [Zea mays]
Length=558

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  844  GMNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPG  665
              +   L DA EVF ++           Y L+ +AL  G EVD A+A L +MVR GY+  
Sbjct  405  ATDASALGDAEEVFGKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALR  464

Query  664  RFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVY  485
            +  + +V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VY
Sbjct  465  KRAYTDVVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMTVY  524

Query  484  AAALKRGLLV  455
            AAA+KRG++V
Sbjct  525  AAAVKRGVVV  534



>ref|NP_001130560.1| uncharacterized protein LOC100191659 [Zea mays]
 gb|ACF78824.1| unknown [Zea mays]
Length=558

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  844  GMNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPG  665
              +   L DA EVF ++           Y L+ +AL  G EVD A+A L +MVR GY+  
Sbjct  405  ATDASALGDAEEVFGKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALR  464

Query  664  RFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVY  485
            +  + +V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VY
Sbjct  465  KRAYTDVVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMTVY  524

Query  484  AAALKRGLLV  455
            AAA+KRG++V
Sbjct  525  AAAVKRGVVV  534



>ref|XP_004984461.1| PREDICTED: protein Rf1, mitochondrial-like [Setaria italica]
Length=552

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 73/128 (57%), Gaps = 0/128 (0%)
 Frame = -2

Query  838  NEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  659
            +   L DA EVF ++           Y L+ +AL  G EVD A+A L EMVR GY+  + 
Sbjct  405  DASALGDAREVFAKLVASGHEPVSYTYCLMAQALARGGEVDAAVALLEEMVRRGYALRKR  464

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAA  479
             + +V+RALC  G+   AL VL L+     F  G   ++ L+ EL+RQGR  DA  VYAA
Sbjct  465  AYTDVVRALCDRGRARDALRVLVLVMIVRDFVPGRNAFDALLGELSRQGRWPDAMAVYAA  524

Query  478  ALKRGLLV  455
            A+KRG+ V
Sbjct  525  AVKRGVAV  532



>ref|NP_001050037.1| Os03g0336000 [Oryza sativa Japonica Group]
 gb|ABF95816.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11951.1| Os03g0336000 [Oryza sativa Japonica Group]
 gb|EAY89912.1| hypothetical protein OsI_11461 [Oryza sativa Indica Group]
 dbj|BAG94427.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            EVF ++           Y L+ +AL  G EVD A++ L EM R GY+  +  + +V+RAL
Sbjct  401  EVFGKLVASGHEPVSYTYCLMAQALARGGEVDAAVSLLGEMARRGYALRKRAYTDVVRAL  460

Query  631  CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  452
            C  G+   AL VL+L+  R  F  G   ++ L+ EL RQGR  DA  VYAAA+KRG+LV 
Sbjct  461  CERGRARDALRVLALVIARD-FVPGRNAFDALLGELARQGRWPDAMAVYAAAVKRGVLVS  519

Query  451  RKK  443
             K+
Sbjct  520  LKR  522



>gb|EAZ26836.1| hypothetical protein OsJ_10752 [Oryza sativa Japonica Group]
Length=523

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = -2

Query  745  EALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRF  566
            EAL  G EVD A++ L EM R GY+  +  + +V+RALC  G+   AL VL+L+  R  F
Sbjct  401  EALARGGEVDAAVSLLGEMARRGYALRKRAYTDVVRALCERGRARDALRVLALVIARD-F  459

Query  565  WVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKK  443
              G   ++ L+ EL RQGR  DA  VYAAA+KRG+LV  K+
Sbjct  460  VPGRNAFDALLGELARQGRWPDAMAVYAAAVKRGVLVSLKR  500



>gb|KFK35778.1| hypothetical protein AALP_AA4G035000 [Arabis alpina]
Length=397

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +VFD M ERK VV+  AY  +++ALC   +VD+A     EM ++G+ P  +++   I 
Sbjct  102  ARKVFDEMLERKCVVDLLAYNALLDALCKSGDVDEAYKMFEEMGKVGFKPDAYSYAIFIH  161

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            A C  G V  A  VL  M RR         YN +IK L ++ +  DA  +    ++RG
Sbjct  162  AYCDSGDVHSAYKVLDRM-RRYDLVTNVYTYNHIIKTLCKKDKVDDAYLMLDEMIERG  218


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +  AY+V DRMR   +V     Y  +I+ LC   +VD A   L EM+  G SP  +T+ +
Sbjct  169  VHSAYKVLDRMRRYDLVTNVYTYNHIIKTLCKKDKVDDAYLMLDEMIERGASPDTWTYNS  228

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C   +V+ A  + S M  R++       YN+++K L R GR   A  V+    +R
Sbjct  229  IMAYHCDHCEVNRATKLFSRMD-RTKCLPDRHTYNMVLKLLIRIGRFDRATEVWEGMSER  287

Query  466  GL  461
              
Sbjct  288  KF  289



>ref|NP_001060800.1| Os08g0107700 [Oryza sativa Japonica Group]
 dbj|BAF22714.1| Os08g0107700, partial [Oryza sativa Japonica Group]
Length=374

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY +FD+M ++ +  +   Y  +I AL   + +DKA   LV MV+ G  P R T  +
Sbjct  219  LDTAYHLFDQMLDQGLSPDVVTYNSIISALSKARAMDKAAVVLVRMVKNGAMPNRITHNS  278

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++   C+ GK + A+ V   M R      G  P    YN L+  L + GR+++AR ++ +
Sbjct  279  LLHGYCSSGKPNDAIGVFKRMCRD-----GVEPDVFTYNTLMGYLCKNGRSMEARKIFDS  333

Query  478  ALKRG  464
             +KRG
Sbjct  334  MVKRG  338



>dbj|BAD09393.1| putative PPR protein [Oryza sativa Japonica Group]
 gb|EAZ41257.1| hypothetical protein OsJ_25765 [Oryza sativa Japonica Group]
Length=798

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY +FD+M ++ +  +   Y  +I AL   + +DKA   LV MV+ G  P R T  +
Sbjct  219  LDTAYHLFDQMLDQGLSPDVVTYNSIISALSKARAMDKAAVVLVRMVKNGAMPNRITHNS  278

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++   C+ GK + A+ V   M R      G  P    YN L+  L + GR+++AR ++ +
Sbjct  279  LLHGYCSSGKPNDAIGVFKRMCRD-----GVEPDVFTYNTLMGYLCKNGRSMEARKIFDS  333

Query  478  ALKRG  464
             +KRG
Sbjct  334  MVKRG  338


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 9/116 (8%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA  +F +MR + +  +   Y +V++ALC   +VD A+A    ++  G +P    F N+I
Sbjct  396  DAMLLFSKMRRQGLNPDTVTYGIVMDALCMVGKVDDAMAQFGRLISEGLTPDAVVFRNLI  455

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVY  485
              LCA  K D A  +   M  R     G  P    +N L+  L ++G    A+N++
Sbjct  456  HGLCARDKWDKAEELAVEMIGR-----GICPNNIFFNTLLNHLCKEGMVARAKNIF  506



>ref|XP_010248027.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Nelumbo nucifera]
Length=616

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (56%), Gaps = 1/126 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +  A ++ D MR++ + V+   Y ++I ALC   E  KA+  L EMV +G SP   T+  
Sbjct  462  MEGAGKLLDEMRDKGVRVDLVTYNILISALCKDGESKKAVKLLNEMVEMGLSPSHVTYNT  521

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C++G +  AL++ S M +  +       YN+LI+ L ++G+  +A ++    L++
Sbjct  522  LMDGFCSEGNLRAALNMRSRMEKEGK-RANVVTYNVLIRGLCQKGKLEEANDLLNEMLEK  580

Query  466  GLLVPR  449
            GL+  R
Sbjct  581  GLIPNR  586



>dbj|BAD13709.1| PPR protein [Oryza sativa Indica Group]
Length=332

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 1/125 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L   Y  ++ M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T
Sbjct  25   EGDLDKTYSTYNEMLDKRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMT  84

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            + +++   C+ G+   A+  L  M R          YN L+  L + GR  +AR ++ + 
Sbjct  85   YNSIVHGFCSSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSM  143

Query  475  LKRGL  461
             KRGL
Sbjct  144  TKRGL  148



>ref|XP_010530432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Tarenaya hassleriana]
Length=511

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 76/138 (55%), Gaps = 12/138 (9%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHR----------AYELVIEALCNGKEVDKALASLVEMVRI  680
            ++ DA+++FD+  +R +  + +           + L+I A C G+  D+A+  L   + +
Sbjct  375  LVEDAHQLFDKTTKRALTAKRKLMAIDVDVLGMHSLMIRAFCVGRRFDEAVECLERAIEL  434

Query  679  GYSPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALD  500
            G  P    F N+++ L  +G+++ A+++L +M+ + +       Y+ LIKELNR+G    
Sbjct  435  GIVPRTIAFNNLVQGLSGEGRIEEAINILLVMYGQGKI-PSTTSYDTLIKELNRRGMWAV  493

Query  499  ARNVYAAALKRGLLVPRK  446
            A  +Y AALKR +  PR+
Sbjct  494  ASALYGAALKRRVF-PRR  510



>ref|XP_010530346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 68/122 (56%), Gaps = 2/122 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +  +M ER I V+ + Y ++I+ LC G  +D AL+   +M   G +P   T+  +I 
Sbjct  245  ALNLLMKMEERNIEVDVKIYSMIIDGLCKGGHIDDALSLFEKMDSKGIAPNVVTYSCLIN  304

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
             LC   + + A+ +L+ M +R + +     +NILI    ++G+ L+A+ +Y   ++RG L
Sbjct  305  GLCVFDRWNDAVRLLNDMAKR-KIFPNVVTFNILIDAFVKEGKFLEAKELYEEMIRRG-L  362

Query  457  VP  452
            VP
Sbjct  363  VP  364



>gb|ABG66168.1| Rf1 protein, mitochondrial precursor, putative, expressed [Oryza 
sativa Japonica Group]
Length=484

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 9/129 (7%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T
Sbjct  212  EGDLDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRT  271

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNV  488
            + +++   C+ G+   A+  L  MH       G  P    YN L+  L + GR  +AR +
Sbjct  272  YNSIVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKM  326

Query  487  YAAALKRGL  461
            + +  KRGL
Sbjct  327  FDSMTKRGL  335



>dbj|BAD08212.1| hypothetical protein [Oryza sativa Indica Group]
 dbj|BAD13710.1| PPR protein [Oryza sativa Indica Group]
 dbj|BAE00068.1| PPR protein [Oryza sativa Indica Group]
 gb|ABI74690.1| fertility restorer [Oryza sativa Indica Group]
Length=683

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 1/125 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L   Y  ++ M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T
Sbjct  101  EGDLDKTYSTYNEMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMT  160

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            + +++   C+ G+   A+  L  M R          YN L+  L + GR  +AR ++ + 
Sbjct  161  YNSIVHGFCSSGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSM  219

Query  475  LKRGL  461
             KRGL
Sbjct  220  TKRGL  224



>dbj|BAD13711.1| PPR protein [Oryza sativa Indica Group]
Length=794

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 9/129 (7%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T
Sbjct  212  EGDLDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRT  271

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNV  488
            + +++   C+ G+   A+  L  MH       G  P    YN L+  L + GR  +AR +
Sbjct  272  YNSIVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKM  326

Query  487  YAAALKRGL  461
            + +  KRGL
Sbjct  327  FDSMTKRGL  335



>ref|NP_001064958.1| Os10g0497300 [Oryza sativa Japonica Group]
 dbj|BAD08215.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF26872.1| Os10g0497300 [Oryza sativa Japonica Group]
 dbj|BAG89195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=794

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 9/129 (7%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T
Sbjct  212  EGDLDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRT  271

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNV  488
            + +++   C+ G+   A+  L  MH       G  P    YN L+  L + GR  +AR +
Sbjct  272  YNSIVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKM  326

Query  487  YAAALKRGL  461
            + +  KRGL
Sbjct  327  FDSMTKRGL  335



>dbj|BAD08211.1| hypothetical protein [Oryza sativa Indica Group]
 dbj|BAE00069.1| PPR protein [Oryza sativa Indica Group]
Length=794

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 9/129 (7%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T
Sbjct  212  EGDLDKAYGTYHEMLDRGILPNVVTYNSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRT  271

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNV  488
            + +++   C+ G+   A+  L  MH       G  P    YN L+  L + GR  +AR +
Sbjct  272  YNSIVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKM  326

Query  487  YAAALKRGL  461
            + +  KRGL
Sbjct  327  FDSMTKRGL  335



>ref|XP_009604022.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Nicotiana tomentosiformis]
Length=547

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER   V+  AY  ++E+ C  +++D A    V+M  +G  P  FT+   I
Sbjct  258  EAQKLFDEMLERGFAVDLLAYNSILESQCKAEKMDDAYNLFVKMRSMGLKPDAFTYAVFI  317

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +  A  VL  M +R +       YN++IK+L +  +  DA  +    ++RG+
Sbjct  318  RAYCVKDDIHSAFRVLDRM-KRYKLVPNVFTYNVIIKKLCKSDKVEDAYQLIDEMIERGV  376



>dbj|BAD20284.1| hypothetical protein [Oryza sativa Indica Group]
Length=791

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I  +   Y  +I ALC G+ +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRRISPDVVTYSSIIAALCKGQAMDKAMEVLTTMVKNGVMPNCMTYNSILH  274

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+  +   A+  L  M R          YN L+  L + GR+ +AR ++ +  KRGL
Sbjct  275  GYCSSEQPKEAIGFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRSTEARKIFDSMTKRGL  332



>ref|XP_003623872.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES80090.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=539

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 0/120 (0%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            RDA ++F +M++ ++      Y  VI+ LC    VD+A     EMV  G     +++ ++
Sbjct  192  RDAIQMFPKMKKIRVYPNLIMYNTVIDGLCKQGLVDEACGLCTEMVENGIELDVYSYNSM  251

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            I   C+ G+   A+ +L  M  R + +     +NILI  L + GR  +A NV A  +KRG
Sbjct  252  IHGFCSVGRFQAAVKLLDEMVVRGKVYPDVYTFNILIDGLCKLGRVSEAYNVVAVMIKRG  311



>ref|XP_010315244.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315245.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315249.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315250.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315256.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315257.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315261.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315262.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315263.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
 ref|XP_010315265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Solanum lycopersicum]
Length=767

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 60/114 (53%), Gaps = 7/114 (6%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+ V  +M E+ ++ +   Y  +I+ LC  + + +A     EM R+G  P +FT+  
Sbjct  478  LERAFCVKQQMVEKGVLPDVITYSSLIQGLCEQRRLTEAFELFQEMFRVGLQPDKFTYTT  537

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDAR  494
            +I A CA+G + GA      +H +  +   FP    YN+LI  LN+Q R  +A+
Sbjct  538  LIGAYCANGDIKGAFH----LHNKMIYKGCFPDVVTYNVLINGLNKQARTREAK  587



>dbj|BAD08213.1| hypothetical protein [Oryza sativa Indica Group]
Length=762

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I  +   Y  +I ALC G+ +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRRISPDVVTYSSIIAALCKGQAMDKAMEVLTTMVKNGVMPNCMTYNSILH  274

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+  +   A+  L  M R          YN L+  L + GR+ +AR ++ +  KRGL
Sbjct  275  GYCSSEQPKEAIGFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRSTEARKIFDSMTKRGL  332



>gb|ABC42331.1| PPR protein [Oryza sativa Indica Group]
Length=506

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I+     Y  +I ALC G+ +DKA+     MV+ G +P  FT+ +++ 
Sbjct  217  AYATYREMLDRRILPNVVTYSSIIAALCKGQAMDKAMEVHDRMVKNGVTPNCFTYTSLVH  276

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
              C+ G++  A+  L  M        G  P    Y+  +  L + GR  +AR ++ + +K
Sbjct  277  GFCSSGQLTEAIKFLEKMCSN-----GVEPNVVTYSSFMDYLCKNGRCTEARKIFYSMVK  331

Query  469  RGL  461
            RGL
Sbjct  332  RGL  334



>gb|AAL58263.1|AC068923_5 putative membrane-associated protein [Oryza sativa Japonica Group]
Length=1219

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 9/126 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++   C+ G+   A+  L  MH       G  P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  478  ALKRGL  461
              KRGL
Sbjct  330  MTKRGL  335



>gb|AES60450.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=497

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L +A ++F+ MR   ++ +  AY  +I+ LC    ++ AL  + EM   G  P   T+ 
Sbjct  305  MLDEAMDLFEGMRNENVIPDVVAYSSLIDGLCKSGRINSALKYVDEMHDRGQPPNVITYT  364

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            ++I ALC   +VD A+++L  +  +         YNIL+  L + GR  DA+ V+   L 
Sbjct  365  SLIDALCKSHQVDKAIALLKKIKDQG-IQANMYTYNILVDGLCKDGRLTDAQKVFQDLLM  423

Query  469  RG  464
            +G
Sbjct  424  KG  425



>gb|EEE51212.1| hypothetical protein OsJ_32033 [Oryza sativa Japonica Group]
Length=1144

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 9/126 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +
Sbjct  215  LDKAYGTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTSMVKNGVMPNCRTYNS  274

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++   C+ G+   A+  L  MH       G  P    YN L+  L + GR  +AR ++ +
Sbjct  275  IVHGYCSSGQPKEAIGFLKKMHSD-----GVEPDVVTYNSLMDYLCKNGRCTEARKMFDS  329

Query  478  ALKRGL  461
              KRGL
Sbjct  330  MTKRGL  335



>gb|ACL53100.1| unknown [Zea mays]
Length=437

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L DA EVF ++           Y L+ +AL  G EVD A+A L +MVR GY+  +  + +
Sbjct  290  LGDAEEVFAKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALRKRAYTD  349

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VYAAA+KR
Sbjct  350  VVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMAVYAAAVKR  409

Query  466  GLLVPRK  446
            G++V  K
Sbjct  410  GVVVSWK  416



>ref|NP_001064975.1| Os10g0499500 [Oryza sativa Japonica Group]
 gb|AAM93691.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54465.1| Rf1 protein, mitochondrial precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26889.1| Os10g0499500 [Oryza sativa Japonica Group]
 gb|EAZ16577.1| hypothetical protein OsJ_32049 [Oryza sativa Japonica Group]
 dbj|BAG89496.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91413.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAJ07249.1| pentatricopeptide repeat-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAJ07251.1| pentatricopeptide repeat-containing protein [Oryza sativa Japonica 
Group]
Length=506

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I+     Y  +I ALC G+ +DKA+     MV+ G +P  FT+ +++ 
Sbjct  217  AYATYREMLDRRILPNVVIYSSIIAALCKGQAMDKAMEVHDRMVKNGVTPNCFTYTSLVH  276

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
              C+ G++  A+  L  M        G  P    Y+  +  L + GR  +AR ++ + +K
Sbjct  277  GFCSSGQLTEAIKFLEKMCSN-----GVEPNVVTYSSFMDYLCKNGRCTEARKIFDSMVK  331

Query  469  RGL  461
            RGL
Sbjct  332  RGL  334



>gb|AIC74549.1| truncated PPR protein PPR9-409-Z [Oryza sativa Indica Group]
Length=409

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+     Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPNVVTYSSIIAALCKAQAMDKAMEVLTTMVKNGVMPDCRTYTSIMH  279

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          YN L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRSTEARKIFDSMTKRGL  337



>dbj|BAD08216.1| hypothetical protein [Oryza sativa Japonica Group]
Length=401

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 1/115 (1%)
 Frame = -2

Query  805  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  626
             D+M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T+ +++   C+
Sbjct  104  LDKMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMTYNSIVHGFCS  163

Query  625  DGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             G+   A+  L  M R          YN L+  L + GR  +AR ++ +  KRGL
Sbjct  164  SGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSMTKRGL  217



>ref|XP_003590199.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=834

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L +A ++F+ MR   ++ +  AY  +I+ LC    ++ AL  + EM   G  P   T+ 
Sbjct  344  MLDEAMDLFEGMRNENVIPDVVAYSSLIDGLCKSGRINSALKYVDEMHDRGQPPNVITYT  403

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            ++I ALC   +VD A+++L  + +          YNIL+  L + GR  DA+ V+   L 
Sbjct  404  SLIDALCKSHQVDKAIALLKKI-KDQGIQANMYTYNILVDGLCKDGRLTDAQKVFQDLLM  462

Query  469  RG  464
            +G
Sbjct  463  KG  464



>ref|XP_006346446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006346447.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
isoform X2 [Solanum tuberosum]
Length=767

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 9/115 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+ V   M E+ ++ +   Y  +I+ LC  + + +A     EM+R+G  P +FT+  
Sbjct  478  LERAFCVKQLMVEKGVLPDVITYSSLIQGLCEQQRLTEACELFQEMLRVGLQPDKFTYTT  537

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDAR  494
            +I A CA+G + GA  + + M      + GF P    YN+LI  LN+Q R  +A+
Sbjct  538  LIGAYCANGDIKGAFHLHNKM-----IYKGFFPDVVTYNVLINGLNKQARTREAK  587



>sp|Q76C99.1|RF1_ORYSI RecName: Full=Protein Rf1, mitochondrial; AltName: Full=Fertility 
restorer; AltName: Full=Protein PPR; AltName: Full=Restorer 
for CMS; Flags: Precursor [Oryza sativa Indica Group]
 dbj|BAC77665.2| PPR protein [Oryza sativa Indica Group]
 dbj|BAC77666.2| Rf1 [Oryza sativa Indica Group]
 dbj|BAD08214.1| fertility restorer [Oryza sativa Indica Group]
 dbj|BAD13708.1| PPR protein [Oryza sativa Indica Group]
 dbj|BAD20283.1| restorer for CMS [Oryza sativa Indica Group]
Length=791

