BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8313

Length=931
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               387   1e-126   Nicotiana sylvestris
gb|KJB23542.1|  hypothetical protein B456_004G104100                    374   2e-124   Gossypium raimondii
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    381   3e-124   Eucalyptus grandis [rose gum]
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               381   3e-124   Sesamum indicum [beniseed]
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    379   2e-123   Cucumis melo [Oriental melon]
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 378   4e-123   
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3                    376   2e-122   Cucumis sativus [cucumbers]
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               375   6e-122   Nicotiana tomentosiformis
ref|XP_011016520.1|  PREDICTED: protein ECERIFERUM 3-like               360   1e-121   Populus euphratica
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    374   2e-121   Vitis vinifera
gb|KJB23543.1|  hypothetical protein B456_004G104100                    373   2e-121   Gossypium raimondii
gb|KJB23541.1|  hypothetical protein B456_004G104100                    373   4e-121   Gossypium raimondii
gb|KJB23544.1|  hypothetical protein B456_004G104100                    373   5e-121   Gossypium raimondii
gb|KHG27245.1|  Protein WAX2                                            373   5e-121   Gossypium arboreum [tree cotton]
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               372   1e-120   Nicotiana sylvestris
emb|CDP02895.1|  unnamed protein product                                371   4e-120   Coffea canephora [robusta coffee]
ref|XP_012071608.1|  PREDICTED: protein ECERIFERUM 3                    369   1e-119   Jatropha curcas
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         370   1e-119   Prunus mume [ume]
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             369   2e-119   Prunus persica
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               368   3e-119   Solanum tuberosum [potatoes]
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    368   4e-119   Solanum lycopersicum
gb|KJB83325.1|  hypothetical protein B456_013G242200                    364   7e-119   Gossypium raimondii
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               367   7e-119   Glycine max [soybeans]
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                   365   7e-119   Citrus sinensis [apfelsine]
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   366   3e-118   Citrus sinensis [apfelsine]
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               366   3e-118   Glycine max [soybeans]
gb|KHG30512.1|  Protein WAX2 -like protein                              365   3e-118   Gossypium arboreum [tree cotton]
gb|KHN17538.1|  Protein WAX2                                            365   5e-118   Glycine soja [wild soybean]
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    365   5e-118   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB83324.1|  hypothetical protein B456_013G242200                    364   5e-118   Gossypium raimondii
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              365   6e-118   Medicago truncatula
gb|KJB83323.1|  hypothetical protein B456_013G242200                    364   8e-118   Gossypium raimondii
gb|KJB83318.1|  hypothetical protein B456_013G242200                    364   1e-117   Gossypium raimondii
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             365   1e-117   
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             364   2e-117   Citrus clementina [clementine]
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    363   3e-117   Populus euphratica
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             363   4e-117   
gb|KHG27244.1|  Protein WAX2                                            363   1e-116   Gossypium arboreum [tree cotton]
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               360   3e-116   Solanum tuberosum [potatoes]
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    360   4e-116   Fragaria vesca subsp. vesca
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               358   4e-115   Sesamum indicum [beniseed]
emb|CDY32747.1|  BnaA02g08090D                                          357   9e-115   Brassica napus [oilseed rape]
gb|ACN25216.1|  unknown                                                 348   1e-114   Zea mays [maize]
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               357   1e-114   Cicer arietinum [garbanzo]
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    356   2e-114   Nicotiana tomentosiformis
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    356   2e-114   Nicotiana tomentosiformis
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               355   5e-114   Phoenix dactylifera
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               355   7e-114   Sesamum indicum [beniseed]
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                354   9e-114   Erythranthe guttata [common monkey flower]
ref|NP_001131238.1|  gl1 protein                                        345   1e-113   
gb|AFW87579.1|  hypothetical protein ZEAMMB73_499314                    348   1e-113   
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920          353   1e-113   Sorghum bicolor [broomcorn]
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    354   1e-113   Brassica rapa
emb|CDY02769.1|  BnaC02g11200D                                          353   2e-113   
emb|CDY50795.1|  BnaCnng19590D                                          353   3e-113   Brassica napus [oilseed rape]
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               353   4e-113   Nicotiana sylvestris