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRGILPDVVTYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  274

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y++L+  L + GR ++AR ++ +  KRGL
Sbjct  275  GYCSSGQPKEAIGFLKKM-RSDGVEPDVVTYSLLMDYLCKNGRCMEARKIFDSMTKRGL  332



>gb|ABC42330.1| PPR protein [Oryza sativa Indica Group]
Length=791

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  215  AYSTYHEMLDRGILPDVVTYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  274

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y++L+  L + GR ++AR ++ +  KRGL
Sbjct  275  GYCSSGQPKEAIGFLKKM-RSDGVEPDVVTYSLLMDYLCKNGRCMEARKIFDSMTKRGL  332



>gb|EAZ16561.1| hypothetical protein OsJ_32034 [Oryza sativa Japonica Group]
Length=526

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 1/115 (1%)
 Frame = -2

Query  805  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  626
             D+M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T+ +++   C+
Sbjct  104  LDKMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMTYNSIVHGFCS  163

Query  625  DGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             G+   A+  L  M R          YN L+  L + GR  +AR ++ +  KRGL
Sbjct  164  SGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSMTKRGL  217



>gb|AAL58260.1|AC068923_2 putative membrane-associated protein [Oryza sativa Japonica Group]
Length=627

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 1/115 (1%)
 Frame = -2

Query  805  FDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCA  626
             D+M +++I      Y  +I ALC  + VDKA+  L  MV+ G  P   T+ +++   C+
Sbjct  104  LDKMLDQRISPNVVTYNSIIAALCKAQTVDKAMEVLTTMVKSGVMPDCMTYNSIVHGFCS  163

Query  625  DGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             G+   A+  L  M R          YN L+  L + GR  +AR ++ +  KRGL
Sbjct  164  SGQPKEAIVFLKKM-RSDGVEPDVVTYNSLMDYLCKNGRCTEARKIFDSMTKRGL  217



>gb|EPS61251.1| hypothetical protein M569_13548, partial [Genlisea aurea]
Length=488

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +V +RM E        +Y  ++   C  K++D AL  L  MV  G  P   T+  ++ 
Sbjct  266  AVDVLERMPENGCTPNSLSYNSLLHTFCKEKKMDSALEYLELMVSRGCYPDIVTYNTMLT  325

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGKVD A+++L+ +  + R       YN +I  L++ GR  +A  +      RGL
Sbjct  326  ALCRDGKVDAAVAILNRLRSKGRCSPVLITYNTVIDGLSKMGRTDEAMELLVEMRGRGL  384


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 62/125 (50%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A EV DRM  ++   +   Y ++IEA      VD+A+  L +M R G  P   T+  
Sbjct  123  LSEAMEVIDRMLLKECHPDVITYTILIEATLKENGVDQAMELLDDMKRRGCKPDIVTYNV  182

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  +C +GK+D A+  L  M        G  P    +NI+++ +   GR +DA  + + 
Sbjct  183  LIDGICKEGKLDEAIKFLDTMSS-----YGCRPNVITHNIILRSMCSTGRWMDAEKLLSE  237

Query  478  ALKRG  464
             L +G
Sbjct  238  MLVKG  242



>gb|ACL53015.1| unknown [Zea mays]
 tpg|DAA45234.1| TPA: hypothetical protein ZEAMMB73_414823 [Zea mays]
Length=559

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  844  GMNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPG  665
              +   L DA EVF ++           Y L+ +AL  G EVD A+A L +MVR GY+  
Sbjct  406  ATDASALGDAEEVFAKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALR  465

Query  664  RFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVY  485
            +  + +V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VY
Sbjct  466  KRAYTDVVRALCDRGRARDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMAVY  525

Query  484  AAALKRGLLV  455
            AAA+KRG++V
Sbjct  526  AAAVKRGVVV  535



>ref|XP_006651349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Oryza brachyantha]
Length=507

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 74/143 (52%), Gaps = 3/143 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVD-KALASLVEMVRIGYSPGRF-TFCNV  644
            A++ + RM       + RA + +   LC     D  ALA   E+     + GR   +  V
Sbjct  360  AWQTYKRMERAGFEADGRALDTLARGLCRRCAADISALADAREVFATLVASGRKRAYTGV  419

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            +RALC  G+   AL VL+L+  R  F  G   ++ L+ EL RQGR  DA  VYAAA+KRG
Sbjct  420  VRALCERGRSRDALRVLALVIARD-FVPGRNAFDALLGELARQGRWPDAMAVYAAAVKRG  478

Query  463  LLVPRKKPIQFSAKAQAPHIANG  395
            +LV  K+  + +  AQ    ++G
Sbjct  479  VLVSLKRHSKEALLAQETRESSG  501



>gb|KHN04861.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=566

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +AY +F  M+ER + ++  +Y  +I   CN +E+ KA A   EM R G SP   T+  
Sbjct  426  MHEAYGIFKEMKERGLCLDQISYTTLIVGFCNNREMKKAWALFEEMSREGCSPNVITYTC  485

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I   C   ++D A  V   M+R S        Y +LI   ++ G    A  +Y     +
Sbjct  486  IIDGFCKSNRIDLATWVFDKMNRDSVI-PDVVTYTVLIDWYHKHGYFDQAHKLYDVMKDK  544

Query  466  GLL  458
            G+L
Sbjct  545  GVL  547



>ref|XP_002467904.1| hypothetical protein SORBIDRAFT_01g036150 [Sorghum bicolor]
 gb|EER94902.1| hypothetical protein SORBIDRAFT_01g036150 [Sorghum bicolor]
Length=558

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 72/124 (58%), Gaps = 0/124 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L DA EVF ++           Y L+ +AL  G EVD A+A L +MVR GY+  +  + +
Sbjct  411  LGDAKEVFAKVVASGHEPVSYTYCLMAQALARGGEVDAAVALLEDMVRKGYALRKRAYTD  470

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            V+RALC  G+   AL VL L+     F  G   +  L+ EL+RQGR  DA  VYAAA+KR
Sbjct  471  VVRALCDRGRALDALQVLVLVMIVRDFVPGRNAFEALLGELSRQGRWADAMAVYAAAVKR  530

Query  466  GLLV  455
            G++V
Sbjct  531  GVVV  534



>ref|XP_006572968.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X1 [Glycine max]
 ref|XP_006572969.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X2 [Glycine max]
 ref|XP_006572970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X3 [Glycine max]
 ref|XP_006572971.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X4 [Glycine max]
Length=734

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +AY +F  M+ER + ++  +Y  +I   CN +E+ KA A   EM R G SP   T+  
Sbjct  594  MHEAYGIFKEMKERGLCLDQISYTTLIVGFCNNREMKKAWALFEEMSREGCSPNVITYTC  653

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I   C   ++D A  V   M+R S        Y +LI   ++ G    A  +Y     +
Sbjct  654  IIDGFCKSNRIDLATWVFDKMNRDSVI-PDVVTYTVLIDWYHKHGYFDQAHKLYDVMKDK  712

Query  466  GLL  458
            G+L
Sbjct  713  GVL  715



>ref|XP_002512435.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF49887.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=546

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 1/126 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A  +   M  + +  +   Y ++I++LCN  E+ KAL  L EM R G  P + T+  
Sbjct  392  LEAARNLVSEMDTKHLKADLITYNILIDSLCNKGEMKKALRLLDEMCRKGLKPSQLTYNT  451

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I   C +G +  AL++ S M +  R       YN+LIK   ++ +  DA  +    L++
Sbjct  452  MIDGYCKEGNLRAALNLRSQMEKVGRL-ANVATYNVLIKGFCKKDKLEDANGLLNEMLEK  510

Query  466  GLLVPR  449
            GL+  R
Sbjct  511  GLIPNR  516



>gb|AIC74551.1| PPR protein PPR9-782-M [Oryza sativa Indica Group]
Length=782

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLTTMVKNGVMPDCMTYTSIMH  279

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGFLKKM-RSDGVEPNVFTYRSLMNYLCKNGRSTEARKIFDSMTKRGL  337



>gb|AIC74550.1| PPR protein PPR9-782-I [Oryza sativa Indica Group]
 dbj|BAQ15369.1| pentatricopeptide repeat-containing protein [Oryza sativa Indica 
Group]
Length=782

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLTTMVKNGVMPDCMTYTSIMH  279

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGFLKKM-RSDGVKPNVFTYRSLMNYLCKNGRSTEARKIFDSMTKRGL  337



>ref|XP_010458712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=633

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E+  +M ERKI +    Y ++I+ LC  + +D AL    EM   G+     T+  +IR
Sbjct  243  AMELLRKMEERKIKLNVVHYSIIIDGLCKDENLDDALNLFNEMEVKGFKADVITYTTLIR  302

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C DG+ D    +L  M  R R       +N LI    ++G+ L+A  +Y   ++RG+
Sbjct  303  GFCNDGRWDDGAQLLRDMITR-RIAPNVVTFNSLIDSFVKEGKLLEAEELYKEMIRRGI  360



>gb|AES79447.2| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=713

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA +V D M +R     +  Y  +I  LC    VD AL  L  M + G  P   T+  ++
Sbjct  322  DAIKVLDLMVKRGEEPNNVTYNAIINGLCKEGRVDDALGILETMAKKGKKPDVVTYSTLV  381

Query  640  RALCADGKVDGALSVLS-LMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            + LC  GK+D A+ +L+ LM +          +N++I+EL +Q R   A+ VY   ++RG
Sbjct  382  KGLCGVGKIDEAVDLLNLLMSKEFHIKPDVFAFNLVIQELCKQRRLRHAKRVYYTMVERG  441

Query  463  L  461
             
Sbjct  442  F  442



>ref|XP_010458689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=575

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E+  +M ERKI +    Y ++I+ LC  + +D AL    EM   G+     T+  +IR
Sbjct  233  AMELLRKMEERKIKLNVVHYSIIIDGLCKDENLDDALNLFNEMEVKGFKADVITYTTLIR  292

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C DG+ D    +L  M  R R       +N LI    ++G+ L+A  +Y   ++RG+
Sbjct  293  GFCNDGRWDDGAQLLRDMITR-RIAPNVVTFNSLIDSFVKEGKLLEAEELYKEMIRRGI  350



>ref|XP_003623229.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=770

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA +V D M +R     +  Y  +I  LC    VD AL  L  M + G  P   T+  ++
Sbjct  322  DAIKVLDLMVKRGEEPNNVTYNAIINGLCKEGRVDDALGILETMAKKGKKPDVVTYSTLV  381

Query  640  RALCADGKVDGALSVLS-LMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            + LC  GK+D A+ +L+ LM +          +N++I+EL +Q R   A+ VY   ++RG
Sbjct  382  KGLCGVGKIDEAVDLLNLLMSKEFHIKPDVFAFNLVIQELCKQRRLRHAKRVYYTMVERG  441

Query  463  L  461
             
Sbjct  442  F  442



>ref|NP_001064949.1| Os10g0495200 [Oryza sativa Japonica Group]
 gb|ABB47822.1| Rf1 protein, mitochondrial precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26863.1| Os10g0495200 [Oryza sativa Japonica Group]
 gb|AIC74552.1| PPR protein PPR9-782-ZH [Oryza sativa Japonica Group]
Length=782

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  279

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y+ L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYSSLMNYLCKNGRSTEARKIFDSMTKRGL  337



>emb|CDP12725.1| unnamed protein product [Coffea canephora]
Length=767

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = -2

Query  841  MNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  662
            + +  L +A  +FD M+      +   Y +++  LC G + D A     +M+R   SP +
Sbjct  311  LQQHSLNNALRLFDIMKGNGCQPDEWTYAILVSGLCKGGKFDLASTLFEDMIRKHLSPNQ  370

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
              +  +I  LC DGKVD AL++L  M + S        YN ++  L++ G   +A+ ++ 
Sbjct  371  VNYTTLIDGLCKDGKVDAALALLKRM-QGSGCNPAIETYNAVLNGLSKSGMLSEAKKLHD  429

Query  481  AALKRGLL  458
              L+ GLL
Sbjct  430  KLLESGLL  437


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 60/129 (47%), Gaps = 10/129 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AYEVFDRM +  I      Y  +I  LC+   VD+ L  L EM+  G  P  +T+  
Sbjct  106  LDKAYEVFDRMLKDGIDPNSVTYSTLINGLCDEGRVDEVLDMLDEMIEKGVEPTVYTYTV  165

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
             +  LC  G+   A+ ++S M +R     G  P    Y  LI  L   G+   A  +Y  
Sbjct  166  PLNVLCDVGRAKDAIGLMSTMMKR-----GCKPNAQNYTALISGLAVVGQLELAIGLYHR  220

Query  478  ALKRGLLVP  452
             LK G LVP
Sbjct  221  MLKEG-LVP  228



>ref|XP_003620179.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES76397.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=517

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            ++ +A E+   M  ++I+     Y  +I+ LC   ++  AL  + EM   G  P   T+ 
Sbjct  262  MMDEAMELLKEMHHKQIIPNVVTYSSLIDGLCKSGKISYALKLVDEMHDRGQPPNIVTYS  321

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYA  482
            +++ ALC + +VD A+++L+ M  +     G  P    Y ILIK L + G+  DAR V+ 
Sbjct  322  SILDALCKNHQVDNAIALLTQMKNQ-----GIQPNMYTYTILIKGLCQSGKLEDARKVFE  376

Query  481  AALKRG  464
              L +G
Sbjct  377  DLLVKG  382



>ref|XP_011468486.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial, partial [Fragaria vesca subsp. vesca]
Length=506

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (48%), Gaps = 7/143 (5%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M E+  +V+  AY   +EALC G  VD+A     EM   G  P   T+   I
Sbjct  237  NARKLFDEMTEKGCLVDVPAYNSYLEALCKGGNVDEAYKIFREMGSKGVEPDAGTYSIFI  296

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +    SVL  M +R         YN +IK+L +  R  +A  +    ++ G+
Sbjct  297  RAYCEANDIHSVFSVLDRM-KRYNLLANVFTYNCVIKKLCKNERVEEAYQLLDEMIEMGV  355

Query  460  LVPRKKPIQFSAKA-QAPHIANG  395
                 KP ++S  A QA H  +G
Sbjct  356  -----KPDEWSYNAIQAYHCEHG  373


 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 64/123 (52%), Gaps = 3/123 (2%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +   + V DRM+   ++     Y  VI+ LC  + V++A   L EM+ +G  P  +++ N
Sbjct  305  IHSVFSVLDRMKRYNLLANVFTYNCVIKKLCKNERVEEAYQLLDEMIEMGVKPDEWSY-N  363

Query  646  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             I+A  C  G+V+ AL +LS M + S        YN+++K L R GR   A +V+    K
Sbjct  364  AIQAYHCEHGEVNQALRLLSRMEKDSCM-PDHHTYNMVLKLLIRIGRFDRATDVWERMGK  422

Query  469  RGL  461
            RG 
Sbjct  423  RGF  425



>ref|XP_011009113.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Populus euphratica]
Length=720

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++F+RM+   I+ +  +Y  +I  LC  K ++KA+  LVEM      P  FT+C ++ 
Sbjct  155  ALDLFNRMKRINILPDTVSYNTIINGLCKEKRLEKAVDLLVEMEGSNCEPNSFTYCILMD  214

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             LC +G+V+ A+ +L  M +R    V    Y+ LI     QG     + ++   L+RG+
Sbjct  215  GLCKEGRVEEAMRLLGEM-KRKELEVDVVVYSTLISGFCSQGCLDRGKALFDEMLERGI  272


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIG--YSPGR  662
            E  + DA+++F+ M E++   E  +Y  +I  LCN  ++D+A+     ++  G    P  
Sbjct  359  EGCIGDAFKIFETMLEKRKRPEVVSYNTLIMGLCNNGKLDEAMKLFSSLLEDGNYVEPDV  418

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             TF  VI+ LC +G++D A+ +   M  R      F  + ILI E  + G    A  ++ 
Sbjct  419  ITFNTVIQGLCKEGRLDKAVEIYDTMTERGGLGNLFTCH-ILIGEYIKAGIIDKAMELWK  477

Query  481  AALKRGLLVP  452
               K G LVP
Sbjct  478  RVHKLG-LVP  486


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 54/123 (44%), Gaps = 6/123 (5%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            +FD M ER I      Y  +I   C      +A A L  M   G  P  +T+  +I  LC
Sbjct  263  LFDEMLERGISPNVVVYSCLINGFCKKGLWREATAVLHAMTERGIQPDVYTYTCMIGGLC  322

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  449
             DG+   AL +  LM  +         YN+LI  L ++G   DA  ++   L++     R
Sbjct  323  KDGRARKALDLFDLMTEKGE-EPSTVTYNVLINGLCKEGCIGDAFKIFETMLEK-----R  376

Query  448  KKP  440
            K+P
Sbjct  377  KRP  379



>ref|XP_007139919.1| hypothetical protein PHAVU_008G069700g [Phaseolus vulgaris]
 gb|ESW11913.1| hypothetical protein PHAVU_008G069700g [Phaseolus vulgaris]
Length=524

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 2/123 (2%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            + A E+  +M    I      Y +V++ LC    V +A     EMV  G+    FT+ ++
Sbjct  176  KGAIELLRKMDSVGIRPNLIMYNMVVDGLCKEGHVTEACGLCSEMVGKGFCIDVFTYNSL  235

Query  643  IRALCADGKVDGALSVLS--LMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
            I  LC  G+  GA+ +L+  +M      W     +NIL+  L + G   +ARNV+   +K
Sbjct  236  IHGLCGAGQFQGAVRLLNEMVMQENKDIWPDVYTFNILVDGLCKLGMVAEARNVFGVMIK  295

Query  469  RGL  461
            RGL
Sbjct  296  RGL  298



>gb|EEE68328.1| hypothetical protein OsJ_26607 [Oryza sativa Japonica Group]
Length=461

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 9/123 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M ER I+ +   Y  ++ ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  225  AYSTYHEMLERGILPDVVTYNTIVAALCKAQAMDKAMDVLNRMVKNGVMPDCITYNSIVH  284

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
              C+ G+   A+ +L  M        G  P    Y  L+  L + GR ++AR +  + +K
Sbjct  285  GYCSSGQSKEAIGILEKMCSD-----GVEPDAVTYTSLMDYLCKNGRCIEARKILDSMIK  339

Query  469  RGL  461
            RGL
Sbjct  340  RGL  342



>ref|NP_001061364.1| Os08g0248400 [Oryza sativa Japonica Group]
 dbj|BAF23278.1| Os08g0248400, partial [Oryza sativa Japonica Group]
Length=440

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 9/123 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M ER I+ +   Y  ++ ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  225  AYSTYHEMLERGILPDVVTYNTIVAALCKAQAMDKAMDVLNRMVKNGVMPDCITYNSIVH  284

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
              C+ G+   A+ +L  M        G  P    Y  L+  L + GR ++AR +  + +K
Sbjct  285  GYCSSGQSKEAIGILEKMCSD-----GVEPDAVTYTSLMDYLCKNGRCIEARKILDSMIK  339

Query  469  RGL  461
            RGL
Sbjct  340  RGL  342



>gb|KGN60996.1| hypothetical protein Csa_2G034490 [Cucumis sativus]
Length=153

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 61/126 (48%), Gaps = 1/126 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +   + + M+ R +  +   Y ++I A C  KE  KA   + EM+  G  P   T+  
Sbjct  1    MEEVKNLLNEMQCRGVKADTVTYNILISAWCEKKEPKKAARLIDEMLDKGLKPSHLTYNI  60

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C +G +  AL++   M +  R W     YN+LI+   R+G+  DA  +    L++
Sbjct  61   LLNGYCMEGNLRAALNLRKQMEKEGR-WANVVTYNVLIQGYCRKGKLEDANGLLNEMLEK  119

Query  466  GLLVPR  449
            GL+  R
Sbjct  120  GLIPNR  125



>ref|XP_001777347.1| predicted protein [Physcomitrella patens]
 gb|EDQ57877.1| predicted protein [Physcomitrella patens]
Length=621

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 9/128 (7%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L DA  +FDRM+ +    +   Y  +I AL     V+ A     EM  +G  P  FT+C
Sbjct  339  LLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYC  398

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYA  482
            ++I  L   G+VD A  + S M  +     G  P    YN  +  L R GR  +AR ++ 
Sbjct  399  SIITVLGKAGQVDDADRLFSEMRGK-----GLSPDVITYNAFLNSLGRGGRFKEARKIFE  453

Query  481  AALKRGLL  458
               + GLL
Sbjct  454  DMKESGLL  461


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
             ++A ++F+ M+E  ++ +   Y+ ++  L   KEVD A   L E++  G +     F  
Sbjct  445  FKEARKIFEDMKESGLLPDVATYDALLLGLSKTKEVDDACGLLKELIEQGCAFDSLKFDE  504

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNV  488
             +  L + G VD A  +L   + +   W G   YN LI  L + GR  +A N 
Sbjct  505  CLEILTSWGNVDEAHELLQFANSKG-LWPGASSYNALIDALAKAGRVSEAFNT  556



>ref|XP_010476252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=621

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E+   M ERK+ ++   Y ++I+ LC  K +D AL    EM   G+     T+  +I+
Sbjct  248  AMELLRNMEERKMKLDAAKYNILIDGLCKDKNLDDALNLFNEMEVKGFKADVITYTTLIK  307

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C DG+ D    +L  M  R R       +N+LI    ++G+ L+A  ++   ++RG+
Sbjct  308  GFCNDGRWDDGAQLLRDMITR-RITPNVVTFNVLIDSFVKEGKLLEAEALHNEMIRRGI  365