gb|KJB27033.1|  hypothetical protein B456_004G273200                    351   8e-113   Gossypium raimondii
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    351   1e-112   Brassica rapa
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    351   1e-112   Elaeis guineensis
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog                349   1e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KJB27032.1|  hypothetical protein B456_004G273200                    351   1e-112   Gossypium raimondii
emb|CDY51280.1|  BnaA10g11680D                                          351   1e-112   Brassica napus [oilseed rape]
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    351   2e-112   Nelumbo nucifera [Indian lotus]
dbj|BAJ85039.1|  predicted protein                                      351   2e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146749.1|  uncharacterized protein LOC100280351               345   2e-112   Zea mays [maize]
gb|ACF79426.1|  unknown                                                 343   2e-112   Zea mays [maize]
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    350   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               350   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88639.1|  BnaA03g10100D                                          350   4e-112   
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             350   4e-112   Eutrema salsugineum [saltwater cress]
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               349   6e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_200588.2|  protein ECERIFERUM 3                                  349   7e-112   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87617.1|  predicted protein                                      349   7e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    350   8e-112   
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like               348   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             349   1e-111   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    348   2e-111   
ref|NP_001266321.1|  gl1 protein                                        348   2e-111   
emb|CDO98263.1|  unnamed protein product                                350   2e-111   Coffea canephora [robusta coffee]
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    348   3e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             348   3e-111   Capsella rubella
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         348   3e-111   Tarenaya hassleriana [spider flower]
gb|ACN25689.1|  unknown                                                 348   3e-111   Zea mays [maize]
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               347   4e-111   Setaria italica
emb|CDY11848.1|  BnaC03g12740D                                          347   4e-111   Brassica napus [oilseed rape]
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               347   5e-111   Camelina sativa [gold-of-pleasure]
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    347   6e-111   Phoenix dactylifera
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          346   1e-110   Sorghum bicolor [broomcorn]
emb|CDY11847.1|  BnaC03g12730D                                          346   1e-110   Brassica napus [oilseed rape]
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    346   2e-110   Sesamum indicum [beniseed]
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    346   2e-110   Sesamum indicum [beniseed]
gb|EMS67420.1|  Protein WAX2                                            347   3e-110   Triticum urartu
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               345   4e-110   Camelina sativa [gold-of-pleasure]
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like               345   4e-110   Brachypodium distachyon [annual false brome]
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               344   4e-110   Vitis vinifera
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3         344   4e-110   
emb|CBI25244.3|  unnamed protein product                                344   5e-110   Vitis vinifera
gb|ACN25333.1|  unknown                                                 344   6e-110   Zea mays [maize]
gb|AAR90847.1|  glossy1 protein                                         344   7e-110   Zea mays [maize]
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         344   8e-110   Solanum lycopersicum
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like               345   8e-110   Solanum tuberosum [potatoes]
tpg|DAA61563.1|  TPA: glossy1                                           344   8e-110   
ref|NP_001058237.1|  Os06g0653000                                       344   8e-110   
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         344   8e-110   Solanum lycopersicum
gb|EAZ01917.1|  hypothetical protein OsI_23945                          344   9e-110   Oryza sativa Indica Group [Indian rice]
gb|AAB87722.1|  glossy1 homolog                                         342   1e-109   Oryza sativa Japonica Group [Japonica rice]
gb|KHG04939.1|  Protein WAX2                                            343   1e-109   Gossypium arboreum [tree cotton]
ref|NP_001046080.1|  Os02g0178800                                       343   1e-109   
gb|EEC72610.1|  hypothetical protein OsI_06088                          343   1e-109   Oryza sativa Indica Group [Indian rice]
gb|AGT16346.1|  glossy1 protein                                         343   2e-109   Saccharum hybrid cultivar R570
ref|NP_001105247.1|  glossy1                                            343   2e-109   Zea mays [maize]
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               343   2e-109   Brachypodium distachyon [annual false brome]
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               343   2e-109   Vitis vinifera
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    343   2e-109   Setaria italica
emb|CBI25242.3|  unnamed protein product                                342   3e-109   Vitis vinifera
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         342   4e-109   Elaeis guineensis
emb|CDX88640.1|  BnaA03g10090D                                          341   4e-109   
dbj|BAK04216.1|  predicted protein                                      340   4e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               342   6e-109   Brassica rapa
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               341   7e-109   Setaria italica
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like               341   1e-108   
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               340   1e-108   Elaeis guineensis
ref|XP_008775261.1|  PREDICTED: protein ECERIFERUM 3-like               335   2e-108   Phoenix dactylifera
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    340   2e-108   Brassica rapa
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like               340   3e-108   
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    339   4e-108   
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    343   4e-108   
ref|NP_001063227.1|  Os09g0426800                                       338   1e-107   
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          338   1e-107   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85064.1|  predicted protein                                      339   2e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               337   2e-107   Brachypodium distachyon [annual false brome]
dbj|BAK02959.1|  predicted protein                                      336   9e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04110.1|  predicted protein                                      333   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                335   2e-106   Erythranthe guttata [common monkey flower]
gb|ERN07159.1|  hypothetical protein AMTR_s00019p00142280               330   2e-105   Amborella trichopoda
ref|XP_006845484.2|  PREDICTED: protein ECERIFERUM 3                    330   2e-104   Amborella trichopoda
emb|CDX88642.1|  BnaA03g10070D                                          330   2e-104   
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               328   6e-104   Setaria italica
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                322   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_004252089.1|  PREDICTED: protein ECERIFERUM 3-like               308   7e-101   Solanum lycopersicum
gb|ADE77418.1|  unknown                                                 308   4e-100   Picea sitchensis
gb|ERM99525.1|  hypothetical protein AMTR_s00088p00066300               307   6e-99    Amborella trichopoda
ref|XP_001781794.1|  predicted protein                                  315   2e-98    
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680             310   7e-97    Selaginella moellendorffii
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167             310   7e-97    Selaginella moellendorffii
gb|EMT23422.1|  Protein WAX2                                            312   9e-97    
gb|ADE75704.1|  unknown                                                 308   3e-96    Picea sitchensis
ref|XP_006836672.2|  PREDICTED: protein ECERIFERUM 3                    306   3e-95    Amborella trichopoda
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         296   8e-92    Elaeis guineensis
ref|XP_001783415.1|  predicted protein                                  295   8e-91    
ref|XP_001782380.1|  predicted protein                                  291   2e-89    
emb|CAN62442.1|  hypothetical protein VITISV_009194                     283   3e-88    Vitis vinifera
emb|CAN69291.1|  hypothetical protein VITISV_043141                     270   2e-87    Vitis vinifera
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982             286   2e-87    Selaginella moellendorffii
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448             285   4e-87    Selaginella moellendorffii
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343             285   4e-87    Selaginella moellendorffii
ref|XP_007154832.1|  hypothetical protein PHAVU_003G1516001g            264   7e-85    Phaseolus vulgaris [French bean]
gb|AEW67744.1|  WAX2 protein                                            263   2e-84    Eutrema halophilum
gb|AFK49575.1|  unknown                                                 260   2e-83    Lotus japonicus
ref|XP_002460243.1|  hypothetical protein SORBIDRAFT_02g025230          254   3e-81    
gb|AAK68765.1|  Unknown protein                                         253   9e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KHG04940.1|  Protein WAX2                                            264   1e-79    Gossypium arboreum [tree cotton]
gb|ACF79563.1|  unknown                                                 249   3e-79    Zea mays [maize]
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    256   5e-76    
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    256   1e-75    
ref|XP_003061467.1|  predicted protein                                  252   1e-74    Micromonas pusilla CCMP1545
ref|XP_009132284.1|  PREDICTED: protein ECERIFERUM 3-like               248   2e-73    
ref|XP_002509294.1|  predicted protein                                  246   3e-72    Micromonas commoda
ref|XP_005822223.1|  hypothetical protein GUITHDRAFT_158756             241   2e-71    Guillardia theta CCMP2712
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                243   3e-71    Ostreococcus tauri
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            243   6e-71    
ref|XP_001420263.1|  predicted protein                                  242   7e-71    Ostreococcus lucimarinus CCE9901
gb|AAA33934.1|  lipid transfer protein                                  219   7e-63    Senecio odorus