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/121 (24%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            D +E+F +M  R +V     Y  +++      +++ A     EMV  G  P   T+  ++
Sbjct  422  DGFELFRKMSLRGVVANTVTYNTLVQGFRQSGKLEVAKELFQEMVFRGVHPDIVTYSILL  481

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              LC +G+++ AL +   + ++S+  +    YNI+I  +   G+  DA +++++   RG+
Sbjct  482  DGLCDNGEIEKALEIFEKI-QKSKMELDIGIYNIIIHGMCNDGKVDDAWDLFSSLPLRGV  540

Query  460  L  458
            +
Sbjct  541  M  541



>ref|XP_003527866.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Glycine max]
Length=603

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++A EV DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  225  LKEAMEVLDRQMQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  284

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  285  LINGICKEGRLDEAIKFLNNMP-----LYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  339

Query  478  ALKRG  464
             L++G
Sbjct  340  MLRKG  344


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +V ++M +   +    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  368  AIDVLEKMPKHGCMPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  427

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGK D A+ +L+ +  +    V    YN +I  L + G+   A  +     ++GL
Sbjct  428  ALCKDGKADAAVEILNQLSSKGCSPV-LITYNTVIDGLTKVGKTEYAAELLEEMRRKGL  485



>gb|KHN09027.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=513

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++A EV DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  135  LKEAMEVLDRQMQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  194

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  195  LINGICKEGRLDEAIKFLNNMP-----LYGCQPNVITHNIILRSMCSTGRWMDAERLLAD  249

Query  478  ALKRG  464
             L++G
Sbjct  250  MLRKG  254


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +V ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  278  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  337

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGK D A+ +L+ +  +    V    YN +I  L + G+   A  +     ++GL
Sbjct  338  ALCKDGKADAAVEILNQLSSKGCSPV-LITYNTVIDGLTKVGKTEYAAELLEEMRRKGL  395



>ref|XP_002967156.1| hypothetical protein SELMODRAFT_144844 [Selaginella moellendorffii]
 gb|EFJ31755.1| hypothetical protein SELMODRAFT_144844 [Selaginella moellendorffii]
Length=651

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 58/118 (49%), Gaps = 9/118 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY++ + M E+  V     + ++I  LC    V +A   L +MV  G SP   T+  
Sbjct  200  LDSAYKLLEVMIEKGCVPNVFTFTILITGLCKANRVGEAQQLLEKMVTGGCSPNVVTYST  259

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVY  485
            VI  LC  G+VD A  +  LM RR+      PP    +NILI  L +  R  +AR +Y
Sbjct  260  VINGLCKQGQVDDAYELFQLMERRN-----CPPNVVTHNILIDGLCKAKRIEEARQLY  312



>ref|XP_009802358.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802362.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802363.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
 ref|XP_009802364.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Nicotiana sylvestris]
Length=548

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER   V+  AY  ++E++C   ++D+A    ++M  +G  P  FT+   I
Sbjct  249  EAQKLFDEMLERGFSVDLLAYNSILESVCKAGKMDEAYNLFMKMRSMGLRPDAFTYAVFI  308

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             A C    +  A  VL  M +R +       YN++IK+L +  +  DA  +    ++RG+
Sbjct  309  HAYCVKDDIHAAFRVLDRM-KRYKLVPNVFTYNVIIKKLCKSDKVEDAYQLIDEMIERGV  367



>gb|KJB45449.1| hypothetical protein B456_007G306300 [Gossypium raimondii]
Length=589

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            ++ + M  + + V    Y ++++ALCN  E  KA   L EMV++G  P + T+  ++   
Sbjct  441  KLINEMLNKGLKVNVVTYNILVDALCNDGESRKAARLLDEMVKMGLRPNQITYNTLMDGY  500

Query  631  CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVP  452
            C +G +  AL+V + M +          YN+LIK L ++G+  DA  +    L++GL+  
Sbjct  501  CREGNLRAALNVRTRMEKEG-MLANVVTYNVLIKGLCKKGKLEDANGLLNEMLEKGLIPN  559

Query  451  R  449
            R
Sbjct  560  R  560



>ref|XP_010530459.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62590-like 
[Tarenaya hassleriana]
Length=371

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +  +M ER I V    Y  +I+ LC G ++D AL    +M   G +P   T+  +I 
Sbjct  245  ALNLLMKMEERNIEVNVIMYNTIIDGLCKGGQIDDALNLFEKMDSKGIAPNVVTYSCLIN  304

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
             LC   + + A+ +L+ M +R + +     +NILI    ++G+ L+A+ +Y   ++RGL 
Sbjct  305  GLCVFDRWNDAVRLLNDMAKR-KIFPNVVTFNILIDVFVKEGKFLEAKELYEDMIRRGLF  363



>gb|AIC74547.1| PPR protein PPR7-458-ZH [Oryza sativa Japonica Group]
Length=458

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLDRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  282

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  340



>gb|EMT29222.1| hypothetical protein F775_16585 [Aegilops tauschii]
Length=502

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 2/121 (2%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            + D M+++ +  +   Y  +I ALC   EV KA+  L EM+ +G  P   T+ N+I   C
Sbjct  303  LLDEMKDKGVRADIVTYNTLIGALCCKGEVRKAVKLLDEMLMVGLEPEHRTYNNIINGYC  362

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVPR  449
              G +  A  + + M  + R       YN+ IK L+R G+  +A  +    L++G LVP 
Sbjct  363  EKGNIKSAYEIRARME-KGRKRANVVTYNVFIKHLSRMGKMEEANELLNEMLEKG-LVPN  420

Query  448  K  446
            K
Sbjct  421  K  421



>ref|XP_007141297.1| hypothetical protein PHAVU_008G184000g [Phaseolus vulgaris]
 gb|ESW13291.1| hypothetical protein PHAVU_008G184000g [Phaseolus vulgaris]
Length=622

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 60/123 (49%), Gaps = 1/123 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            +L  A  V + M +       R+Y  +IE  CN K VD+A+  L  MV  G  P   T+ 
Sbjct  335  LLGKALNVLEMMPKHGCTPNSRSYNPLIEGFCNEKSVDRAIEYLEIMVSRGCYPDIVTYN  394

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             ++ ALC DGKVD A+ +L+ +     F      YNI+I  L   G+   A  ++    +
Sbjct  395  ILLTALCKDGKVDDAVEILNQLSFEG-FLSSLITYNIVIDRLLTVGKTEPAVELFEEMSR  453

Query  469  RGL  461
            +GL
Sbjct  454  KGL  456


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 63/124 (51%), Gaps = 7/124 (6%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV D   + K   +   Y  +I+A C    V +++  L+EM+  G  P   T+  
Sbjct  196  LKQAMEVPDIELQSKCYPDVVTYTELIDATCKENGVGQSMKLLIEMMSKGCKPNVVTYNV  255

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAAA  476
            +I+ +C +G++D A+  L+    + R +   P    + I++  L   GR +DA  + A+ 
Sbjct  256  LIKGICNEGRLDEAIRFLN----KLRSYGCNPDVISHTIILHSLCSGGRWMDAMKLLASM  311

Query  475  LKRG  464
            L++G
Sbjct  312  LRKG  315



>ref|NP_001176222.1| Os10g0495400 [Oryza sativa Japonica Group]
 dbj|BAH94950.1| Os10g0495400, partial [Oryza sativa Japonica Group]
Length=438

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLDRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  282

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  340



>ref|XP_010431726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g64100-like 
[Camelina sativa]
Length=630

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (50%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A  +FD M E ++      +  ++  LC+   V +A+A L  M+ IG+ P   T+  
Sbjct  167  VSEAVALFDHMVETRLTPNVVTFTTLMNGLCHDGRVLEAVALLGRMLAIGHEPNAVTYRT  226

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++  +C  G  D AL++L  M   S     F  YN +I  L + G   DA+N++   L++
Sbjct  227  IVNGMCKMGDTDSALNLLRKMD-DSHIKANFLLYNPIIDRLCKDGHHSDAQNLFTEMLEK  285

Query  466  GLL  458
            G  
Sbjct  286  GFF  288



>ref|XP_002960858.1| hypothetical protein SELMODRAFT_75631 [Selaginella moellendorffii]
 gb|EFJ38397.1| hypothetical protein SELMODRAFT_75631 [Selaginella moellendorffii]
Length=699

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 58/118 (49%), Gaps = 9/118 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY++ + M E+  V     + ++I  LC    V +A   L +MV  G SP   T+  
Sbjct  248  LDSAYKLLEVMIEKGCVPNVFTFTILITGLCKANRVGEAQQLLEKMVMGGCSPNVVTYST  307

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVY  485
            VI  LC  G+VD A  +  LM RR+      PP    +NILI  L +  R  +AR +Y
Sbjct  308  VINGLCKQGQVDDAYELFQLMERRN-----CPPNVVTHNILIDGLCKAKRIEEARQLY  360



>gb|AAM92824.1| putative chloroplast RNA processing protein [Oryza sativa Japonica 
Group]
Length=878

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R I+ +   Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  220  AYSTYHEMLDRGILPDVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  279

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y+ L+  L + GR+ +AR ++ +  KRGL
Sbjct  280  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYSSLMNYLCKNGRSTEARKIFDSMTKRGL  337



>ref|XP_004296143.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Fragaria vesca subsp. vesca]
Length=262

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 62/117 (53%), Gaps = 1/117 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++   M ER    +  +Y  +I++L  G  +D+AL    EM+R G +P   T+ ++I+
Sbjct  75   AIQLLTNMEERGFNPDTVSYSTIIDSLAKGTLIDEALKLFAEMIRRGIAPDVVTYTSLIQ  134

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
             LC  G+   A  +L+ M  +S F      +N+L+  L + G+ ++A++V     +R
Sbjct  135  GLCDIGRCKQATRLLNYMVSQSVFP-DLVTFNVLVDTLCKDGKVVEAQSVIEIMFQR  190



>ref|XP_008809556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Phoenix dactylifera]
Length=902

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A  + D M+E     +   Y  ++   C G ++D A  +  EM+  G SP   ++  
Sbjct  446  LNNAIRMLDHMKENGHEPDEWTYTELVNGFCKGGKLDMAHKTFEEMLECGLSPNEVSYTA  505

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I   C DGK+D AL++L+ M  +S        YN +I   +R+ +  +A  +++  +++
Sbjct  506  LIDGYCKDGKLDNALALLNRM-EKSSCKPNVRTYNAIINGFSRKNQLSEAEKLFSEMVEQ  564

Query  466  GLL  458
            GLL
Sbjct  565  GLL  567



>ref|XP_009596549.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596550.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596551.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596552.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
 ref|XP_009596553.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana tomentosiformis]
Length=777

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+ V  +M E+ +  +   Y  +I+ LC  + + +A     EM+R+G  P +FT+  
Sbjct  488  LERAFCVKQQMVEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTT  547

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDAR  494
            +I A C +G + GAL++   M  +  F+     Y++LI  LN+Q R  +A+
Sbjct  548  LIGAYCVEGDIKGALNLHDEMINKG-FFPDAVTYSVLINGLNKQARTREAK  597


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E +D M +  +      Y ++I  LC   +++K LA   EM + G  P   T+  +I 
Sbjct  211  AQEFYDDMVKSGVSPNVYTYNIMIRGLCGKGDLEKGLAFFKEMEKCGCLPSVVTYNTIIG  270

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            A C  GKVD A+ +L LM  R+        YN +I  L R+GR  +   V       GL+
Sbjct  271  AYCKIGKVDEAVKLLKLMQVRN-LEPSVVTYNAIINGLCREGRMKETSEVLEDMRGTGLV  329



>dbj|BAQ15370.1| pentatricopeptide repeat-containing protein [Oryza sativa Indica 
Group]
Length=782

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 1/125 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  L  AY  +  M +R I      Y  +I ALC  + +DKA+  L  MV+ G  P   T
Sbjct  214  EGDLDKAYSTYHEMLDRGISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMT  273

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            + +++   C+ G+   A+  L  M R          Y  L+  L + GR+ +AR ++ + 
Sbjct  274  YNSILHGYCSSGQPKEAIGTLKKM-RSDGVEPNVFTYRSLMNYLCKNGRSTEARKIFDSM  332

Query  475  LKRGL  461
             KRGL
Sbjct  333  TKRGL  337



>ref|XP_010475835.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Camelina sativa]
Length=608

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 66/123 (54%), Gaps = 1/123 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++FD++  + +  +   Y +++E  C+  E  KA   L EM ++G  P   T+  +++
Sbjct  457  AKKLFDQLTSKGLP-DLVTYHILMEGYCSKGETRKAAMLLKEMSKMGLKPRHLTYNILMK  515

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
              C +G +  A ++ + M +  R W+    YN+L++  +++G+  DA  +    L++GL+
Sbjct  516  GYCREGNLKAATNLRTQMEKERRLWINVASYNVLLQGYSQKGKLEDANILLNEMLEKGLV  575

Query  457  VPR  449
              R
Sbjct  576  PNR  578



>ref|XP_002871729.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47988.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=504

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + DA  +FDRM E         Y  +I+ LC  K+VD AL  L  M   G  P   T+ +
Sbjct  167  IYDALYMFDRMVEMGYEPNVVIYNTIIDGLCKSKQVDNALDLLNRMEVDGIRPDAVTYNS  226

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC  G+ D A  ++S M +R  +   F  +N LI    ++GR  +A  +Y   ++R
Sbjct  227  LISGLCNSGRWDDATRMVSCMTKREIYPDVF-TFNALIDACVKEGRISEAEELYEEMIRR  285

Query  466  GL  461
             L
Sbjct  286  SL  287


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            ++F  M +R +V     Y ++I+  C   +++ A      MV  G  P   T+  ++  L
Sbjct  347  KLFCEMSQRGVVRNTVTYTVLIQGYCRAGKLNVAEEIFKWMVFCGVPPNIITYNVLLHGL  406

Query  631  CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            C +GK++ AL +L+ M ++S        YNI+I+ + + G   DA ++Y +   +GL
Sbjct  407  CDNGKIEKALVILADM-QKSGMDADIVTYNIIIRGMCKAGEVADAWDLYCSLNLKGL  462



>gb|KFK30719.1| hypothetical protein AALP_AA6G018600 [Arabis alpina]
Length=472

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 13/126 (10%)
 Frame = -2

Query  841  MNEWVLRD----AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  674
            M  +VL D    AY++F +M ER +V +  +Y ++I+  C   +V+ A+  L +M+  G+
Sbjct  202  MQAFVLNDDLSIAYQLFGKMLERDVVPDIESYRILIQGFCRKGQVNGAMELLDDMLNKGF  261

Query  673  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRA  506
             P R ++  ++ +LC   ++  A  VL  M  +     G  P    YN +I    R+G  
Sbjct  262  VPDRLSYTTLLNSLCRKTQLREAYKVLCRMKLK-----GCNPDLVHYNTIILGFVREGHG  316

Query  505  LDARNV  488
            +DAR V
Sbjct  317  MDARKV  322



>ref|XP_009117967.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g22470, mitochondrial-like [Brassica rapa]
Length=638

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A+++  +M +RKI  +   Y ++I++LC  + +D AL+   EM   G  P  FT+ ++I 
Sbjct  236  AFDLLTKMEDRKIKPQVVIYNMIIDSLCKDESLDDALSLFSEMETKGIKPNVFTYTSLIG  295

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C  G+ D    +L  M  R         +N LI    ++G+  +A+ +Y   + RG+
Sbjct  296  GFCNAGRWDDGAQLLRDMITRD-ITPDVVTFNALIDSFVKEGKLTEAQELYNEMITRGI  353



>ref|XP_004492691.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X1 [Cicer arietinum]
 ref|XP_004492692.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X2 [Cicer arietinum]
Length=538

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            R A E+F +M+   +      Y  VI+ LC   +VD+A     EMV  G     +++ ++
Sbjct  190  RVAIELFPKMKTLSVYPNLIMYNTVIDGLCKQGDVDEACGLCSEMVANGIGLDVYSYNSL  249

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            I   C+ G+   A  +L  M  R   +     +NILI  L + G   +A NV A  +KRG
Sbjct  250  IHGFCSVGRFGSAAKLLDEMAVRGNVYPDVYTFNILIDGLCKLGMVTEAHNVVAVMIKRG  309

Query  463  L  461
            L
Sbjct  310  L  310



>gb|KHN08231.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=471

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++A EV DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  93   LKEAMEVLDRQLQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  152

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + + 
Sbjct  153  LINGICKEGRLDEAIKFLNNMPS-----YGCKPNVITHNIILRSMCSTGRWMDAERLLSD  207

Query  478  ALKRG  464
             L++G
Sbjct  208  MLRKG  212


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +V ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  236  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  295

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGKVD A+ +L+ +  +    V    YN +I  L + G+   A  +     ++GL
Sbjct  296  ALCKDGKVDAAVEILNQLSSKGCSPV-LITYNTVIDGLTKVGKTEYAVELLEEMRRKGL  353



>gb|EYU42661.1| hypothetical protein MIMGU_mgv1a020055mg [Erythranthe guttata]
Length=730

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (52%), Gaps = 1/116 (1%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            V+D M +  +      Y ++I  LC+ KE+D+ L    +M + G  P   T+  +I A C
Sbjct  218  VYDEMMDNDVSPNVFTYNILIRGLCSNKEMDRGLVLFEKMEKKGCLPNVVTYNTLIDAYC  277

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              GK+D A ++L LM  ++        YN++I  L R+GR  + + V+    ++GL
Sbjct  278  KMGKIDEAYALLKLMWEKN-MEPNVITYNVIINGLCREGRMEETKKVFEEMKEQGL  332



>ref|XP_004515689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Cicer arietinum]
Length=550

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 9/123 (7%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A  +F  M+ RKIV +   Y  +I++LC    +  AL  + EM   G  P  +T+ +++
Sbjct  361  EAMNLFKEMQSRKIVPDVVTYSSLIDSLCKSGRITYALELVCEMHDRGQPPNIYTYSSIL  420

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAAL  473
             ALC    VD A+++L   +      +G  P    YNIL+  L + GR  D++ ++   L
Sbjct  421  DALCKSHDVDKAIALLKKFND-----LGIQPDMCTYNILLNGLCKSGRIKDSQKIFEYLL  475

Query  472  KRG  464
             +G
Sbjct  476  VKG  478



>ref|XP_007023868.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY26490.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=520

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 7/122 (6%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A+ V DRMR   +V     Y  +I  LCN  +VD+A   L EM+  G SP  +++  ++ 
Sbjct  303  AFRVLDRMRRYNLVPNLFTYNCIIRKLCNNDKVDEAYQLLTEMIERGISPDEWSYNAILA  362

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAAALKR  467
              C   +V+ AL+++S M +       FP    YN+ +K L R GR   A  ++ +   R
Sbjct  363  YHCEHSEVNRALNLISRMEKNE----CFPDRHTYNMALKLLIRIGRFDRATELWESMANR  418

Query  466  GL  461
            G 
Sbjct  419  GF  420



>gb|AAM92820.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54427.1| Rf1 protein, mitochondrial precursor, putative [Oryza sativa 
Japonica Group]
Length=517

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  360  AYSTYHEMLDRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  419

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  420  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  477



>ref|XP_011014424.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Populus euphratica]
Length=720

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++F+RM+   I+ +  +Y  +I  LC  K ++KA+  LVEM      P  FT+C ++ 
Sbjct  155  ALDLFNRMKRINILPDIVSYNTIINGLCKEKRLEKAVDLLVEMEGSNCEPNSFTYCILMD  214

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             LC +G+V+ A+ +L  M +R    V    Y+ LI     QG     + ++   L++G+
Sbjct  215  GLCKEGRVEEAMRLLGEM-KRKELEVDVVVYSTLISGFCSQGCLDRGKALFDEMLEKGI  272


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIG--YSPGR  662
            E  + DA+++F+ M E++   E  +Y  +I  LCN  ++D+A+     ++  G    P  
Sbjct  359  EGCIGDAFKIFETMLEKRKRPEVVSYNTLIMGLCNNGKLDEAMKLFSSLLEDGNYVEPDV  418

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             TF  VI+ LC +G++D A+ +   M  R      F  + ILI E  + G    A  ++ 
Sbjct  419  ITFNTVIQGLCKEGRLDKAVEIYDTMIERGGLGNLFTCH-ILIGEYIKAGIIDKAMELWK  477

Query  481  AALKRGLLVP  452
               K G LVP
Sbjct  478  RVHKLG-LVP  486



>ref|XP_003523769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Glycine max]
Length=602

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (53%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++A EV DR  +R+   +   Y ++IEA CN   V +A+  L EM + G  P   T+  
Sbjct  224  LKEAMEVLDRQLQRECYPDVITYTILIEATCNDSGVGQAMKLLDEMRKKGCKPDVVTYNV  283

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + + 
Sbjct  284  LINGICKEGRLDEAIKFLNNMPS-----YGCKPNVITHNIILRSMCSTGRWMDAERLLSD  338

Query  478  ALKRG  464
             L++G
Sbjct  339  MLRKG  343


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +V ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  367  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  426

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGKVD A+ +L+ +  +    V    YN +I  L + G+   A  +     ++GL
Sbjct  427  ALCKDGKVDAAVEILNQLSSKGCSPV-LITYNTVIDGLTKVGKTEYAVELLEEMRRKGL  484



>ref|XP_003630734.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AET05210.1| PPR containing plant-like protein [Medicago truncatula]
Length=520

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 65/138 (47%), Gaps = 7/138 (5%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E+FD M E+   V+  AY  ++EALC G  VD+A+  L +M+     P  FT+   IR
Sbjct  232  ARELFDAMLEQGCHVDLLAYNNLLEALCKGGHVDEAMDFLNDMLSKKVEPDAFTYSIFIR  291