ref|XP_010103144.1|  Protein WAX2                                       218   1e-61    
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like               214   3e-61    Populus euphratica
ref|XP_002993505.1|  hypothetical protein SELMODRAFT_137211             196   3e-58    
ref|XP_007509665.1|  predicted protein                                  208   6e-58    Bathycoccus prasinos
gb|EPS58637.1|  hypothetical protein M569_16175                         200   1e-57    Genlisea aurea
ref|XP_002528208.1|  sterol desaturase, putative                        204   8e-57    
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    193   7e-53    
ref|XP_001756318.1|  predicted protein                                  184   4e-49    
gb|ADE77466.1|  unknown                                                 167   2e-46    Picea sitchensis
gb|EMT05122.1|  Protein WAX2                                            173   3e-46    
gb|EMS58990.1|  Protein WAX2                                            174   5e-46    Triticum urartu
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942             172   5e-45    
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             170   2e-44    
gb|KJB23545.1|  hypothetical protein B456_004G104100                    168   4e-44    Gossypium raimondii
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         165   1e-43    
gb|EEC81004.1|  hypothetical protein OsI_23762                          154   1e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    147   8e-41    
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         156   1e-39    
gb|KJB83321.1|  hypothetical protein B456_013G242200                    155   2e-39    Gossypium raimondii
gb|KJB83322.1|  hypothetical protein B456_013G242200                    155   3e-39    Gossypium raimondii
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    153   2e-38    Sesamum indicum [beniseed]
gb|EEE56435.1|  hypothetical protein OsJ_05611                          149   4e-37    Oryza sativa Japonica Group [Japonica rice]
emb|CDP09364.1|  unnamed protein product                                147   3e-36    Coffea canephora [robusta coffee]
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                    145   2e-35    Brassica rapa
gb|AHD24918.1|  CER1                                                    144   2e-35    Brassica napus [oilseed rape]
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                     144   3e-35    Camelina sativa [gold-of-pleasure]
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                     144   4e-35    Camelina sativa [gold-of-pleasure]
gb|EMS51791.1|  hypothetical protein TRIUR3_23680                       137   5e-35    Triticum urartu
emb|CDY38059.1|  BnaCnng09200D                                          145   7e-35    Brassica napus [oilseed rape]
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2          142   9e-35    
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1          142   1e-34    Camelina sativa [gold-of-pleasure]
gb|KFK27319.1|  hypothetical protein AALP_AA8G367000                    132   2e-34    Arabis alpina [alpine rockcress]
dbj|BAF01865.1|  CER1 protein                                           138   5e-34    Arabidopsis thaliana [mouse-ear cress]
emb|CDX93353.1|  BnaC04g45430D                                          140   6e-34    
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like               140   7e-34    Elaeis guineensis
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    140   8e-34    Glycine max [soybeans]
gb|KJB67450.1|  hypothetical protein B456_010G191300                    140   9e-34    Gossypium raimondii
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                     139   1e-33    
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg             139   2e-33    
gb|AAC23640.1|  CER1-like protein                                       139   2e-33    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850932.2|  protein ECERIFERUM 1                                  137   2e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg             139   2e-33    
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg             138   3e-33    Capsella rubella
emb|CDY07774.1|  BnaA03g17370D                                          137   3e-33    Brassica napus [oilseed rape]
gb|KJB67446.1|  hypothetical protein B456_010G191100                    137   6e-33    Gossypium raimondii
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    137   6e-33    
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                     137   7e-33    Brassica rapa
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    137   8e-33    Tarenaya hassleriana [spider flower]
ref|XP_004253517.1|  PREDICTED: protein CER1-like 1                     131   1e-32    Solanum lycopersicum
gb|KJB67445.1|  hypothetical protein B456_010G191100                    137   1e-32    Gossypium raimondii
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1       137   1e-32    
gb|KDO42773.1|  hypothetical protein CISIN_1g041887mg                   131   1e-32    Citrus sinensis [apfelsine]
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2       137   1e-32    
ref|NP_171723.2|  protein ECERIFERUM 1                                  137   1e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007219469.1|  hypothetical protein PRUPE_ppa021389mg             130   2e-32    Prunus persica
gb|KHG03871.1|  Protein WAX2 -like protein                              135   2e-32    Gossypium arboreum [tree cotton]
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg             136   3e-32    Citrus clementina [clementine]
gb|EEC73617.1|  hypothetical protein OsI_08114                          135   3e-32    Oryza sativa Indica Group [Indian rice]
ref|NP_001047459.1|  Os02g0621300                                       135   4e-32    