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            + C    V  A  VL  M RR         YN +IK L +  +  +A  +    +  GL 
Sbjct  292  SYCDANNVHSAFGVLDKM-RRCNLLPNVFTYNCIIKRLCKIKKVEEAYQLLDEMISSGL-  349

Query  457  VPRKKPIQFSAKA-QAPH  407
                KP  +S  A QA H
Sbjct  350  ----KPDTWSYNAIQAYH  363



>ref|XP_007137661.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris]
 gb|ESW09655.1| hypothetical protein PHAVU_009G145100g [Phaseolus vulgaris]
Length=600

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++A EV DR  +R+   +   Y ++IEA CN   V +A+  L EM   G  P   T+  
Sbjct  222  LKEAMEVLDRQLQRECYPDVITYTILIEATCNESGVGQAMKLLDEMRNKGCKPDVVTYNV  281

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  282  LINGICKEGRLDEAIKFLNSMPS-----YGCQPNVITHNIILRSMCSTGRWMDAERLLAD  336

Query  478  ALKRG  464
             L++G
Sbjct  337  MLRKG  341


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +V ++M +   V    +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  365  AIDVLEKMPKHGCVPNSLSYNPLLHGFCQEKKMDRAIEYLEIMVSRGCYPDIVTYNTLLT  424

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGKVD A+ +L+ +  +    V    YN +I  L + G+   A  +     ++GL
Sbjct  425  ALCKDGKVDAAIEILNQLSSKGCSPV-LVTYNTVIDGLAKVGKTESAVELLEEMRRKGL  482



>gb|KCW88273.1| hypothetical protein EUGRSUZ_A00652 [Eucalyptus grandis]
Length=447

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 64/129 (50%), Gaps = 1/129 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  +  A ++F  M++  +      Y ++I +LC  +E  KA   L  MV+IG SP   T
Sbjct  292  EGKMDKAEKLFGEMKDNSLKPNVVTYNILIGSLCKKRESRKAHRLLDRMVKIGLSPNHVT  351

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  ++   C +G +  A+ V  LM +          +N+LIK   +QG+  +A ++    
Sbjct  352  YDTLMDGYCTEGNLRAAVKVRELMQKEG-LRANIATFNVLIKGFCKQGKLENANSLLNEM  410

Query  475  LKRGLLVPR  449
            L+RG++  R
Sbjct  411  LERGMVPNR  419



>ref|XP_008806452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Phoenix dactylifera]
Length=447

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 1/126 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +  A ++ D M E  +  +   Y ++I ALC   ++ KA+  L EM  IG  P   T+  
Sbjct  295  MSSATKLLDEMEENDVKADLITYNVLISALCREGKMAKAVKLLDEMQDIGLQPSHVTYNT  354

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC  G +  AL++ + M +  +       YNILIK  + +G+  +A  +    L++
Sbjct  355  LIDGLCKKGNLRAALNIRARMEKGGKH-ANVVTYNILIKYFSGRGKMHEANELLNEMLEK  413

Query  466  GLLVPR  449
            GL+  R
Sbjct  414  GLVPNR  419



>ref|XP_006662452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like, 
partial [Oryza brachyantha]
Length=526

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 5/127 (4%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            +W  R A  + D M+E+ I  +   Y ++I ALC   EV KA+  L EM+++G  P   T
Sbjct  368  DW--RSASGLRDEMKEKGIEADVVTYNVLIGALCGKGEVPKAVKLLDEMLKVGLEPNHLT  425

Query  655  FCNVIRALCADGKVDGALSVLSLMHR-RSRFWVGFPPYNILIKELNRQGRALDARNVYAA  479
            +  +I+  C  G +  A  + + M + R R  V    YN+LIK     G+   A ++   
Sbjct  426  YNTIIQGFCDKGNIKAAYEIRTRMEKFRKRANV--VTYNVLIKYFCSLGKMEQADDLINE  483

Query  478  ALKRGLL  458
             L +GL+
Sbjct  484  MLDKGLV  490


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 53/119 (45%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  VF+ M+++ I      Y ++I  LC    V++ L  + EM  +G  P   TF  V+ 
Sbjct  232  AVRVFEEMKQQGIAASAAIYNVLISGLCGEGRVEEGLKMMKEMEDLGLPPNEITFGRVLN  291

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C  G V  A   +  M  R+        YN+LI    R G+  DA  V  A  K+G+
Sbjct  292  GFCKKGMVANAKDWIDGMVERN-VQPSVVTYNMLIGGYRRLGKMEDAMAVKEAMAKKGI  349



>ref|XP_010417523.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic-like [Camelina sativa]
Length=580

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +++A+ +   +  ++    H  Y+ VI +LC       A   L EM R G+ P   T+ +
Sbjct  408  VQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDSHTYSS  467

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +IR LC +G   GA+ VLS+M    ++      +N +I  L +  R   A  V+   +++
Sbjct  468  LIRGLCLEGMYTGAMEVLSIMEESEKYKPSVDNFNAMILGLCKTRRTDLAMEVFEMMVEK  527



>ref|XP_010472747.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic isoform X1 [Camelina sativa]
 ref|XP_010472748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic isoform X2 [Camelina sativa]
Length=580

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +++A+ +   +  ++    H  Y+ VI +LC       A   L EM R G+ P   T+ +
Sbjct  408  VQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDSHTYSS  467

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +IR LC +G   GA+ VLS+M    ++      +N +I  L +  R   A  V+   +++
Sbjct  468  LIRGLCLEGMYTGAMEVLSIMEESEKYKPSVDNFNAMILGLCKTRRTDLAMEVFEMMVEK  527



>ref|XP_010429780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, 
chloroplastic [Camelina sativa]
Length=580

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +++A+ +   +  ++    H  Y+ VI +LC       A   L EM R G+ P   T+ +
Sbjct  408  VQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDSHTYSS  467

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +IR LC +G   GA+ VLS+M    ++      +N +I  L +  R   A  V+   +++
Sbjct  468  LIRGLCLEGMYTGAMEVLSIMEESEKYKPSVDNFNAMILGLCKTRRTDLAMEVFEMMVEK  527



>ref|XP_011003803.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Populus euphratica]
Length=611

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++  +M ER  +     Y  +I++LC  K + +A+  L EMV  G SP   T+ +++ 
Sbjct  215  AIQLLRKMEERGCMPNVVVYSTIIDSLCKDKLITEAMEFLSEMVNRGISPNVVTYSSILH  274

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C  G+ + A S+   M  R+        +NIL+  L+++G  L+AR V+   +++G+
Sbjct  275  GFCNLGRSNEATSLFKQMVERN-VMPDTVTFNILVDGLSKEGMILEARCVFETMIEKGV  332



>ref|XP_009419261.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=996

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 66/118 (56%), Gaps = 1/118 (1%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            +VFD+M+   I ++  A+ ++I+ALC   ++D+ +  L  M  +G  P R T+  VI+ +
Sbjct  387  QVFDKMKMFGIGLDAYAFTILIKALCREGKLDETVGVLDVMREVGVQPDRITYHTVIQGM  446

Query  631  CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            C +GK D A  +L ++  +S   +    YN +I  L ++ R  +A NV     ++G+L
Sbjct  447  CTNGKPDLAYVLLKVI-TKSGILLDRVAYNKVISRLCKEKRVQEAENVLEDMNRQGIL  503


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 65/118 (55%), Gaps = 1/118 (1%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            +VF++M    I ++  A+ ++I++LC   ++D+ L  L  M ++G  P R T+  VI  +
Sbjct  210  QVFEKMMMLGIDLDAYAFTILIKSLCREGKLDETLGVLDVMRKVGIQPDRITYHTVIEGM  269

Query  631  CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            C +GK D A  +L  + RR    +G   YN +I  L ++ R  +A NV     ++G++
Sbjct  270  CTNGKPDLAYVLLKEITRRG-ILLGRIAYNKVISRLCKEKRVREAENVLEDMTRQGVV  326



>ref|XP_008378619.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV DR  +R+   +   Y ++IEA C    V++A+  L EM   G  P   T+  
Sbjct  235  LKQAMEVLDRQMQRQCYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNV  294

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  +C +G++D A+  L+ M   S        +NI+++ +   GR +DA  + A  + R
Sbjct  295  LINGICKEGRLDEAIKFLNDMPS-SDCQPNVITHNIILRSMCSTGRWMDAEKLLAEMVHR  353

Query  466  G  464
            G
Sbjct  354  G  354


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++ ++M +        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  378  AIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDTMVSRGCYPDIVTYNTLLT  437

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC D KVD A+ +L+ +  +    V    YN +I  L++ G+   A  +     K+GL
Sbjct  438  ALCKDAKVDIAVEILNQLSSKGCSPV-LITYNTVIDGLSKVGKTERALELLHEMRKKGL  495



>ref|XP_004492420.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like 
[Cicer arietinum]
Length=721

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 64/124 (52%), Gaps = 9/124 (7%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA +V D M ++     +  Y ++I  LC    VD A   L  M + G  P   T+  ++
Sbjct  330  DAIKVLDLMVQKGEEPNNITYNVIINGLCKEGRVDDAFKILETMAKKGKKPDVVTYNTLL  389

Query  640  RALCADGKVDGALSVLSLM-----HRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            + LC  GK+D A+ +L+L+     H +   +     +N++I+ L ++ R  DAR VY+  
Sbjct  390  KGLCGVGKIDEAMDLLNLLLSKEFHMKPDVFA----FNLVIQGLCKELRLHDARKVYSTM  445

Query  475  LKRG  464
            +++G
Sbjct  446  VEKG  449



>gb|AIC74548.1| PPR protein PPR8-780-M [Oryza sativa Indica Group]
Length=780

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M +R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  218  AYITYHEMLDRRISPNVATYNSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  277

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR  +AR ++ +  KRGL
Sbjct  278  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTEARKIFDSMTKRGL  335



>ref|XP_010530347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=637

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +  +M E+ I V+ + Y ++I+ LC G  +D AL+   +M   G +P   T+  +I 
Sbjct  246  ALNLLMKMEEKNIEVDVKIYSMIIDGLCKGGHIDDALSLFDKMDSKGIAPNVVTYSCLIN  305

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
             LC   + +  + +L+ M +R + +     +NILI    ++G+ L+A+ +    ++RG L
Sbjct  306  GLCVFDRWNDVVRLLNDMAKR-KIFPNVVTFNILIDAFVKEGKFLEAKELCEEMIRRG-L  363

Query  457  VP  452
            VP
Sbjct  364  VP  365



>ref|XP_012064995.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900 [Jatropha curcas]
Length=914

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A  + D MRER IV     Y ++IE  C      KA   L EMV  G  P  +T+  
Sbjct  525  MAEAIRLLDEMRERNIVPNEVTYNVMIEGYCREGNTVKAFGLLDEMVEKGLVPDTYTYRP  584

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G+   A   +  +H+ +R  V    Y +L+    ++GR  +A N     ++R
Sbjct  585  LISGLCSTGRASEAKEFIDDLHKMNR-KVNEMCYGVLLHGFCKEGRFREALNASREMVER  643

Query  466  GL  461
            G+
Sbjct  644  GV  645



>ref|XP_010921699.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Elaeis guineensis]
Length=531

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 60/121 (50%), Gaps = 2/121 (2%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVR-IGYSPGRFTFCN  647
            + A ++FD M +R  VV+  AY  +I A C G E+D+A   L EM R  G  P   T+  
Sbjct  249  KKALDLFDEMLQRGCVVDAVAYNTLIMAFCRGGEIDEAHRRLQEMQRDHGLKPDAATYSA  308

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
             IRA C    V  A+ VL  M RR      F  YN +IK L  + + ++A  +    L R
Sbjct  309  FIRASCEAKDVHSAMRVLDTMKRRDLSPNVF-TYNAIIKLLCEEEKIVEAYELLDEMLYR  367

Query  466  G  464
            G
Sbjct  368  G  368



>gb|KEH26904.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=389

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A  +F+ M  RKI+ +   Y  +I+ LC   ++  AL  + EM   G  P   T+ +++
Sbjct  200  EAMNLFEEMHCRKIIPDVVTYNSLIDGLCKSGKISYALKLVDEMHDRGVPPDIITYSSIL  259

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAAL  473
             ALC + +VD A+++L+ +  +     G  P    Y ILI  L + GR  DA N++   L
Sbjct  260  DALCKNHQVDKAIALLTNLKDQ-----GIRPNMYTYTILIDGLCKGGRLEDAHNIFEDLL  314

Query  472  KRG  464
             +G
Sbjct  315  VKG  317


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 1/100 (1%)
 Frame = -2

Query  760  YELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLMH  581
            Y  +I+ +C  K V+ A     EMV    SP  FT+  +I   C  GK+  A+ + + M 
Sbjct  45   YNTIIDGMCKDKHVNDAFDLYSEMVSKRISPDVFTYNALISGFCIVGKLKDAIGLFNKMT  104

Query  580  RRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              +        +NIL+    ++G+  +A+NV A  +K+G+
Sbjct  105  LEN-INPDMYTFNILVDAFCKEGKMKEAKNVLAMMMKQGM  143



>ref|XP_010040584.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
 ref|XP_010040641.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
 ref|XP_010040692.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
 ref|XP_010040755.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Eucalyptus grandis]
Length=626

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 64/129 (50%), Gaps = 1/129 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  +  A ++F  M++  +      Y ++I +LC  +E  KA   L  MV+IG SP   T
Sbjct  471  EGKMDKAEKLFGEMKDNSLKPNVVTYNILIGSLCKKRESRKAHRLLDRMVKIGLSPNHVT  530

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  ++   C +G +  A+ V  LM +          +N+LIK   +QG+  +A ++    
Sbjct  531  YDTLMDGYCTEGNLRAAVKVRELMQKEG-LRANIATFNVLIKGFCKQGKLENANSLLNEM  589

Query  475  LKRGLLVPR  449
            L+RG++  R
Sbjct  590  LERGMVPNR  598



>ref|XP_012085339.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial [Jatropha curcas]
 gb|KDP45287.1| hypothetical protein JCGZ_15152 [Jatropha curcas]
Length=897

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++ Y +F ++ +  +V     Y ++++  C   E++ +L  L  M R+G +P  +T+  
Sbjct  564  LKEEYTMFGKILKYGLVPSVVTYTILVDGQCRAGEINSSLNMLELMKRVGCAPNVYTYTI  623

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            VI  LC +G++  A S+LS M     F VG PP    Y  L+K     GR   A N+   
Sbjct  624  VINGLCQNGRIQEAESLLSSM-----FDVGVPPNVITYTTLVKAHANAGRLDCALNIVNT  678

Query  478  ALKRG  464
             +K G
Sbjct  679  MVKNG  683


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A+ + + M  +  +   R Y ++++A+C+   +DKA++ L EMVR G  P  +T+  
Sbjct  284  LEEAFGLKEEMSRKGCLPTTRTYSVLLKAVCDIGLIDKAISLLDEMVRNGCKPNVYTYTA  343

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC +GK++ A  +   M +      G   YN LI    ++GR + A  +     +R
Sbjct  344  LIDGLCREGKIEEANGIFRRMLQDG-LSPGIITYNALINGYCKEGRIVSAFEIIGLMERR  402



>ref|XP_002889775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66034.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=598

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV DRM +R    +   Y ++IEA C    V +A+  L EM   G +P   T+  
Sbjct  220  LKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRDRGCTPDVVTYNV  279

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++  +C +G++D A+  L+ M   S        +NI+++ +   GR +DA  + A  L++
Sbjct  280  LVNGICKEGRLDEAIKFLNDMP-SSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRK  338

Query  466  GL  461
            G 
Sbjct  339  GF  340



>gb|EYU21622.1| hypothetical protein MIMGU_mgv1a019624mg, partial [Erythranthe 
guttata]
Length=510

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER+  V+  A+  V++ALC G +VD+A      M   G  P  +++   I
Sbjct  223  EAQKLFDEMLEREYTVDLLAWNSVLDALCKGGKVDEAYELFQGMRTKGLEPDAYSYSIFI  282

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C++  +  A  VL  M +R         YN +IK L +  +  +A  +    L+RG+
Sbjct  283  RASCSENDIHSAFRVLDSM-KRCNLAPNVFTYNCIIKSLCKNNKIDEAYELLDEMLERGV  341



>ref|XP_006828862.2| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial [Amborella trichopoda]
Length=891

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A+E+   M +RK     R Y  +I+ LC  ++  KA++ L +M+  G  P   T+  +I 
Sbjct  384  AFELLSTMEKRKCKPNTRTYNELIDGLCRERKPYKAMSLLQKMLDNGLFPSNVTYNTLIN  443

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C +GK+D AL + + M R   +  GF  Y +LI  L ++G+   A   +   ++ G+
Sbjct  444  GFCGEGKLDMALCLFNSMSRIGLYPDGF-TYTVLIDGLCKKGQLEQAHEFFNEMVQEGI  501


 Score = 50.8 bits (120),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 60/124 (48%), Gaps = 9/124 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A+++F  M E+        Y ++I+ALC  ++V K++    EMV+ G  P   T+  
Sbjct  276  MEEAFQLFGEMTEKGCEPSVYTYTVLIKALCGIRQVYKSIDLFNEMVKKGCVPNVHTYTV  335

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I   C + K++ A  +L +M  +     G  P    YN LI    ++GR   A  + + 
Sbjct  336  LIDGWCRENKLEEANGLLKMMLEK-----GVLPSTITYNALINGYCKEGRVFSAFELLST  390

Query  478  ALKR  467
              KR
Sbjct  391  MEKR  394



>gb|ERM96278.1| hypothetical protein AMTR_s00001p00165480 [Amborella trichopoda]
Length=903

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A+E+   M +RK     R Y  +I+ LC  ++  KA++ L +M+  G  P   T+  +I 
Sbjct  396  AFELLSTMEKRKCKPNTRTYNELIDGLCRERKPYKAMSLLQKMLDNGLFPSNVTYNTLIN  455

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C +GK+D AL + + M R   +  GF  Y +LI  L ++G+   A   +   ++ G+
Sbjct  456  GFCGEGKLDMALCLFNSMSRIGLYPDGF-TYTVLIDGLCKKGQLEQAHEFFNEMVQEGI  513


 Score = 50.8 bits (120),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 60/124 (48%), Gaps = 9/124 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A+++F  M E+        Y ++I+ALC  ++V K++    EMV+ G  P   T+  
Sbjct  288  MEEAFQLFGEMTEKGCEPSVYTYTVLIKALCGIRQVYKSIDLFNEMVKKGCVPNVHTYTV  347

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I   C + K++ A  +L +M  +     G  P    YN LI    ++GR   A  + + 
Sbjct  348  LIDGWCRENKLEEANGLLKMMLEK-----GVLPSTITYNALINGYCKEGRVFSAFELLST  402

Query  478  ALKR  467
              KR
Sbjct  403  MEKR  406



>ref|XP_010424275.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, 
mitochondrial-like [Camelina sativa]
Length=300

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 59/125 (47%), Gaps = 1/125 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
             W    A E+  +M ER I +    Y ++I++LC  + +D AL+   EM   G      T
Sbjct  163  SWKTALAMELLKKMEERNIKLNVVHYSIIIDSLCKDENLDDALSLFNEMEVKGIKSNIVT  222

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  +IR  C DG+ D    +L  M  R R       +N LI    ++G+ +DA  ++   
Sbjct  223  YNTLIRGFCNDGRWDDGAQLLRDMITR-RITPDVVTFNALIDSFAKEGKLVDAEALHEEM  281

Query  475  LKRGL  461
            + RG+
Sbjct  282  IIRGI  286



>ref|XP_006465352.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Citrus sinensis]
Length=531

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A ++FD M ERK  V+  A+  ++EA+C    +D+A   L EM  IG  P  F++  
Sbjct  241  LSEARKLFDEMLERKCPVDILAHNSLLEAMCKAGNIDEAHGMLREMRSIGAEPDAFSYSI  300

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
             I A C    +     VL  M R +     F  YN +IK+L +  +  +A  +    ++R
Sbjct  301  FIHAFCEANDIHSVFRVLDSMKRYNLVPNVF-TYNCIIKKLCKNEKVEEAYQLLDEMIER  359

Query  466  G  464
            G
Sbjct  360  G  360


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +   + V D M+   +V     Y  +I+ LC  ++V++A   L EM+  G +P  +++  
Sbjct  311  IHSVFRVLDSMKRYNLVPNVFTYNCIIKKLCKNEKVEEAYQLLDEMIERGANPDEWSYNA  370

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C   +V+ AL +++ M  +         YN+++K L R GR   A  V+ +  KR
Sbjct  371  ILAYHCDHAEVNMALRLITRM-TKENVMPDRHTYNMVLKLLVRVGRFDRATEVWESMEKR  429

Query  466  GL  461
            G 
Sbjct  430  GF  431



>ref|XP_010936288.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g74900, mitochondrial [Elaeis guineensis]
Length=517

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 1/125 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  + +VFD M ++  +     Y  +I+ +C    V  A+    EMVR GY+P   T+  
Sbjct  316  LDKSRKVFDEMVDQGCLPSVPTYNALIQVICKKGSVKDAILVFDEMVRKGYTPNAVTYNL  375

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            VIR LC  G++D A+  L  M +R         YNILI+    +G       ++   L R
Sbjct  376  VIRGLCHAGEMDQAMEFLERM-KREECEPNVQTYNILIRYWCEEGEIEKGLQLFGTMLGR  434

Query  466  GLLVP  452
            G  +P
Sbjct  435  GGCLP  439


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (46%), Gaps = 0/109 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            ++DA  VFD M  +        Y LVI  LC+  E+D+A+  L  M R    P   T+  
Sbjct  351  VKDAILVFDEMVRKGYTPNAVTYNLVIRGLCHAGEMDQAMEFLERMKREECEPNVQTYNI  410