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478             135   4e-32    
gb|EEE57393.1|  hypothetical protein OsJ_07566                          135   4e-32    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like               135   5e-32    
ref|NP_001184890.1|  protein ECERIFERUM 1                               135   6e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like               135   7e-32    Tarenaya hassleriana [spider flower]
gb|AAB87721.1|  maize gl1 homolog                                       134   8e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1                    134   1e-31    Cucumis sativus [cucumbers]
gb|EMT07276.1|  Protein WAX2                                            134   1e-31    
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily                 136   1e-31    
gb|ACA14353.1|  TCER1                                                   134   1e-31    Triticum aestivum [Canadian hard winter wheat]
gb|EMT05456.1|  Protein WAX2                                            133   1e-31    
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg             134   1e-31    Eutrema salsugineum [saltwater cress]
ref|XP_010496698.1|  PREDICTED: protein ECERIFERUM 1-like               131   2e-31    
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2          133   2e-31    Brassica rapa
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like               133   2e-31    Nelumbo nucifera [Indian lotus]
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    134   2e-31    
emb|CDY55894.1|  BnaA04g29150D                                          133   2e-31    Brassica napus [oilseed rape]
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    132   2e-31    Nicotiana sylvestris
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                    133   3e-31    Arabis alpina [alpine rockcress]
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like               133   3e-31    Prunus mume [ume]
ref|NP_181306.3|  protein CER1-like 2                                   133   3e-31    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like               133   3e-31    Cicer arietinum [garbanzo]
gb|KJB76251.1|  hypothetical protein B456_012G081600                    132   3e-31    Gossypium raimondii
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1          133   3e-31    Brassica rapa
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    133   3e-31    Nicotiana sylvestris
ref|XP_010512796.1|  PREDICTED: protein ECERIFERUM 1-like               129   3e-31    
ref|XP_010496479.1|  PREDICTED: protein CER1-like 1                     130   4e-31    
gb|KJB76257.1|  hypothetical protein B456_012G081600                    132   4e-31    Gossypium raimondii
gb|KHN40121.1|  Protein WAX2                                            132   4e-31    Glycine soja [wild soybean]
gb|EMT33049.1|  Protein WAX2                                            132   5e-31    
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like               132   5e-31    Oryza brachyantha
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                     132   5e-31    Brassica rapa
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    132   5e-31    Fragaria vesca subsp. vesca
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                     132   5e-31    Brassica rapa
emb|CDX74937.1|  BnaA05g06830D                                          132   5e-31    
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like               132   6e-31    Cucumis melo [Oriental melon]
emb|CDY55893.1|  BnaA04g29140D                                          132   6e-31    Brassica napus [oilseed rape]
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like               132   8e-31    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX93352.1|  BnaC04g45440D                                          132   8e-31    
gb|KHG15491.1|  Protein WAX2 -like protein                              131   1e-30    Gossypium arboreum [tree cotton]
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like               131   1e-30    
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1       131   1e-30    Theobroma cacao [chocolate]
gb|EMS48099.1|  Protein WAX2                                            130   2e-30    Triticum urartu
ref|XP_009612940.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    129   2e-30    
gb|KHN30013.1|  Protein WAX2                                            130   2e-30    Glycine soja [wild soybean]
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    130   2e-30    Fragaria vesca subsp. vesca
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    130   2e-30    
gb|AIE57503.1|  CER1                                                    130   3e-30    
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like               132   3e-30    
emb|CDX91381.1|  BnaC04g07690D                                          130   3e-30    
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg             130   3e-30    
ref|XP_007041194.1|  CER1 protein                                       129   4e-30    
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    130   4e-30    
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    129   4e-30    
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like               129   5e-30    
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like               129   6e-30    
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                     129   6e-30    
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    129   6e-30    
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320          129   7e-30    
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like               129   7e-30    
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like               129   7e-30    
ref|XP_007041192.1|  CER1 protein                                       129   7e-30    