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALD  500
            +IR  C +G+++  L +   M  R         YN+LI  +  + R  D
Sbjct  411  LIRYWCEEGEIEKGLQLFGTMLGRGGCLPNLDTYNVLISAMFTRKRPED  459



>ref|XP_009613976.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
[Nicotiana tomentosiformis]
Length=949

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/125 (29%), Positives = 58/125 (46%), Gaps = 9/125 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +FD M     +   R Y  +I   C  K+V KA+A L  M+    SP   TF  ++ 
Sbjct  443  ALAIFDTMESNNCIPNVRTYNELISGFCRTKKVHKAMALLDRMLERKLSPSNVTFNLLVH  502

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
              C +G++D A  +L LM        G  P    Y  L+  L  +GR  +A  ++++  +
Sbjct  503  GQCKEGEIDSAFRLLRLMEEN-----GLAPDDWTYGTLVDGLCERGRVEEANTIFSSLKE  557

Query  469  RGLLV  455
            +G+ V
Sbjct  558  KGIKV  562



>ref|XP_010524658.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial isoform X1 [Tarenaya hassleriana]
 ref|XP_010524659.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial isoform X2 [Tarenaya hassleriana]
Length=882

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A+ + D+MRE+      R Y ++I+ALC+   ++KAL  L EMV  G  P   T+ +
Sbjct  285  LEEAFRLKDQMREKGCQPSTRTYTVLIKALCDKGLIEKALNLLDEMVAGGCKPNAHTYTD  344

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC  GK++ A  + S M +   F      YN LI    + GR + A  +     KR
Sbjct  345  LIDGLCKLGKIEEANGLYSKMVKEGIF-PSVVTYNALINGYCKDGRIIPAIELLGMMEKR  403



>gb|AIC74546.1| PPR protein PPR7-458-Z [Oryza sativa Indica Group]
Length=458

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYSSILH  282

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR   AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  340



>gb|AES89466.2| PPR containing plant-like protein [Medicago truncatula]
Length=889

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A ++FD M ERKI      Y ++IE  C    +DKA   L +M+  G  P  +T+  
Sbjct  514  MAEASKLFDEMVERKIKPTEVTYNVMIEGYCKAHNMDKAFELLEDMLHNGLVPDTYTYRP  573

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+     QGR  +A +     ++R
Sbjct  574  LISGLCSTGRVSAAKDFIDDLHKKN-LKLNEMCYSALLHGYCGQGRLTEALSASCEMIQR  632

Query  466  GL  461
            G+
Sbjct  633  GI  634



>gb|ERN18787.1| hypothetical protein AMTR_s00067p00076830 [Amborella trichopoda]
Length=602

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +  DR+ E         Y ++IEA CN   +D+A+  L EM+     P  FT+  +IR
Sbjct  188  AMKFLDRLLENNCSPTVVTYTILIEATCNIGGIDEAMKLLDEMLARNLHPDMFTYNVIIR  247

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
             +C +GK+D AL +        R  V   P    YNIL++ L  Q R  DA N+ +  + 
Sbjct  248  GMCKEGKLDVALELF-------RTKVNCEPDTISYNILLRALLSQQRWGDAENILSEMIS  300

Query  469  RG  464
             G
Sbjct  301  NG  302



>ref|XP_003619805.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES76023.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=548

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            ++ +A  +F+ MR RKI+     Y  +I+ LC    +  AL  + EM   G  P   T+ 
Sbjct  356  MVDEAINLFEEMRCRKIIPNVVTYSSLIDGLCKLGRIFYALKLVDEMHDRGQPPNIVTYS  415

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYA  482
            +++ ALC +  VD A+++L+ +  +     G  P    Y ILIK L + GR  DA+NV+ 
Sbjct  416  SILDALCKNHHVDKAIALLTNLKDQ-----GIRPDMYTYTILIKGLCQSGRLEDAQNVFE  470

Query  481  AALKRG  464
              L +G
Sbjct  471  DLLVKG  476



>ref|XP_002515077.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF47061.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=262

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 63/114 (55%), Gaps = 9/114 (8%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY++F++M +R ++ +  +Y ++++ LC   +V+ A+  L +M+  G+ P   T+  ++ 
Sbjct  13   AYKLFNQMFKRDVLPDIESYRILMQGLCRRSQVNGAVGLLEDMLNKGFVPDCLTYTTLLN  72

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNV  488
            +LC   K+  A  +L  M  +     G  P    YN +I    R+GRA+DAR V
Sbjct  73   SLCRKKKLREAYKLLCRMKVK-----GCNPDIVHYNTIISGFCREGRAMDARKV  121



>ref|XP_009362528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009362529.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009362534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009362535.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Pyrus x bretschneideri]
Length=525

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 72/160 (45%), Gaps = 16/160 (10%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER  +V+  AY   +EALC G +VD+A     EM   G  P   T+   I
Sbjct  237  EARKLFDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFREMGSNGVEPDACTYSIFI  296

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +     VL  M RR         YN +IK+L +  +  +A  +     +RG+
Sbjct  297  RAYCEVDDIHSVFRVLDRM-RRYNLLPNVYTYNCVIKKLCKNEKVEEAYQLLDEMTERGV  355

Query  460  LVPRKKPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  344
            +     P  +S  A QA H         C+ C  +  LRL
Sbjct  356  M-----PDTWSYNAIQAYH---------CDHCEVNGSLRL  381



>ref|XP_010428258.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, 
mitochondrial [Camelina sativa]
Length=476

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 69/138 (50%), Gaps = 13/138 (9%)
 Frame = -2

Query  841  MNEWVLRD----AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  674
            M+ + L D    AY++F +M ER +V +  +Y+++I+      +V+ A+  L +M+  G+
Sbjct  200  MHAFCLNDDLSIAYQLFGKMLERDVVPDVESYKILIQGFSRKGQVNGAMELLEDMLNKGF  259

Query  673  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRA  506
             P R ++  ++ +LC   ++  A  +L  M  +     G  P    YN +I    R+GRA
Sbjct  260  VPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLK-----GCNPDIVHYNTMILGFCREGRA  314

Query  505  LDARNVYAAALKRGLLVP  452
            +DAR V       G   P
Sbjct  315  MDARKVLDDMSGNGCCAP  332



>ref|XP_003607269.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like 
protein [Medicago truncatula]
Length=970

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 35/122 (29%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A ++FD M ERKI      Y ++IE  C    +DKA   L +M+  G  P  +T+  
Sbjct  514  MAEASKLFDEMVERKIKPTEVTYNVMIEGYCKAHNMDKAFELLEDMLHNGLVPDTYTYRP  573

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+     QGR  +A +     ++R
Sbjct  574  LISGLCSTGRVSAAKDFIDDLHKKN-LKLNEMCYSALLHGYCGQGRLTEALSASCEMIQR  632

Query  466  GL  461
            G+
Sbjct  633  GI  634



>gb|KEH26866.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=403

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 9/122 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +F+ M  RKI+     Y  +I+ LC   ++  AL  + EM   G  P   T+ +++ 
Sbjct  215  AMNLFEEMHCRKIIPNVVTYNSLIDGLCKSGKISYALKLVDEMHDRGQPPDIITYSSLLD  274

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
            ALC +  VD A+++L+ +  +     G  P    Y ILI  L + GR  DA+N++   L 
Sbjct  275  ALCKNHHVDKAIALLTKLKDQ-----GLQPNMYTYTILINGLCKGGRPEDAQNIFEDLLV  329

Query  469  RG  464
            +G
Sbjct  330  KG  331



>ref|XP_012080261.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g74580 [Jatropha curcas]
 ref|XP_012080262.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g74580 [Jatropha curcas]
 gb|KDP31244.1| hypothetical protein JCGZ_11620 [Jatropha curcas]
Length=763

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
             D  E F  M E++ V     Y ++IE+LC  ++V+ AL  + E+   G +P   +F  V
Sbjct  513  EDVMETFKLMMEKRCVPNLITYNILIESLCKARKVNDALDLVEEIRNKGLTPDTVSFGTV  572

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQ  515
            +  LC +G ++GA  V   M ++ +       YNI+I   + Q
Sbjct  573  MSGLCNNGDLEGAYRVFRRMEQQYKVCYSVATYNIMINAFSEQ  615



>ref|XP_008243715.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Prunus mume]
Length=525

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 77/166 (46%), Gaps = 17/166 (10%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER  +V+  AY   +EALC G +VD+A     EM   G  P   T+   I
Sbjct  237  EARKLFDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFREMGSNGTDPDACTYSIFI  296

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +     VL  M +R         YN +IK+L +  +  +A  +    ++ G+
Sbjct  297  RAYCEANDIHSVFRVLDRM-KRYNLLPNVYSYNCIIKKLCKNDKVEEAYQLLDEMIESGV  355

Query  460  LVPRKKPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRLCIHRVK  326
            +     P  +S  A QA H         C+ C  +  LRL ++R+K
Sbjct  356  M-----PDAWSYNAIQAYH---------CDHCEVNRALRL-LYRMK  386



>ref|XP_010908081.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Elaeis guineensis]
 ref|XP_010908082.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Elaeis guineensis]
Length=447

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (48%), Gaps = 1/130 (1%)
 Frame = -2

Query  838  NEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  659
            N   +  A ++ D M E  +  +   Y ++I ALC  ++  KA+  L EM  I   P   
Sbjct  291  NNGDMNSATKLLDEMEENGVKADLITYNVLISALCREQKTAKAVKLLDEMQEISLQPSHV  350

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAA  479
            T+  +I  LC  G +  AL++ + M +  +       YNILIK  +  G+  +A  +   
Sbjct  351  TYNTLIDGLCKKGNLRAALNIRARMEKGGK-HANVVTYNILIKYFSGGGKMDEANELLNE  409

Query  478  ALKRGLLVPR  449
             L++GL+  R
Sbjct  410  MLEKGLVPNR  419



>ref|XP_003558747.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Brachypodium distachyon]
 ref|XP_010229153.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Brachypodium distachyon]
 ref|XP_010229154.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 
[Brachypodium distachyon]
Length=651

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A E++D M  R+I   H  Y ++I++ C   +VD A A L EMV  G  P   T+ +
Sbjct  455  LGKANELWDDMHSREIFPNHVTYSILIDSHCEKGQVDNAFAFLDEMVNKGIVPNIMTYNS  514

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNV  488
            +I+  C  G V      L  M R  +       YN LI    ++G+  +A N+
Sbjct  515  IIKGYCRSGNVSKGQQFLPKM-RHDKVMPDLITYNTLIHGYVKEGKMHEAFNL  566



>ref|XP_008243718.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial-like [Prunus mume]
Length=525

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 77/166 (46%), Gaps = 17/166 (10%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER  +V+  AY   +EALC G +VD+A     EM   G  P   T+   I
Sbjct  237  EARKLFDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFREMGSNGTDPDACTYSIFI  296

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +     VL  M +R         YN +IK+L +  +  +A  +    ++ G+
Sbjct  297  RAYCEANDIHSVFRVLDRM-KRYNLLPNVYSYNCIIKKLCKNDKVEEAYQLLDEMIESGV  355

Query  460  LVPRKKPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRLCIHRVK  326
            +     P  +S  A QA H         C+ C  +  LRL ++R+K
Sbjct  356  M-----PDAWSYNAIQAYH---------CDHCEVNRALRL-LYRMK  386



>ref|XP_002967974.1| hypothetical protein SELMODRAFT_88078 [Selaginella moellendorffii]
 gb|EFJ31321.1| hypothetical protein SELMODRAFT_88078 [Selaginella moellendorffii]
Length=376

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 59/131 (45%), Gaps = 9/131 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
              +A  V D M ER  +     Y  +I+ LC   +V++A      MV+ G SP  +T+ +
Sbjct  80   FSEALAVLDVMAERGCIPPAIVYNQLIDGLCKAGKVEEAFELSTTMVKNGCSPTLYTYNS  139

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  LC  GK D A   L  M        G+ P    Y +LI  L R G    A +V+  
Sbjct  140  LINGLCLQGKTDEARDFLQEMADS-----GYNPDVVTYTVLINSLRRDGNFKAAVDVFDE  194

Query  478  ALKRGLLVPRK  446
             + +G  VP +
Sbjct  195  MVSKGGCVPDR  205



>ref|XP_002298371.2| hypothetical protein POPTR_0001s24340g [Populus trichocarpa]
 gb|EEE83176.2| hypothetical protein POPTR_0001s24340g [Populus trichocarpa]
Length=742

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + DA+ +FD M E+ ++     Y ++IE  C      KA   L +MV+ G  P  +T+  
Sbjct  349  MTDAFRLFDEMLEQNMMPNEVTYNVMIEGHCKEGNTVKAFELLNQMVQKGLVPDTYTYRP  408

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I +LC+ G+V  A   +  +HR   F +    Y+ L+    ++GR  DA  V    +KR
Sbjct  409  LISSLCSTGRVCEAKKFIDDLHRE-HFKLNEMCYSALLHGYCKEGRLRDALGVCREMVKR  467

Query  466  GL  461
            G+
Sbjct  468  GV  469



>ref|XP_011099967.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Sesamum indicum]
 ref|XP_011099969.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Sesamum indicum]
Length=937

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A+E+FD M  +      R Y  +I   C GK+V KA+A L +M+     P   TF  ++R
Sbjct  420  AFEIFDMMESKNCSPNVRTYNELISGFCEGKKVHKAMALLSKMLEEKIPPDLVTFNILVR  479

Query  637  ALCADGKVDGALSVLSLMHRRS  572
              C +G +D AL +L+LM  ++
Sbjct  480  GQCKEGDIDSALRLLNLMEEKN  501


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 9/105 (9%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY++FD ++E+ I V    Y  +I+  CN ++VD ALA    MVR G  P  +T+  +I 
Sbjct  525  AYDMFDSLKEKGIKVNEVMYTALIDGYCNVEKVDAALALFERMVREGCLPNSYTYNVLIN  584

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQ  515
             LC   K+  AL  L  M        G  P    Y+I+I+++ ++
Sbjct  585  GLCKVKKLREALKFLERMLED-----GMKPTIVTYSIIIEQMLKE  624



>ref|XP_009366374.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Pyrus x bretschneideri]
Length=613

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV DR  +R+   +   Y ++IEA C    V++A+  L EM   G  P   T+  
Sbjct  235  LKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNV  294

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  +C +G++D A+  L+ M   S        +NI+++ +   GR +DA  + A  + R
Sbjct  295  LINGICKEGRLDEAIKFLNDMPS-SDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMVHR  353

Query  466  G  464
            G
Sbjct  354  G  354


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++ ++M +        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  378  AIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLT  437

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGKVD A+ +L+ +  +    V    YN +I  L++ G+   A  +     K+GL
Sbjct  438  ALCKDGKVDSAVEILNQLSSKGCSPV-LITYNTVIDGLSKVGKTERALELLHEMRKKGL  495



>ref|XP_008792873.1| PREDICTED: uncharacterized protein LOC103709351 [Phoenix dactylifera]
Length=1724

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 2/123 (2%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKE-VDKALASLVEMVRIGYSPGRFTFC  650
            L   +EV+  MR   +      + ++I ALC G+E   KA   L EM   G+ P   T+ 
Sbjct  245  LGHCWEVYGEMRRIGVSPNSYTFNILIHALCRGEEDAGKAKEFLEEMELEGFDPDVVTYN  304

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             +I   C  G++D A  +  +MHRR+        Y +L+  L R  R ++A  ++   L+
Sbjct  305  TLIDGYCRRGRLDEAFYLFRIMHRRA-VEPDLVSYTVLMNGLCRDRRVVEAHQLFNRMLQ  363

Query  469  RGL  461
            RGL
Sbjct  364  RGL  366



>ref|XP_002531694.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF30685.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=821

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 57/122 (47%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A      M+E     + R Y  +I   C G ++D A +   EM++ G SP ++T+  
Sbjct  458  LNNATRFLYMMKESNCEPDERTYCELISGFCKGGKLDSATSFFYEMLKCGISPNQWTYTA  517

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I   C +GK+D ALS+   M            YN +I  L++  R  +A    A   ++
Sbjct  518  MIDGYCKEGKIDVALSLFERMEENG-CSASIETYNAIISGLSKGNRFSEAEKFCAKMTEQ  576

Query  466  GL  461
            GL
Sbjct  577  GL  578



>ref|XP_006857320.2| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Amborella trichopoda]
Length=1181

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 40/122 (33%), Positives = 59/122 (48%), Gaps = 11/122 (9%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +  DR+ E         Y ++IEA CN   +D+A+  L EM+     P  FT+  +IR
Sbjct  188  AMKFLDRLLENNCSPTVVTYTILIEATCNIGGIDEAMKLLDEMLARNLHPDMFTYNVIIR  247

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
             +C +GK+D AL +        R  V   P    YNIL++ L  Q R  DA N+ +  + 
Sbjct  248  GMCKEGKLDVALELF-------RTKVNCEPDTISYNILLRALLSQQRWGDAENILSEMIS  300

Query  469  RG  464
             G
Sbjct  301  NG  302



>ref|XP_010092441.1| hypothetical protein L484_019198 [Morus notabilis]
 gb|EXB51207.1| hypothetical protein L484_019198 [Morus notabilis]
Length=759

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            ++DA ++FD M ER +  + R Y ++I  LC  K VD+A   L+ M   G  P    +  
Sbjct  177  IQDAQKMFDEMAERGLAPDERTYTIIISGLCQAKRVDEARRLLITMEESGCCPDTVAYNA  236

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C  G++D A + +    +   + VG   Y+ LI  L +  R ++A   +   +K 
Sbjct  237  LLNGYCQLGRIDEAYAFMRWSEKEG-YVVGLKGYSCLIDGLFKAKRYVEAHGWFRKMIKA  295

Query  466  GL  461
            G+
Sbjct  296  GV  297



>ref|XP_006826435.2| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 
[Amborella trichopoda]
Length=598

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 59/129 (46%), Gaps = 9/129 (7%)
 Frame = -2

Query  838  NEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  659
            N+ +   A E+F  M E++I      Y  +I  LC   +   A      M+  G  P   
Sbjct  138  NKGLFDKAIELFHEMSEKRISPNVVTYSSLIHGLCKNGQWQDATEMFNGMLESGLQPDAI  197

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARN  491
            T+  ++  LC DG+V  A+ +L+ M  +     G  P    YN+LI  L ++G+  DA N
Sbjct  198  TYTGLVDGLCKDGRVPQAMQLLNTMMEK-----GEEPDTVTYNVLINGLCKEGQMGDAMN  252

Query  490  VYAAALKRG  464
                 ++RG
Sbjct  253  YMGKMIERG  261



>ref|XP_008338987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like 
[Malus domestica]
Length=613

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV DR  +R+   +   Y ++IEA C    V++A+  L EM   G  P   T+  
Sbjct  235  LKQAMEVLDRQLQRECYPDVITYTILIEATCKESGVEQAMKLLDEMRSKGCKPDVVTYNV  294

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  +C +G++D A+  L+ M   S        +NI+++ +   GR +DA  + A  + R
Sbjct  295  LINGICKEGRLDEAIKFLNDMPS-SDCQPNVITHNIVLRSMCSTGRWMDAEKLLAEMVHR  353

Query  466  G  464
            G
Sbjct  354  G  354


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++ ++M +        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  378  AIDILEKMPKHGCTPNSLSYNPLLHGFCKEKKMDRAIEYLDIMVSRGCYPDIVTYNTLLT  437

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            ALC DGKVD A+ +L+ +  +    V    YN +I  L++ G+   A  +     K+GL
Sbjct  438  ALCKDGKVDSAVEILNQLSSKGCSPV-LITYNTVIDGLSKVGKTECALELLHEMRKKGL  495



>gb|EYU40636.1| hypothetical protein MIMGU_mgv1a021322mg [Erythranthe guttata]
Length=838

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 10/125 (8%)
 Frame = -2

Query  820  DAYEVFDRMRERK-IVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            DAY+VFD M E+    V    Y +++  LC  + +D+AL    EM   G  P   T+  +
Sbjct  246  DAYKVFDLMSEKDGCGVNSATYSILMHGLCEARRLDEALKLKEEMCVKGCHPSTRTYTVL  305

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAA  476
            I+A C  G +D AL +L  M ++     G  P    Y IL+  L ++G+  +A  ++   
Sbjct  306  IKATCDKGLIDKALILLDEMIKK-----GCKPNAHTYTILVDMLCKEGKIEEANGMFRKM  360

Query  475  LKRGL  461
            LK G+
Sbjct  361  LKDGI  365



>gb|AIC74544.1| PPR protein PPR7-454-M [Oryza sativa Indica Group]
Length=454

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  219  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  278

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR   AR ++ +  KRGL
Sbjct  279  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  336



>ref|XP_007131603.1| hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris]
 gb|ESW03597.1| hypothetical protein PHAVU_011G027200g [Phaseolus vulgaris]
Length=900

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A ++FD + ERKI      Y ++IE  C    +DKA   L +M++ G  P  +T+  
Sbjct  518  MAEASKLFDDLLERKIKPTEVTYNVLIEGYCRDNNIDKAFELLEDMLQKGLVPDTYTYRP  577

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC++G+V  A   +  +H++ +  +    Y+ L+    ++GR ++A +     ++R
Sbjct  578  LISGLCSNGRVSEAGDFIDALHKQ-KVKLNEMCYSALLHGYCQEGRLVEALSASCEMIQR  636

Query  466  GL  461
            G+
Sbjct  637  GI  638



>ref|XP_002963945.1| hypothetical protein SELMODRAFT_82351 [Selaginella moellendorffii]
 gb|EFJ34278.1| hypothetical protein SELMODRAFT_82351 [Selaginella moellendorffii]
Length=376