ref|NP_973742.1|  protein CER1-like 1                                   129   8e-30    
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    129   8e-30    
emb|CAA65200.1|  CER1-like                                              129   8e-30    
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    129   9e-30    
ref|NP_171721.3|  protein CER1-like 1                                   129   9e-30    
gb|KJB67449.1|  hypothetical protein B456_010G191200                    129   9e-30    
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg             129   1e-29    
ref|XP_007015842.1|  CER1 protein isoform 1                             128   1e-29    
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg             128   1e-29    
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    128   1e-29    
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like               128   1e-29    
ref|XP_007015845.1|  CER1 protein                                       128   1e-29    
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg             128   1e-29    
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg             128   1e-29    
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg             128   1e-29    
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                    128   1e-29    
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like               128   1e-29    
gb|KHN13741.1|  Protein WAX2                                            126   2e-29    
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    127   2e-29    
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g             127   2e-29    
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like               127   2e-29    
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like               127   2e-29    
gb|KFK27321.1|  hypothetical protein AALP_AA8G367700                    117   3e-29    
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like               127   3e-29    
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like               127   3e-29    
ref|XP_007041196.1|  CER1 protein                                       127   3e-29    
gb|EMS47164.1|  Protein WAX2                                            128   3e-29    
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like               127   4e-29    
gb|EMS58051.1|  Protein WAX2                                            127   4e-29    
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like               127   4e-29    
ref|XP_010097746.1|  Protein WAX2                                       127   4e-29    
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg                127   4e-29    
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like               127   4e-29    
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg             127   4e-29    
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like               127   5e-29    
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like               127   5e-29    
emb|CAA65199.1|  CER1-like                                              127   5e-29    
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    127   5e-29    
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                     127   5e-29    
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                     127   5e-29    
emb|CDX79754.1|  BnaC03g20900D                                          126   6e-29    
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048             126   6e-29    
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like               126   7e-29    
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like               126   8e-29    
gb|EPS60467.1|  hypothetical protein M569_14337                         126   8e-29    
gb|EPS71900.1|  hypothetical protein M569_02856                         126   8e-29    
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like               125   9e-29    
gb|KJB76256.1|  hypothetical protein B456_012G081600                    126   1e-28    
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    125   1e-28    
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    125   1e-28    
gb|EEE61327.1|  hypothetical protein OsJ_15439                          124   1e-28    
ref|XP_003626834.1|  gl1-like protein                                   125   1e-28    
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1          125   1e-28    
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like               125   1e-28    
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2          125   1e-28    
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like               125   1e-28    
gb|EEC77626.1|  hypothetical protein OsI_16615                          124   1e-28    
gb|KDO85390.1|  hypothetical protein CISIN_1g006590mg                   123   2e-28    
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                     125   2e-28    
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2          125   2e-28    
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1          125   2e-28    
ref|XP_008438264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    124   2e-28    
gb|KJB76286.1|  hypothetical protein B456_012G081500                    125   2e-28    
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like               124   2e-28    
gb|AFW64032.1|  hypothetical protein ZEAMMB73_844277                    123   2e-28    
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like               124   3e-28    
gb|KJB76287.1|  hypothetical protein B456_012G081500                    124   3e-28    
gb|EMT04955.1|  Protein WAX2                                            124   3e-28    
gb|KDO85389.1|  hypothetical protein CISIN_1g006590mg                   122   4e-28    
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    124   4e-28    