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 59/131 (45%), Gaps = 9/131 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
              +A  V D M ER  +     Y  +I+ LC   +V++A      MV+ G SP  +T+ +
Sbjct  80   FSEALAVLDVMAERGCIPPAIVYNQLIDGLCKAGKVEEAFELSTTMVKNGCSPTLYTYNS  139

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I  LC  GK D A   L  M        G+ P    Y +LI  L R G    A +V+  
Sbjct  140  LINGLCLQGKTDEARDFLQEMADS-----GYNPDVVTYTVLINSLRRDGNFRAAVDVFDE  194

Query  478  ALKRGLLVPRK  446
             + +G  VP +
Sbjct  195  MVSKGGCVPDR  205



>ref|XP_010654769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Vitis vinifera]
 ref|XP_010654770.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Vitis vinifera]
Length=544

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 74/160 (46%), Gaps = 16/160 (10%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++F+ MRER   V+  AY  ++EALC G  VD+A     EM   G +P   ++   I
Sbjct  237  EARKLFEEMRERGCAVDVVAYNSLLEALCKGGNVDEAYKLFREMGSNGLAPDACSYSIFI  296

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +  A  VL  M RR         YN ++K+L +  +  +A  +    ++RG+
Sbjct  297  RAYCEVNDIHSAFQVLDRM-RRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGV  355

Query  460  LVPRKKPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  344
                  P  +S  A QA H         C+ C  +  LRL
Sbjct  356  -----SPDLWSYNAIQAFH---------CDHCEVNKALRL  381


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +  A++V DRMR   +V     Y  +++ LC  ++VD+A   L EM+  G SP  +++ N
Sbjct  305  IHSAFQVLDRMRRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGVSPDLWSY-N  363

Query  646  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAA  479
             I+A  C   +V+ AL ++S M + +      P    YN+++K L R GR     +V+  
Sbjct  364  AIQAFHCDHCEVNKALRLISRMEKEN----CMPDRHTYNMVLKMLLRVGRFDRVTDVWGG  419

Query  478  ALKRGL  461
              +RG 
Sbjct  420  MEERGF  425



>ref|XP_009618145.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009618147.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009618148.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana tomentosiformis]
Length=900

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 9/127 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+ VFDRM +  I     +Y  +I  LC  + VD+AL  L EM+  G  P  +T+  
Sbjct  247  LDAAFMVFDRMVQDGIDPNAASYTTLINGLCTVERVDEALGMLEEMIEKGIEPTVYTYTV  306

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
             + +LCA G+   A+ ++  M +R     G  P    Y  LI  L++ G    A  +Y  
Sbjct  307  PVSSLCAVGREKEAVDLVVSMRKR-----GCEPNVQTYTALISGLSQSGHLEVAIGLYHN  361

Query  478  ALKRGLL  458
             +++GLL
Sbjct  362  MIRKGLL  368


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A  + D M+      +   Y  ++   C   ++D A A   EM++ G SP +  +  
Sbjct  457  LNNAVRLLDLMKNNGCKPDEWTYAELVSGFCKRGKLDSASALFQEMIKHGLSPNQVNYTA  516

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  L  +GKVD AL++L  M   S    G   YN +I  L++Q R L+A  +     + 
Sbjct  517  LIDGLSKEGKVDDALALLKRM-EESGCSPGIETYNAIINGLSKQNRLLEAERLCNKIAES  575

Query  466  GLL  458
            GLL
Sbjct  576  GLL  578



>emb|CBI36294.3| unnamed protein product [Vitis vinifera]
Length=517

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 74/160 (46%), Gaps = 16/160 (10%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++F+ MRER   V+  AY  ++EALC G  VD+A     EM   G +P   ++   I
Sbjct  210  EARKLFEEMRERGCAVDVVAYNSLLEALCKGGNVDEAYKLFREMGSNGLAPDACSYSIFI  269

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +  A  VL  M RR         YN ++K+L +  +  +A  +    ++RG+
Sbjct  270  RAYCEVNDIHSAFQVLDRM-RRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGV  328

Query  460  LVPRKKPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  344
                  P  +S  A QA H         C+ C  +  LRL
Sbjct  329  -----SPDLWSYNAIQAFH---------CDHCEVNKALRL  354


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +  A++V DRMR   +V     Y  +++ LC  ++VD+A   L EM+  G SP  +++ N
Sbjct  278  IHSAFQVLDRMRRYNLVPNVFTYNCIVKKLCKSEKVDEAYQLLDEMIERGVSPDLWSY-N  336

Query  646  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAA  479
             I+A  C   +V+ AL ++S M + +      P    YN+++K L R GR     +V+  
Sbjct  337  AIQAFHCDHCEVNKALRLISRMEKEN----CMPDRHTYNMVLKMLLRVGRFDRVTDVWGG  392

Query  478  ALKRGL  461
              +RG 
Sbjct  393  MEERGF  398



>gb|AIC74545.1| PPR protein PPR7-458-I [Oryza sativa Indica Group]
Length=458

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYNSILH  282

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+   A+  L  M R          Y  L+  L + GR   AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEAIGTLKKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  340



>gb|KDO45230.1| hypothetical protein CISIN_1g018782mg [Citrus sinensis]
Length=350

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A ++FD M ERK  V+  A+  ++EA+C    +D+A   L EM  IG  P  F++  
Sbjct  60   LSEARKLFDEMLERKCPVDILAHNSLLEAMCKAGNIDEAHGMLREMRSIGAEPDAFSYSI  119

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
             I A C    +     VL  M R +     F  YN +I++L +  +  +A  +    ++R
Sbjct  120  FIHAFCEANDIHSVFRVLDSMKRYNLVPNVF-TYNCIIRKLCKNEKVEEAYQLLDEMIER  178

Query  466  G  464
            G
Sbjct  179  G  179



>ref|XP_002313262.2| hypothetical protein POPTR_0009s07380g [Populus trichocarpa]
 gb|EEE87217.2| hypothetical protein POPTR_0009s07380g [Populus trichocarpa]
Length=648

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++F+RM+   I+ +  +Y  +I  LC  K ++KA+  LVEM      P  FT+C ++ 
Sbjct  83   ALDLFNRMKRINILPDIVSYNTIINGLCKEKRLEKAVDLLVEMEGSNCEPNSFTYCILMD  142

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             LC +G+V+ A+ +L  M R+    V    Y+ LI     +G     + ++   L++G+
Sbjct  143  GLCKEGRVEEAMRLLGEMKRKG-LEVDVVVYSTLISGFCSKGCLDRGKALFDEMLEKGI  200


 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 65/130 (50%), Gaps = 4/130 (3%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIG--YSPGR  662
            E  + DA+++F+ M E+   +E  +Y  +I  LCN  ++D+A+     ++  G    P  
Sbjct  287  EGCIGDAFKIFETMLEKGKRLEVVSYNTLIMGLCNNGKLDEAMKLFSSLLEDGNYVEPDV  346

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYA  482
             TF  VI+ LC +G++D A+ +   M  R  F   F  + ILI E  + G    A  ++ 
Sbjct  347  ITFNTVIQGLCKEGRLDKAVEIYDTMIERGSFGNLFTCH-ILIGEYIKSGIIDKAMELWK  405

Query  481  AALKRGLLVP  452
               K G LVP
Sbjct  406  RVHKLG-LVP  414


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 51/115 (44%), Gaps = 1/115 (1%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            +FD M E+ I      Y  +I   C      +A A L  M   G  P  +T+  +I  LC
Sbjct  191  LFDEMLEKGISPNVVVYSCLINGFCKKGLWREATAVLHTMTERGIQPDVYTYTCMIGGLC  250

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
             DG+   AL +  LM  +         YN+LI  L ++G   DA  ++   L++G
Sbjct  251  KDGRARKALDLFDLMTEKGE-EPSTVTYNVLINGLCKEGCIGDAFKIFETMLEKG  304



>ref|XP_009381144.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Musa acuminata subsp. malaccensis]
 ref|XP_009381152.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Musa acuminata subsp. malaccensis]
 ref|XP_009381160.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Musa acuminata subsp. malaccensis]
 ref|XP_009381168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Musa acuminata subsp. malaccensis]
 ref|XP_009381176.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 
[Musa acuminata subsp. malaccensis]
Length=861

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 38/128 (30%), Positives = 64/128 (50%), Gaps = 9/128 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + DA+ V D M         R Y  +I  LC  K+V KA+A L +M+  G  P + T+ +
Sbjct  354  INDAFGVLDLMESNGCKPNVRTYTELICGLCRNKKVHKAMALLTKMLEDGLLPNQVTYTS  413

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            +I+  C +G  + A  +LSLM  +     G  P    Y++LI  L + G+  +A + + +
Sbjct  414  LIQGQCMEGDTNSAFRLLSLMEEK-----GMVPNEWTYSVLIGGLCKGGKTEEAISFFRS  468

Query  478  ALKRGLLV  455
              + G+ V
Sbjct  469  LSQNGMKV  476



>ref|XP_003551657.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
isoform X1 [Glycine max]
 ref|XP_006602774.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
isoform X2 [Glycine max]
 ref|XP_006602775.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like 
isoform X3 [Glycine max]
Length=525

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            RDA E+  +M +  +      Y +V++ LC    V +A     EMV  G     FT+ ++
Sbjct  178  RDAIELLRKMEKGGVRPNLIMYNMVVDGLCKEGLVTEACGLCSEMVGKGICIDVFTYNSL  237

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            I   C  G+  GA+ +L+ M  +         +NIL+  L + G   +ARNV+   +KRG
Sbjct  238  IHGFCGAGQFQGAVRLLNEMVMKEDVRPDVYTFNILVDALCKLGMVAEARNVFGLMIKRG  297

Query  463  L  461
            L
Sbjct  298  L  298



>ref|XP_010530461.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g12700, mitochondrial [Tarenaya hassleriana]
Length=584

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 57/113 (50%), Gaps = 1/113 (1%)
 Frame = -2

Query  850  GXGMNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYS  671
            G  + EW L +A E++D+M    +V +   Y  +I+ LC  K +D+A      MV +GY 
Sbjct  287  GGFVKEWKLVEAKELYDQMIHMGLVPDTFMYTSLIDGLCIQKRLDEAKEIFESMVALGYP  346

Query  670  PGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQG  512
                TF  +I+  C DG++D  + +LS M RR         YN L++   R G
Sbjct  347  LTTVTFNALIKGYCKDGRMDEGMKLLSEMPRRG-VVADIYTYNSLVEGFFRAG  398



>ref|NP_172461.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q3EDF8.1|PPR28_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g09900 
[Arabidopsis thaliana]
 gb|AEE28512.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=598

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV DRM +R    +   Y ++IEA C    V  A+  L EM   G +P   T+  
Sbjct  220  LKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNV  279

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++  +C +G++D A+  L+ M   S        +NI+++ +   GR +DA  + A  L++
Sbjct  280  LVNGICKEGRLDEAIKFLNDMP-SSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRK  338

Query  466  GL  461
            G 
Sbjct  339  GF  340



>ref|XP_006472193.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
isoform X1 [Citrus sinensis]
 ref|XP_006472194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
isoform X2 [Citrus sinensis]
Length=595

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = -2

Query  763  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  584
             Y +++ ALC   +  KA++ L EM ++G SP   T+  ++   C +G +  A+++   M
Sbjct  462  TYNILVGALCKDGKSKKAVSLLDEMFKVGVSPSHVTYNTLMDGYCREGNLVAAMNLRKQM  521

Query  583  HRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKKPIQ  434
             +  + W     YN+LIK   ++G+  DA  +    L++G L+P +   Q
Sbjct  522  EKEKK-WPNIVTYNVLIKGFCQKGKLEDANGLLNELLEKG-LIPNQTTYQ  569



>gb|KCW90149.1| hypothetical protein EUGRSUZ_A02340 [Eucalyptus grandis]
Length=703

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 59/138 (43%), Gaps = 16/138 (12%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            ++DA ++FD M  R I    R Y +VI  LC  K  D A      M   G SP   T+  
Sbjct  200  IKDALKMFDEMTLRGISPNERTYTIVIAGLCQAKSTDYAYKLFESMRESGCSPDTVTYNV  259

Query  646  VIRALCADGKVDGALSVLSLMHRRS------RFWV----------GFPPYNILIKELNRQ  515
            ++   C  GK+D AL VL    + +        W               Y I+I+ L++ 
Sbjct  260  LLDGFCKAGKIDEALLVLPTFEKEAGRYDEVDVWYRRIVKEEVTPDVTLYAIMIRGLSKA  319

Query  514  GRALDARNVYAAALKRGL  461
            GR  DA ++     +RGL
Sbjct  320  GRMEDAMSMLEEMTQRGL  337



>ref|XP_009801387.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
 ref|XP_009801388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
 ref|XP_009801389.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 
[Nicotiana sylvestris]
Length=767

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 59/111 (53%), Gaps = 1/111 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+    +M E+ +  +   Y  +I+ LC  + + +A     EM+R+G  P +FT+  
Sbjct  479  LERAFCAKQQMVEKGVSPDVITYSSLIQGLCEQQSLTEARELFQEMLRVGIQPDKFTYTT  538

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDAR  494
            +I A C  G + GAL++ + M  +  F+     Y++LI  LN+Q R  +A+
Sbjct  539  LIGAYCLKGDIKGALNLHNEMINKG-FFPDVVTYSVLINGLNKQARTREAK  588


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A + +D M    +      Y ++I  LC   +++K LA   EM + G  P   T+  +I 
Sbjct  202  AQKFYDDMVNSGVSPNVYTYNIMIRGLCVKGDLNKGLAFFKEMEKCGCLPSVVTYNTIIG  261

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            A C  GKVD A+ +L LM  R+        YN +I  L R+GR  +   V      +GL+
Sbjct  262  AYCKIGKVDEAVELLKLMQVRN-LEPSVVTYNAIINGLCREGRMKETSEVLKDMRGKGLV  320


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A E FD++R R +    R Y  +I        +++A   L EM+  G+SP   T+  
Sbjct  374  LHRAMEFFDQLRARGLYPNERTYTTLIVGFSQQGFMNEAYKLLNEMISSGFSPSIVTYNA  433

Query  646  VIRALCADGKVDGALSVLSLMHRR  575
            ++   CA G+++ ALSV+  M RR
Sbjct  434  LVNGHCALGRMEDALSVIQEMERR  457



>ref|XP_004144813.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Cucumis sativus]
 ref|XP_011648861.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 
[Cucumis sativus]
Length=611

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 1/129 (1%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  + +   + + M+ R +  +   Y ++I A C  KE  KA   + EM+  G  P   T
Sbjct  456  EGKMEEVKNLLNEMQCRGVKADTVTYNILISAWCEKKEPKKAARLIDEMLDKGLKPSHLT  515

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  ++   C +G +  AL++   M +  R W     YN+LI+   R+G+  DA  +    
Sbjct  516  YNILLNGYCMEGNLRAALNLRKQMEKEGR-WANVVTYNVLIQGYCRKGKLEDANGLLNEM  574

Query  475  LKRGLLVPR  449
            L++GL+  R
Sbjct  575  LEKGLIPNR  583



>gb|ERM93672.1| hypothetical protein AMTR_s00004p00168920 [Amborella trichopoda]
Length=735

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 59/129 (46%), Gaps = 9/129 (7%)
 Frame = -2

Query  838  NEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  659
            N+ +   A E+F  M E++I      Y  +I  LC   +   A      M+  G  P   
Sbjct  275  NKGLFDKAIELFHEMSEKRISPNVVTYSSLIHGLCKNGQWQDATEMFNGMLESGLQPDAI  334

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARN  491
            T+  ++  LC DG+V  A+ +L+ M  +     G  P    YN+LI  L ++G+  DA N
Sbjct  335  TYTGLVDGLCKDGRVPQAMQLLNTMMEK-----GEEPDTVTYNVLINGLCKEGQMGDAMN  389

Query  490  VYAAALKRG  464
                 ++RG
Sbjct  390  YMGKMIERG  398



>ref|XP_006433532.1| hypothetical protein CICLE_v10003346mg [Citrus clementina]
 gb|ESR46772.1| hypothetical protein CICLE_v10003346mg [Citrus clementina]
Length=596

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = -2

Query  763  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  584
             Y +++ ALC   +  KA++ L EM ++G SP   T+  ++   C +G +  A+++   M
Sbjct  463  TYNILVGALCKDGKSKKAVSLLDEMFKVGVSPSHVTYNTLMDGYCREGNLVAAMNLRKQM  522

Query  583  HRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLLVPRKKPIQ  434
             +  + W     YN+LIK   ++G+  DA  +    L++G L+P +   Q
Sbjct  523  EKEKK-WPNIVTYNVLIKGFCQKGKLEDANGLLNELLEKG-LIPNQTTYQ  570



>ref|XP_008360647.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g52640, mitochondrial-like [Malus domestica]
Length=463

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER  +V+  AY+  +EALC G +VD+A     EM   G  P   T+   I
Sbjct  175  EARKLFDEMTERGCLVDVPAYDSYLEALCKGGKVDEAYKIFQEMGSNGVEPDACTYSIFI  234

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            R  C    +     VL  M RR         YN +IK+L +  +  +A  +    ++RG+
Sbjct  235  RTYCEVDDIHSVFRVLDRM-RRYNILPNVYTYNCVIKKLCKNEKVEEAYQLLDEMIERGV  293

Query  460  L  458
            +
Sbjct  294  M  294


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 62/125 (50%), Gaps = 7/125 (6%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +   + V DRMR   I+     Y  VI+ LC  ++V++A   L EM+  G  P  +++  
Sbjct  243  IHSVFRVLDRMRRYNILPNVYTYNCVIKKLCKNEKVEEAYQLLDEMIERGVMPDTWSYNA  302

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFP---PYNILIKELNRQGRALDARNVYAAA  476
            +    C   +V+G+L +LS M + +      P    YN+++K L R GR   A  V+ + 
Sbjct  303  IXAYHCDHCEVNGSLRLLSRMEKDN----CMPDRHTYNMVLKLLIRIGRFDRATEVWDSI  358

Query  475  LKRGL  461
             KRG 
Sbjct  359  RKRGF  363



>ref|XP_006427239.1| hypothetical protein CICLE_v100269871mg, partial [Citrus clementina]
 gb|ESR40479.1| hypothetical protein CICLE_v100269871mg, partial [Citrus clementina]
Length=436

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A ++FD M ERK  V+  A+  ++EA+C    +D+A   L EM  IG  P  F++  
Sbjct  146  LSEARKLFDEMLERKCPVDILAHNSLLEAMCKAGNIDEAHGMLREMRSIGAEPDAFSYSI  205

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
             I A C    +     VL  M R +     F  YN +I++L +  +  +A  +    ++R
Sbjct  206  FIHAFCEANDIHSVFRVLDSMKRYNLVPNVF-TYNCIIRKLCKNEKVEEAYQLLDEMIER  264

Query  466  G  464
            G
Sbjct  265  G  265



>ref|XP_010530356.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530357.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530358.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010530360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=640

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 2/122 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +  RM E+ I V+   Y  +I+ LC G  +D AL+   +M   G +P   T+  +I 
Sbjct  249  ALNLLMRMEEKNIEVDVIMYNTIIDGLCKGGHIDVALSLFEKMDSKGIAPNVVTYNCLIN  308

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
             LC   + + A+ +L+ M +R + +     +NILI    ++G+ L+A+ +    ++RG L
Sbjct  309  GLCVFNRWNDAVLLLNDMAKR-KIFSNVVTFNILIDAFVKEGKFLEAKELCEEIIRRG-L  366

Query  457  VP  452
            VP
Sbjct  367  VP  368



>gb|KEH26900.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=379

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A  +F+ M  RKI+ +   Y  +I+ LC   ++  AL  + EM   G  P   T+ +++
Sbjct  200  EAMNLFEEMHCRKIIPDVVTYNSLIDGLCKLGKISYALKLVDEMHDRGVPPDIITYSSIL  259

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAAL  473
             ALC + +VD A+++L+ +  +     G  P    Y ILI  L + GR  DA N++   L
Sbjct  260  DALCKNHQVDKAIALLTKLKDQ-----GIRPNMYTYTILIDGLCKGGRLDDAHNIFEDLL  314

Query  472  KRG  464
             +G
Sbjct  315  VKG  317


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 1/121 (1%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNV  644
            R A ++  R+  + +      Y  +I+ +C  K V+ A     EMV    SP  FT+  +
Sbjct  24   RAALQLLRRVDGKLVQPSVVMYNTIIDGMCKDKHVNDAFDLYSEMVSKRISPDVFTYNAL  83

Query  643  IRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
            I   C  GK+  A+ + + M            +NIL+    ++G+  +A+NV A  +K+G
Sbjct  84   ISGFCIVGKLKDAIGLFNKM-TLENINPDMYTFNILVDAFCKEGKMKEAKNVLAMMMKQG  142

Query  463  L  461
            +
Sbjct  143  M  143



>ref|XP_011004426.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Populus euphratica]
Length=523

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A +VFD M  R   ++  AY  ++EALC G  VD+A     E+   G  P   ++   IR
Sbjct  236  ARKVFDEMLGRGCALDVLAYNSLLEALCKGGNVDEAYKMFREIASHGVEPDACSYAIFIR  295

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            A C    +    SVL  M R       F  YN +IK+L + G+  DA  +    ++RG+
Sbjct  296  AYCEANNIHSVFSVLDRMKRYDLVPNVF-TYNCIIKKLCKNGKVEDAYQLLHEMIERGV  353



>ref|XP_004505699.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900-like [Cicer arietinum]
Length=886

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 68/131 (52%), Gaps = 3/131 (2%)
 Frame = -2

Query  853  GGXGMNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGY  674
            G  G NE  + +A ++FD M ERK+      Y ++IE  C  + +DKA   L +M++ G 
Sbjct  503  GLCGTNE--MAEASKLFDEMVERKVNPTEVTYNVMIEGYCRARNIDKAFELLEDMLQKGL  560

Query  673  SPGRFTFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDAR  494
             P  +T+  +I  LC+ G+V  A   +  +H+++   +    Y+ L+     +GR  +A 
Sbjct  561  VPDTYTYRPLIGGLCSTGRVSEAKDFIDDLHKQN-LKLNEMCYSALLHGYCGEGRLTEAL  619

Query  493  NVYAAALKRGL  461
            +     ++RG+
Sbjct  620  SASYEMIQRGI  630



>ref|XP_010492577.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial isoform X2 [Camelina sativa]
Length=453

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 61/123 (50%), Gaps = 2/123 (2%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA  +F+RM E         Y  VI+ LC  K+VD AL  L  M + G  P   T+ +++
Sbjct  118  DALYMFERMVEMGYKPNVVIYNTVIDGLCKSKQVDNALDLLNRMEKDGVRPDAVTYNSLV  177

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              LC  G+   A  ++S M +R  +   F  +N LI    ++G  L+A  +Y   ++R  
Sbjct  178  SGLCNSGRWSDATRMVSYMTKREIYPDVF-TFNALIDACVKEGNILEAEELYEEMIRRS-  235

Query  460  LVP  452
            LVP
Sbjct  236  LVP  238


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            +F  M +R +V     Y ++I+  C   +++ A      MV  G +P   T+  ++  LC
Sbjct  297  LFCEMSQRGVVKNTVTYTILIQGYCRAGKLNVAEEIFRRMVFSGVTPNIVTYNVLLHGLC  356

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
              GK++ AL +L+ M ++S        YNI+I  + + G   DA ++Y +   +GL+
Sbjct  357  DIGKIEKALVILADM-QKSGMDADIVTYNIIIGGMCKAGEVADAWDLYCSLNHKGLM  412



>ref|XP_006592041.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900-like isoform X1 [Glycine max]
 ref|XP_006592042.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g59900-like isoform X2 [Glycine max]
Length=903

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A E+FD + ERKI      Y ++IE  C   ++DKA   L +M + G  P  +T+  
Sbjct  521  MAEASELFDELVERKIKPTEVTYNVLIEGYCRDGKIDKAFELLEDMHQKGLVPDTYTYRP  580

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+    ++GR ++A +     ++R
Sbjct  581  LISGLCSTGRVSKAKDFIDDLHKQN-VKLNEMCYSALLHGYCQEGRLMEALSASCEMIQR  639

Query  466  GL  461
            G+
Sbjct  640  GI  641



>ref|XP_010024947.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic-like [Eucalyptus grandis]
 gb|KCW61500.1| hypothetical protein EUGRSUZ_H04228 [Eucalyptus grandis]
Length=584

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E+F ++ E        +Y  +  AL +  +  +AL  + EMV  G  P   T+ ++I 
Sbjct  404  ALEIFAKLDEVGCSPNVSSYNTMFSALWSSGDRYRALEMISEMVSKGIDPDNITYNSLIS  463

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
             LC DG VD ALS+L  M  RS F      YNI+I  L++  R  DA  V A  +++G+
Sbjct  464  CLCRDGMVDEALSLLVDME-RSGFSSTVISYNIVILGLSKVSRIDDAIEVLAVMVEKGI  521



>gb|KDO66019.1| hypothetical protein CISIN_1g048778mg [Citrus sinensis]
Length=902

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A+ + D M E+      R Y ++I+ALC+    DKAL+   EMV     P   T+  
Sbjct  284  LDEAFSLKDEMCEKGWQPSTRTYTVLIKALCDISLTDKALSLFDEMVVKRCKPNAHTYTV  343

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC +GK+D A  +   M +   F  G   YN+LI    +QGR + A  + A   KR
Sbjct  344  LIDRLCREGKIDEANGMCGKMLQDGHF-PGVVTYNVLINGYCKQGRIIAAFELLALMEKR  402



>ref|XP_006443536.1| hypothetical protein CICLE_v10018778mg [Citrus clementina]
 ref|XP_006479201.1| PREDICTED: pentatricopeptide repeat-containing protein At3g07290, 
mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56776.1| hypothetical protein CICLE_v10018778mg [Citrus clementina]
Length=902

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A+ + D M E+      R Y ++I+ALC+    DKAL+   EMV     P   T+  
Sbjct  284  LDEAFSLKDEMCEKGWQPSTRTYTVLIKALCDISLTDKALSLFDEMVVKRCKPNAHTYTV  343

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC +GK+D A  +   M +   F  G   YN+LI    +QGR + A  + A   KR
Sbjct  344  LIDRLCREGKIDEANGMCGKMLQDGHF-PGVVTYNVLINGYCKQGRIIAAFELLALMEKR  402



>ref|XP_010492576.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial isoform X1 [Camelina sativa]
Length=506

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA  +F+RM E         Y  VI+ LC  K+VD AL  L  M + G  P   T+ +++
Sbjct  171  DALYMFERMVEMGYKPNVVIYNTVIDGLCKSKQVDNALDLLNRMEKDGVRPDAVTYNSLV  230

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              LC  G+   A  ++S M +R  +   F  +N LI    ++G  L+A  +Y   ++R L
Sbjct  231  SGLCNSGRWSDATRMVSYMTKREIYPDVF-TFNALIDACVKEGNILEAEELYEEMIRRSL  289

Query  460  L  458
            +
Sbjct  290  V  290


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = -2

Query  808  VFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALC  629
            +F  M +R +V     Y ++I+  C   +++ A      MV  G +P   T+  ++  LC
Sbjct  350  LFCEMSQRGVVKNTVTYTILIQGYCRAGKLNVAEEIFRRMVFSGVTPNIVTYNVLLHGLC  409

Query  628  ADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
              GK++ AL +L+ M ++S        YNI+I  + + G   DA ++Y +   +GL+
Sbjct  410  DIGKIEKALVILADM-QKSGMDADIVTYNIIIGGMCKAGEVADAWDLYCSLNHKGLM  465



>ref|XP_010544054.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Tarenaya hassleriana]
Length=596

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 64/125 (51%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L++A EV DR  +R    +   Y ++IEA C    V +A+  L EM   G +P   T+  
Sbjct  218  LKEAMEVLDRQLQRGCYPDVITYTILIEATCKESGVGQAMKLLDEMRNRGCNPDVVTYNV  277

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  278  LVNGICKEGRIDEAIEFLNTMPS-----FGCQPNVITHNIILRSMCSTGRWIDAEKLLAD  332

Query  478  ALKRG  464
             L++G
Sbjct  333  MLRKG  337


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 4/131 (3%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++ ++M E        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  361  AIDILEKMPEHGCYPNSLSYNPLLHGFCKEKKMDRAIEYLELMVSRGCYPDIVTYNTLLT  420

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            ALC DGKVD A+ +L+ +  +    V    YN +I  L + G+   A  +  A   +GL 
Sbjct  421  ALCKDGKVDIAVEILNQLSSKGCSPV-LITYNTVIDGLAKAGKTEKAMKLLDAMRGKGL-  478

Query  457  VPRKKPIQFSA  425
              +   I +S+
Sbjct  479  --KPDTITYSS  487



>gb|KDO49128.1| hypothetical protein CISIN_1g004231mg [Citrus sinensis]
 gb|KDO49129.1| hypothetical protein CISIN_1g004231mg [Citrus sinensis]
Length=766

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 58/115 (50%), Gaps = 9/115 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A++    M E+ ++ +   Y  +I  LC  + + +A     EM+  G SP  FT+  
Sbjct  480  LDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTT  539

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDAR  494
            +I A C +G +  AL +   M ++     GF P    Y++LI  LN+Q R ++A+
Sbjct  540  LINAYCTEGDIPQALRLHDEMIQK-----GFLPDVVTYSVLINGLNKQARTMEAK  589



>ref|XP_006423060.1| hypothetical protein CICLE_v10028118mg [Citrus clementina]
 gb|ESR36300.1| hypothetical protein CICLE_v10028118mg [Citrus clementina]
Length=557

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 1/111 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A++    M E+ ++ +   Y  +I  LC  + + +A     EM+  G SP  FT+  
Sbjct  271  LDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTT  330

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDAR  494
            +I A C +G +  AL +   M ++  F      Y++LI  LN+Q R ++A+
Sbjct  331  LINAYCTEGDIPQALRLHDEMIQKG-FLPDVVTYSVLINGLNKQARTMEAK  380



>ref|XP_009618149.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X2 [Nicotiana tomentosiformis]
Length=768

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 9/127 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+ VFDRM +  I     +Y  +I  LC  + VD+AL  L EM+  G  P  +T+  
Sbjct  115  LDAAFMVFDRMVQDGIDPNAASYTTLINGLCTVERVDEALGMLEEMIEKGIEPTVYTYTV  174

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
             + +LCA G+   A+ ++  M +R     G  P    Y  LI  L++ G    A  +Y  
Sbjct  175  PVSSLCAVGREKEAVDLVVSMRKR-----GCEPNVQTYTALISGLSQSGHLEVAIGLYHN  229

Query  478  ALKRGLL  458
             +++GLL
Sbjct  230  MIRKGLL  236


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A  + D M+      +   Y  ++   C   ++D A A   EM++ G SP +  +  
Sbjct  325  LNNAVRLLDLMKNNGCKPDEWTYAELVSGFCKRGKLDSASALFQEMIKHGLSPNQVNYTA  384

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  L  +GKVD AL++L  M   S    G   YN +I  L++Q R L+A  +     + 
Sbjct  385  LIDGLSKEGKVDDALALLKRM-EESGCSPGIETYNAIINGLSKQNRLLEAERLCNKIAES  443

Query  466  GLL  458
            GLL
Sbjct  444  GLL  446



>ref|XP_006480134.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like 
[Citrus sinensis]
Length=766

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 58/115 (50%), Gaps = 9/115 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A++    M E+ ++ +   Y  +I  LC  + + +A     EM+  G SP  FT+  
Sbjct  480  LDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTT  539

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDAR  494
            +I A C +G +  AL +   M ++     GF P    Y++LI  LN+Q R ++A+
Sbjct  540  LINAYCTEGDIPQALRLHDEMIQK-----GFLPDVVTYSVLINGLNKQARTMEAK  589



>gb|KHN05463.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=923

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/122 (28%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A E+FD + ERKI      Y ++IE  C   ++DKA   L +M + G  P  +T+  
Sbjct  533  MAEASELFDELVERKIKPTEVTYNVLIEGYCRDGKIDKAFELLEDMHQKGLVPDTYTYRP  592

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G+V  A   +  +H+++   +    Y+ L+    ++GR ++A +     ++R
Sbjct  593  LISGLCSTGRVSKAKDFIDDLHKQN-VKLNEMCYSALLHGYCQEGRLMEALSASCEMIQR  651

Query  466  GL  461
            G+
Sbjct  652  GI  653



>gb|EPS74565.1| hypothetical protein M569_00187, partial [Genlisea aurea]
Length=860

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 54/123 (44%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A  + D MRE     +   Y  +I   C     DKA A   EM+++G  P    F  
Sbjct  419  LDNAMRLMDMMRENGCEPDQLTYAELISGFCGSNNSDKAFALFQEMIQLGLKPNSVNFTA  478

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC +GKV  AL ++  M +    W     YN ++  L    R  +A  +    L+ 
Sbjct  479  LIDGLCKEGKVRDALILMGRMQKVG-CWPYIEAYNAVLNGLCTTKRLSEAHELLNEILES  537

Query  466  GLL  458
            GLL
Sbjct  538  GLL  540


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 2/128 (2%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            E  +RDA  +  RM++        AY  V+  LC  K + +A   L E++  G  P   T
Sbjct  486  EGKVRDALILMGRMQKVGCWPYIEAYNAVLNGLCTTKRLSEAHELLNEILESGLLPNTIT  545

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  +I  LC +G +D A  V   M +RS F      Y+ LI  L R GRA DA  +    
Sbjct  546  YTTLIDGLCKNGDMDLAFEVFHDMEKRSCF-PNLYTYSALIHGLCRVGRAGDAE-ILLEE  603

Query  475  LKRGLLVP  452
            + + +L P
Sbjct  604  MSKKMLCP  611



>gb|AJG06104.1| restorer-of-fertility [Raphanus sativus]
Length=687

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 61/133 (46%), Gaps = 10/133 (8%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + D  E+   M E  +V +   Y  +I   C   +++ AL  L EM+  G  P   T   
Sbjct  411  IDDGMELLHEMTETGLVADTTTYNTLIHGFCLVGDLNAALDLLQEMISSGLCPDIVTCDT  470

Query  646  VIRALCADGKVDGALSVLSLMHRR------SRFWVGFPP----YNILIKELNRQGRALDA  497
            ++  LC +GK+  AL +  +M +       S  + G  P    YNILI  L  +G+ L+A
Sbjct  471  LLDGLCDNGKLKDALEMFKVMQKSKKDLDASHPFNGVEPDVQTYNILISGLINEGKFLEA  530

Query  496  RNVYAAALKRGLL  458
              +Y     RG++
Sbjct  531  EELYEEMPHRGIV  543


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 0/89 (0%)
 Frame = -2

Query  841  MNEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGR  662
            +NE    +A E+++ M  R IV +   Y  +I+ LC    +D+A      M    +SP  
Sbjct  522  INEGKFLEAEELYEEMPHRGIVPDTITYSSMIDGLCKQSRLDEATQMFDSMGSKSFSPNV  581

Query  661  FTFCNVIRALCADGKVDGALSVLSLMHRR  575
             TF  +I   C  G+VD  L +   M RR
Sbjct  582  VTFTTLINGYCKAGRVDDGLELFCEMGRR  610



>gb|KFK43289.1| hypothetical protein AALP_AA1G104700 [Arabis alpina]
Length=594

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (51%), Gaps = 9/126 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV DR  +R    +   Y ++IEA C    V++A+  L EM   G +P   T+  
Sbjct  213  LKQAMEVLDRQLQRDCYPDVITYTILIEATCKESGVEQAMKLLDEMRERGCTPDVVTYNV  272

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++  +C +G++D A+  L+ M        G  P    +NI+++ +   GR +DA  + A 
Sbjct  273  LVNGICKEGRLDEAIKFLNDMPS-----YGCQPNVITHNIILRSMCSTGRWMDAEKLLAE  327

Query  478  ALKRGL  461
             L++G 
Sbjct  328  MLRKGF  333


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++ ++M +        +Y  ++   C  K++D+A+  L  MV  G  P   T+  ++ 
Sbjct  356  AIDILEKMPKHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLT  415

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRA  506
            ALC DGKV+ A+ +L+ +  +    V    YN +I  L++ G+ 
Sbjct  416  ALCKDGKVEDAVEILNQLSSKGCSPV-LITYNTVIDGLSKAGKT  458



>ref|XP_010540327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
 ref|XP_010540328.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +  +M E  I V    Y  +I+ LC G  +D AL     M   G+ P   T+  +I 
Sbjct  245  ALNLLMKMEEMNIEVNVIMYNTIIDGLCKGGHIDDALNLFEMMDNKGFVPNVVTYNCLIN  304

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
             LC  G+  GA+ +L+ M +R +       +N LI  L+++G+ L+ + +Y   ++RG L
Sbjct  305  GLCVFGRWKGAVLLLNEMVKR-KISPDVVTFNGLIDALSKEGKFLETKELYEEMIRRG-L  362

Query  457  VP  452
            VP
Sbjct  363  VP  364



>ref|XP_010494656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like [Camelina sativa]
Length=637

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A E+  +M ERK+ ++   Y ++I+ LC    +D AL    EM   G      T+  +IR
Sbjct  247  AMELLRKMEERKMKLDAAKYNIIIDGLCKDGSLDDALNLFNEMEVKGIKSNIITYNTLIR  306

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C DG+ D    +L  M  R+        +++LI    ++G+ L+A  +Y   + RG+
Sbjct  307  GFCNDGRWDDGAQLLRDMITRN-ITPDVVTFSVLIDSFVKEGKLLEAEKLYKEMITRGI  364


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 58/121 (48%), Gaps = 1/121 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            D  E+F  M  R +V +   Y  +I   C   +++ A     EMV  G  P   T+  ++
Sbjct  421  DGLELFRAMSLRGVVADTVTYNTLIHGFCQSGKLNVAKELFQEMVSRGVPPNIVTYKILL  480

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              LC  G++  AL +   + ++S+  +    YNI+I  +   G+  DA ++++    RG+
Sbjct  481  DGLCDSGELKKALEIFEKI-QKSKMELDIGIYNIIIHGMCNDGKVDDAWDLFSGLPLRGV  539

Query  460  L  458
            +
Sbjct  540  M  540



>ref|XP_010530350.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like 
[Tarenaya hassleriana]
Length=636

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 2/122 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  +  +M ER I V  R Y ++I+ LC G  +D AL+   +M   G +P   T+  +I 
Sbjct  245  ALNLLMKMEERNIEVNVRIYSMIIDGLCKGGHIDDALSLFDKMDSKGIAPNVVTYSCLIN  304

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
             LC   + + A+ +L+ M +R +       +N LI    ++G+ L+A+ +    ++RG L
Sbjct  305  GLCVFDRWNDAVRLLNDMAKR-KITPDVVTFNGLIDAFVKEGKFLEAKELCEEMIRRG-L  362

Query  457  VP  452
            VP
Sbjct  363  VP  364



>ref|XP_007215907.1| hypothetical protein PRUPE_ppa004160mg [Prunus persica]
 gb|EMJ17106.1| hypothetical protein PRUPE_ppa004160mg [Prunus persica]
Length=526

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 72/160 (45%), Gaps = 16/160 (10%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A ++FD M ER  +V+  AY   +EALC G +VD+A      M   G  P   T+   I
Sbjct  237  EARKLFDEMTERGCLVDVPAYNSYLEALCKGGKVDEAYKIFRGMGSNGTDPDACTYSIFI  296

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +     VL  M +R         YN +IK+L +  +  +A  +    ++RG+
Sbjct  297  RAYCEANDIHSVFRVLDRM-KRYNLLPNVYSYNCIIKKLCKNDKVEEAYELLDEMIERGV  355

Query  460  LVPRKKPIQFSAKA-QAPHIANG*ILLLCEICHGSDLLRL  344
            +     P  +S  A QA H         C+ C  +  LRL
Sbjct  356  M-----PDAWSYNAIQAHH---------CDHCEVNRALRL  381



>ref|XP_008805876.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Phoenix dactylifera]
Length=337

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 58/121 (48%), Gaps = 2/121 (2%)
 Frame = -2

Query  823  RDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRI-GYSPGRFTFCN  647
            + A E+FD M +R  + +  AY  +I ALC G E+D+A   L EM R  G  P   T+  
Sbjct  61   KKALELFDEMLQRGCLADAVAYNTLIMALCRGGEIDEAHRRLQEMQRDRGLKPDAGTYSA  120

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
             IRA C    V  A+ VL  M R       F  YN +IK L  +   ++A  +    L R
Sbjct  121  FIRASCEAKDVHSAMRVLDTMKRHDLSPNVF-TYNAIIKLLCEKENVVEAYELLDEMLHR  179

Query  466  G  464
            G
Sbjct  180  G  180


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 59/121 (49%), Gaps = 2/121 (2%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +AYE+ D M  R    +  +Y  ++   C   EV+KAL  L  MVR    P R T+  ++
Sbjct  168  EAYELLDEMLHRGAKPDAWSYNAILAVHCKLHEVNKALRLLARMVRDSCLPDRHTYNMLL  227

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNR-QGRALDARNVYAAALKRG  464
            + L   G++D A+ V   M +R  F+     + ++I  L R +GR  +A   +   +  G
Sbjct  228  KMLIGVGRIDRAMEVWDGMEKRG-FYPSASTFAVMIHGLCRKKGRIEEACQYFEVMVDEG  286

Query  463  L  461
            +
Sbjct  287  I  287



>gb|KDP44205.1| hypothetical protein JCGZ_05672 [Jatropha curcas]
Length=730

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A  + D MRER IV     Y ++IE  C      KA   L EMV  G  P  +T+  
Sbjct  341  MAEAIRLLDEMRERNIVPNEVTYNVMIEGYCREGNTVKAFGLLDEMVEKGLVPDTYTYRP  400

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G+   A   +  +H+ +R  V    Y +L+    ++GR  +A N     ++R
Sbjct  401  LISGLCSTGRASEAKEFIDDLHKMNR-KVNEMCYGVLLHGFCKEGRFREALNASREMVER  459

Query  466  GL  461
            G+
Sbjct  460  GV  461



>ref|XP_004152353.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, 
mitochondrial [Cucumis sativus]
 gb|KGN52881.1| hypothetical protein Csa_4G004910 [Cucumis sativus]
Length=529

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A +VFD MRER  +++  AY  ++EALC G + D+A    +EM   G  P   T+   I
Sbjct  238  NAQKVFDEMRERGCLIDVLAYNSLLEALCKGGKRDEAYKMFLEMDSNGVDPDADTYSIFI  297

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            R+ C +  +     VL    R++     F  YN +IK+L +     +A  +    ++RG+
Sbjct  298  RSSCQENDLHTVYRVLERTKRKNLLPNVF-TYNCVIKKLCKDQNVEEAYQILDEMIERGV  356


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 3/123 (2%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L   Y V +R + + ++     Y  VI+ LC  + V++A   L EM+  G +P  +++ N
Sbjct  306  LHTVYRVLERTKRKNLLPNVFTYNCVIKKLCKDQNVEEAYQILDEMIERGVTPDTWSY-N  364

Query  646  VIRAL-CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             I+A  C   +V+ AL+++  M  R +       YN+++K L R GR   A  V+ +  K
Sbjct  365  AIQAYHCDHSEVNSALNLVKRMD-RDKCVPDKHTYNMVLKLLVRVGRFDRANEVWESMGK  423

Query  469  RGL  461
            RG 
Sbjct  424  RGF  426



>dbj|BAR42903.1| RFL6, partial [Rapistrum rugosum]
Length=161

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 59/118 (50%), Gaps = 3/118 (3%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            E+ DRM E K+V     +  ++  LC    + +A+A +  M+ IG  P +FT+  ++ ++
Sbjct  1    ELVDRMVEMKVVPHLIIFNTIVNGLCLQDRLSEAMALIDRMLAIGCQPDQFTYGPILNSM  60

Query  631  CADGKVDGALSVLSLM-HRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            C  G    +L +   M HR+ +  V    YNI+I  L + G   DA +++     +G 
Sbjct  61   CKSGNTSSSLDLYRKMEHRKVKPHV--VTYNIIIDSLCKDGSLDDALSLFNEMETKGF  116



>gb|EYU28385.1| hypothetical protein MIMGU_mgv1a003336mg [Erythranthe guttata]
Length=591

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 12/115 (10%)
 Frame = -2

Query  763  AYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRALCADGKVDGALSVLSLM  584
             Y ++I  LC    +D+A+  LVEM+   Y P   T+  ++RALC +  +D A+ VL  +
Sbjct  384  TYNILINGLCKHGLLDRAIDFLVEMISHDYCPDIITYNTLLRALCKEEMIDEAVEVLRWL  443

Query  583  HRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALKRGLLVPRKKPIQF  431
              R     GF P    YNI+I  L + G       VYA  ++RG   PR   + +
Sbjct  444  SDR-----GFSPTLITYNIVIDGLAKLGFMEKTMEVYACMVERG---PRPDDVTY  490



>ref|XP_002305285.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE85796.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=523

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A +VFD M  R   ++  AY  ++EALC G  VD+A     E+   G  P   ++   I
Sbjct  235  EARKVFDEMLGRGCALDVLAYNSLLEALCKGGNVDEAYKMFREIGSHGVEPDACSYAIFI  294

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
            RA C    +    SVL  M R       F  YN +IK+L + G+  DA  +    ++RG+
Sbjct  295  RAYCEANNIHSVFSVLDRMKRYDLVPNVF-TYNCIIKKLCKNGKVEDAYQLLHEMMERGV  353


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            +   + V DRM+   +V     Y  +I+ LC   +V+ A   L EM+  G SP  +++  
Sbjct  303  IHSVFSVLDRMKRYDLVPNVFTYNCIIKKLCKNGKVEDAYQLLHEMMERGVSPDAWSYNT  362

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C   +V+ A  ++S+M  +         YN+L+K L R GR   A  ++ +  +R
Sbjct  363  ILAYHCEHSEVNRATKLISIM-VKDNCLPDRHSYNMLLKLLVRVGRFDRATEIWESMGER  421

Query  466  GL  461
            G 
Sbjct  422  GF  423



>ref|XP_010107145.1| hypothetical protein L484_019627 [Morus notabilis]
 gb|EXC13666.1| hypothetical protein L484_019627 [Morus notabilis]
Length=458

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 65/124 (52%), Gaps = 9/124 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY++F++M ER +V    +Y ++++ LC   +V+ A+  L +M+  G++P   ++  ++ 
Sbjct  206  AYQLFNKMFERDLVPNDESYRILMQGLCRKGQVNTAVDFLEDMLNKGFTPDTLSYTTLLN  265

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
            +LC   ++  A  +L  M  +     G  P    YN +I    R+GRA+DA  V     +
Sbjct  266  SLCRKKQLREAYKLLCRMKVK-----GCNPDIVHYNTVIVGFCREGRAMDACKVLEDMAE  320

Query  469  RGLL  458
             G L
Sbjct  321  NGCL  324



>ref|XP_004512803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X1 [Cicer arietinum]
 ref|XP_004512804.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like isoform X2 [Cicer arietinum]
Length=567

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 9/123 (7%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A  +F  M+ RKIV     Y  +I+ LC    +  AL  + EM   G  P  +T+ +++
Sbjct  378  EAMNLFKEMQSRKIVPNVVTYSSLIDGLCRSGRITYALELVCEMHDRGQPPNIYTYSSIL  437

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAAL  473
             ALC    VD A+++L          +G  P    YNIL+  L + GR  D++ ++   L
Sbjct  438  DALCKSHDVDKAIALLKKFKD-----LGIQPNMCTYNILLNGLCKSGRIKDSQKIFEYLL  492

Query  472  KRG  464
             +G
Sbjct  493  VKG  495



>ref|XP_006417237.1| hypothetical protein EUTSA_v10007258mg [Eutrema salsugineum]
 gb|ESQ35590.1| hypothetical protein EUTSA_v10007258mg [Eutrema salsugineum]
Length=559

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            D  ++F +M  R +V +   Y  +I+  C   +++ A     EMV +G  P   T+  ++
Sbjct  343  DGLKLFRKMSLRGVVADTVTYSTLIQGFCQSGKINAAKEIFQEMVSLGVPPSVVTYGILL  402

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              LC +G+V+ AL +L  M ++S+  +G   YNI++  +    +  DA +++ +   +G+
Sbjct  403  DGLCDNGEVEKALEILGKM-QKSKMDLGIAIYNIILHGMCNASKVDDAWDLFCSLPLKGV  461



>gb|KDP23717.1| hypothetical protein JCGZ_23550 [Jatropha curcas]
Length=584

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A EVF ++ E        +Y  +  AL +  +  +AL  ++EM+  G  P   T+ ++I 
Sbjct  403  ALEVFQKLNEVGCPPTVSSYNTMFSALWSCGDKYRALGMILEMLNQGIDPDEITYNSLIS  462

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
             LC DG V+ A+ +L  M + SRF      YNI++  L +  R  DA  V AA +++G
Sbjct  463  CLCRDGMVNEAIGLLVDMEK-SRFQPNIVSYNIILLGLCKANRVNDAIEVLAAIIEKG  519



>ref|XP_004512700.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, 
mitochondrial-like [Cicer arietinum]
Length=567

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 9/123 (7%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A  +F  M+ RKIV     Y  +I+ LC    +  AL  + EM   G  P  +T+ +++
Sbjct  378  EAMNLFKEMQSRKIVPNVVTYSSLIDGLCRSGRITYALELVCEMHDRGQPPNIYTYSSIL  437

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAAL  473
             ALC    VD A+++L          +G  P    YNIL+  L + GR  D++ ++   L
Sbjct  438  DALCKSHDVDKAIALLKKFKD-----LGIQPNMCTYNILLNGLCKSGRIKDSQKIFEYLL  492

Query  472  KRG  464
             +G
Sbjct  493  VKG  495



>ref|NP_001136745.1| hypothetical protein [Zea mays]
 gb|ACF82524.1| unknown [Zea mays]
 tpg|DAA53111.1| TPA: hypothetical protein ZEAMMB73_920038 [Zea mays]
Length=421

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 60/129 (47%), Gaps = 3/129 (2%)
 Frame = -2

Query  835  EWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFT  656
            +W  R    + D M+E+ +  +   Y ++I ALC   EV KA+  L EMV +G  P    
Sbjct  263  DW--RSVSGLLDEMKEKGVKADVVTYNVLIGALCCKGEVRKAVKLLDEMVEVGLEPKHVA  320

Query  655  FCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAA  476
            +  +I   C  G   GA  +   M +R +       YN+ +K   + G+  +A  V    
Sbjct  321  YNTIINGFCEKGDAQGAHEIRLRMEKRKK-RANVVTYNVFLKYFCKMGKMDEANVVLNEM  379

Query  475  LKRGLLVPR  449
            L++GL+  R
Sbjct  380  LEKGLVPNR  388



>ref|XP_012089335.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X2 [Jatropha curcas]
Length=614

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A EVF ++ E        +Y  +  AL +  +  +AL  ++EM+  G  P   T+ ++I 
Sbjct  443  ALEVFQKLNEVGCPPTVSSYNTMFSALWSCGDKYRALGMILEMLNQGIDPDEITYNSLIS  502

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
             LC DG V+ A+ +L  M + SRF      YNI++  L +  R  DA  V AA +++G
Sbjct  503  CLCRDGMVNEAIGLLVDMEK-SRFQPNIVSYNIILLGLCKANRVNDAIEVLAAIIEKG  559



>ref|XP_009767090.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009767092.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009767093.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009767094.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like 
isoform X1 [Nicotiana sylvestris]
Length=899

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 9/127 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  A+ VFDRM +  I      Y  +I  LC    VD+AL  L EM+  G  P  +T+  
Sbjct  246  LDAAFMVFDRMVQDGIDPNAATYTTLINGLCTEGRVDEALGMLEEMIVKGIEPTVYTYTV  305

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
             + +LCA G+   A+ ++  M +R     G  P    Y  LI  L++ G    A  +Y  
Sbjct  306  PVSSLCAVGREKEAVDLVVSMRKR-----GCEPNVQTYTALISGLSQSGHLEVAIGLYHN  360

Query  478  ALKRGLL  458
             L++GLL
Sbjct  361  MLRKGLL  367


 Score = 58.9 bits (141),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L +A  + D M+      +   Y  ++   C   ++D A A   EM++ G SP +  +  
Sbjct  456  LDNAVRLLDLMKNNGCKPDEWTYAELVSGFCKRGKLDSASALFQEMIKHGLSPNQVNYTA  515

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  L  +GKVD AL++L  M   S    G   YN +I  L++Q R L+A  +     + 
Sbjct  516  LIDGLSKEGKVDDALALLKRM-EESGCSPGIETYNAIINGLSKQNRLLEAERLCNKIAES  574

Query  466  GLL  458
            GLL
Sbjct  575  GLL  577



>gb|KHN39972.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=611

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 9/123 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A  V + M +       R++  +I+  CNGK +D+A+  L  MV  G  P   T+  V+ 
Sbjct  340  ALNVLEMMPKHGHTPNSRSFNPLIQGFCNGKGIDRAIEYLEIMVSRGCYPDIVTYNIVLT  399

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
            ALC DGKVD A+ +LS +  +     G  P    YN +I  L + G+   A  ++    +
Sbjct  400  ALCKDGKVDDAVVILSQLSSK-----GCSPSLISYNTVIDGLLKVGKTECAIELFEEMCR  454

Query  469  RGL  461
            +GL
Sbjct  455  KGL  457



>ref|XP_010453827.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, 
mitochondrial-like [Camelina sativa]
Length=506

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            DA  +F+RM E         Y  VI+ LC  K+VD AL  L  M   G  P   T+ ++I
Sbjct  171  DALYMFERMVEMGYKPNVVIYNTVIDGLCKSKQVDNALDLLNRMENDGVRPDAVTYNSLI  230

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              LC  G+   A  ++S M +R  +   F  +N LI    ++G  L+A  +Y   ++R L
Sbjct  231  SGLCNSGRWSDATRMVSYMTKREIYPDVF-TFNALIDACVKEGNILEAEELYEEMIRRSL  289


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = -2

Query  811  EVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIRAL  632
            ++F  M +R ++     Y ++I+  C   +++ A      MV  G +P   T+  ++  L
Sbjct  349  KLFCEMSQRGVIRNAVTYTILIQGYCRAGKLNVAEEIFRRMVFSGVTPNIVTYNVLLHGL  408

Query  631  CADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            C +GK++ AL +L+ M ++S        YNI+I  + + G   DA ++Y +   +GL+
Sbjct  409  CGNGKIEKALVILADM-QKSGMDADIVTYNIIIGGMCKAGEVADAWDLYCSLNHKGLM  465



>ref|XP_012089334.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, 
chloroplastic isoform X1 [Jatropha curcas]
Length=624

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A EVF ++ E        +Y  +  AL +  +  +AL  ++EM+  G  P   T+ ++I 
Sbjct  443  ALEVFQKLNEVGCPPTVSSYNTMFSALWSCGDKYRALGMILEMLNQGIDPDEITYNSLIS  502

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRG  464
             LC DG V+ A+ +L  M + SRF      YNI++  L +  R  DA  V AA +++G
Sbjct  503  CLCRDGMVNEAIGLLVDMEK-SRFQPNIVSYNIILLGLCKANRVNDAIEVLAAIIEKG  559



>gb|EEC67240.1| hypothetical protein OsI_34171 [Oryza sativa Indica Group]
Length=458

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 1/119 (1%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            AY  +  M  R+I      Y  +I ALC  + +DKA+  L  MV+ G  P   T+ +++ 
Sbjct  223  AYSTYHEMLGRRISPNVVTYSSIIAALCKAQAMDKAMEVLNTMVKNGVMPDCMTYSSILH  282

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              C+ G+    +  L+ M R          Y  L+  L + GR   AR ++ +  KRGL
Sbjct  283  GYCSSGQPKEDIGTLNKM-RSDGVEPNVVTYRSLMNYLCKNGRCTKARKIFDSMTKRGL  340



>ref|XP_011627875.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g09900 [Amborella trichopoda]
Length=605

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 1/123 (1%)
 Frame = -2

Query  829  VLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFC  650
            ++R A +V +RM E        +Y  ++   C  K +D+ +  L  MV  G  P   T+ 
Sbjct  366  LMRRAIDVLERMPEHGCTPNSLSYNPILHGFCKEKNMDRVIEYLEVMVLRGCFPDIVTYN  425

Query  649  NVIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALK  470
             ++ ALC DGKVD AL +L  +  +    V    YN +I  L++ G+  +A  +    + 
Sbjct  426  TLLTALCKDGKVDAALEILRQLRSKGCSPV-LITYNTVIDGLSKMGKTEEAIELXNEMVA  484

Query  469  RGL  461
            +GL
Sbjct  485  KGL  487


 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (49%), Gaps = 9/129 (7%)
 Frame = -2

Query  838  NEWVLRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRF  659
            +E  L+ A EV DRM  R    +   Y ++IEA C    V +A+  L EM   G  P   
Sbjct  223  DEGKLKQAMEVLDRMMNRGCFPDVITYTILIEATCKESGVGQAMKLLDEMRSKGCKPDVV  282

Query  658  TFCNVIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARN  491
            T+  +I  +C +GK++ A+  L+ M        G  P    +NI+++ +   GR +DA  
Sbjct  283  TYNVLINGICKEGKLNEAIKFLNSMPS-----YGCRPNVITHNIILRSMCSTGRWMDAEK  337

Query  490  VYAAALKRG  464
            + +  ++ G
Sbjct  338  LLSEMIENG  346



>gb|KJB49640.1| hypothetical protein B456_008G131000 [Gossypium raimondii]
 gb|KJB49641.1| hypothetical protein B456_008G131000 [Gossypium raimondii]
Length=458

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (52%), Gaps = 9/127 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY++F++M ER ++ +  +Y ++++ LC   +V++A+  L +M+  G+ P   ++  
Sbjct  207  LSIAYKLFNKMFERDVMPDVESYRILMQGLCRKSQVNRAVDLLEDMLNKGFEPDSLSYTT  266

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++ +LC   K+  A  +L  M  +     G  P    YN +I    R+GRA+DA  V   
Sbjct  267  LLNSLCRKKKLREAYKLLCRMKVK-----GCNPDIVHYNTVILGFCREGRAMDAVKVLED  321

Query  478  ALKRGLL  458
                G L
Sbjct  322  MPSNGCL  328



>ref|XP_010490447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 
[Camelina sativa]
Length=600

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+ A EV +RM +R    +   Y ++IEA C    V +A+  L EM   G +P   T+  
Sbjct  222  LKQAMEVLNRMLQRDCYPDVITYTILIEATCRDSGVGQAMKLLDEMRDRGCTPDVVTYNV  281

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++  +C +G++D A+  L+ M   S        +NI+++ +   GR +DA  + A  L++
Sbjct  282  LVNGICKEGRLDEAIKFLNDMPS-SGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRK  340

Query  466  GL  461
            G 
Sbjct  341  GF  342



>gb|KHN32303.1| Putative pentatricopeptide repeat-containing protein [Glycine 
soja]
Length=827

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            + +A E+FD + ER I      Y ++IE  C   ++DKA   L +M + G  P  +T+  
Sbjct  445  MAEASELFDELVERNIKPTEVTYNVLIEGYCRDGKIDKAFELLEDMHQKGLIPDTYTYRP  504

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            +I  LC+ G++  A   +  +H+++   +    Y+ L+    R+GR ++A +     ++R
Sbjct  505  LISGLCSTGRISKAKDFIDGLHKQNA-KLNEMCYSALLHGYCREGRLMEALSASCEMIQR  563

Query  466  GL  461
            G+
Sbjct  564  GI  565



>ref|XP_011038920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820-like 
[Populus euphratica]
Length=731

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 1/126 (1%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            ++ A  + + M  +K+  +   Y ++I++LC   E  KA+  L EM   G +P   T+  
Sbjct  573  VKAARNLINEMVSKKLSADVVTYNILIDSLCKKGESRKAVKLLDEMFEKGLNPSHVTYNT  632

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKR  467
            ++   C +G +  AL V + M R+ +       YN+LIK    +GR  DA  +    L+R
Sbjct  633  LMDGYCREGNLRAALIVRTRMERKGK-QANVVTYNVLIKGFCLKGRLEDANGLLNEMLER  691

Query  466  GLLVPR  449
            GL+  R
Sbjct  692  GLVPNR  697



>ref|XP_003620148.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|ACJ85849.1| unknown [Medicago truncatula]
 gb|AES76366.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=465

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 9/125 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L+DA ++F++M    I  +   + ++++  C   ++  AL  + EM   G  P   T+ +
Sbjct  278  LKDAVDLFNKMISENIKPDVYTFNILVDVFCKSGKISYALKLVDEMHDRGQPPNIVTYSS  337

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++ ALC   +VD A+++L+ +  +     G  P    Y ILI  L   G+  DARN++  
Sbjct  338  ILDALCKTHRVDKAVALLTKLKDQ-----GIRPNMHTYTILIDGLCTSGKLEDARNIFED  392

Query  478  ALKRG  464
             L +G
Sbjct  393  LLVKG  397



>ref|XP_009118082.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, 
mitochondrial-like isoform X2 [Brassica rapa]
Length=524

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A ++  +M  RKI ++   Y  +I++LC    ++ AL+   EM   G  P  FT+ ++IR
Sbjct  239  ALDLLRKMEHRKIKLDAVTYNFIIDSLCKDGSLEDALSLFNEMETKGIKPNVFTYNSLIR  298

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAAALK  470
              C+ G+ D    +L  M  R     G  P    +N LI    + G+  +A+++Y   + 
Sbjct  299  GFCSAGRWDDGAPLLRDMITR-----GITPTVITFNSLIDSFVKVGKLTEAQDLYNEMIT  353

Query  469  RG  464
            RG
Sbjct  354  RG  355


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 60/131 (46%), Gaps = 6/131 (5%)
 Frame = -2

Query  820  DAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVI  641
            +A E+ DRM E +++        ++  LC   EV +A+A +  M+  G  P   T+  V+
Sbjct  168  EAVELVDRMVEMEVIPNLITLNTIVNGLCLQGEVSEAMALIDRMMDNGCQPNERTYGPVL  227

Query  640  RALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGL  461
              +C  G    AL +L  M  R +  +    YN +I  L + G   DA +++     +G+
Sbjct  228  NRMCKSGNTALALDLLRKMEHR-KIKLDAVTYNFIIDSLCKDGSLEDALSLFNEMETKGI  286

Query  460  LVPRKKPIQFS  428
                 KP  F+
Sbjct  287  -----KPNVFT  292



>emb|CDP10983.1| unnamed protein product [Coffea canephora]
Length=775

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = -2

Query  817  AYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCNVIR  638
            A++   +M++  +  +   Y   ++A C    + +AL   ++M R+G +P  FT+ ++I 
Sbjct  364  AFDFLRQMKDSGLKPDTVTYSTFVDAFCKEGLLQQALKFYLDMWRVGLTPNEFTYTSLID  423

Query  637  ALCADGKVDGALSVLSLMHRRSRFWVGFPPYNILIKELNRQGRALDARNVYAAALKRGLL  458
            A C  GK+D AL +L  M       +    Y +L+  L  +G+  +A  V+ A  K G +
Sbjct  424  ANCKAGKLDDALKLLKEMLEMG-CKLNIVTYTVLVDGLCEEGKMKEAEEVFIAMEKDG-I  481

Query  457  VPRKK  443
            +P +K
Sbjct  482  IPNEK  486



>gb|ADE76539.1| unknown [Picea sitchensis]
Length=486

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 9/127 (7%)
 Frame = -2

Query  826  LRDAYEVFDRMRERKIVVEHRAYELVIEALCNGKEVDKALASLVEMVRIGYSPGRFTFCN  647
            L  AY +F++M ++  + +   Y ++++ LC   +V  AL  L EM+  GY P   T+  
Sbjct  254  LSHAYFLFNKMHKQGCIPDVETYSILMQGLCRKSQVKTALGVLDEMLNKGYVPDALTYNT  313

Query  646  VIRALCADGKVDGALSVLSLMHRRSRFWVGFPP----YNILIKELNRQGRALDARNVYAA  479
            ++ +LC    +  A  +LS M       +G  P    YN +I    R+GRALDA  +   
Sbjct  314  LLNSLCRKMNLREAYRLLSKMK-----VMGCNPDVINYNTVITGFCREGRALDACQILRD  368

Query  478  ALKRGLL  458
              + G L
Sbjct  369  MPENGCL  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1867489308488