emb|CAE03390.2|  OSJNBa0004N05.14                                       124   5e-28    
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                    124   5e-28    
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    123   6e-28    
gb|ACG35856.1|  CER1                                                    123   6e-28    
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590          123   6e-28    
ref|NP_001141595.1|  uncharacterized protein LOC100273712               122   7e-28    
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3       122   7e-28    
gb|ACG47659.1|  CER1                                                    124   7e-28    
gb|ACN31737.1|  unknown                                                 123   7e-28    
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320          123   7e-28    
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like               123   7e-28    
gb|KDO85388.1|  hypothetical protein CISIN_1g006590mg                   122   8e-28    
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like               124   8e-28    
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                     123   8e-28    
gb|ACR38546.1|  unknown                                                 123   8e-28    
emb|CBI16758.3|  unnamed protein product                                119   9e-28    
gb|EMT15822.1|  Protein WAX2                                            121   9e-28    
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like               123   1e-27    
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...    123   1e-27    
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                    123   1e-27    
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like               122   1e-27    
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    122   1e-27    
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    122   1e-27    
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                    123   1e-27    
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...    123   2e-27    
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g             122   2e-27    
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like               120   2e-27    
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                   122   2e-27    
dbj|BAK00236.1|  predicted protein                                      122   2e-27    
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like               122   2e-27    
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                    122   2e-27    
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like               122   2e-27    
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2         122   2e-27    
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like               122   2e-27    
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like               123   2e-27    
gb|ABF51011.1|  putative aldehyde decarbonylase enzyme CER1;1           122   2e-27    
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    122   2e-27    
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1         122   2e-27    
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg             122   2e-27    
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    122   2e-27    
ref|XP_002526511.1|  sterol desaturase, putative                        122   3e-27    
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like               121   3e-27    
gb|KCW76795.1|  hypothetical protein EUGRSUZ_D01146                     116   4e-27    
emb|CAN83072.1|  hypothetical protein VITISV_026148                     118   5e-27    
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    119   5e-27    
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like               121   5e-27    
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like               120   6e-27    
emb|CAN63491.1|  hypothetical protein VITISV_032726                     118   7e-27    
gb|AAC24373.1|  CER1-like protein                                       120   7e-27    
ref|XP_002443045.1|  hypothetical protein SORBIDRAFT_08g006850          119   7e-27    
ref|NP_001146661.1|  uncharacterized protein LOC100280261               120   1e-26    
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like               120   1e-26    
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                    120   1e-26    
gb|KHG12604.1|  Protein WAX2 -like protein                              120   1e-26    
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    120   1e-26    
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    120   1e-26    
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like               119   1e-26    
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    120   1e-26    
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like               119   1e-26    
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like               119   2e-26    
gb|EMS58604.1|  Protein WAX2                                            119   2e-26    
ref|XP_002320584.1|  ECERIFERUM 1 family protein                        119   2e-26    
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like               119   2e-26    
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like               119   2e-26    
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg                119   2e-26    
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like               119   3e-26    
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg                119   3e-26    
ref|XP_010054530.1|  PREDICTED: protein ECERIFERUM 1-like               116   3e-26    
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg                118   3e-26    
gb|KJB09060.1|  hypothetical protein B456_001G122000                    119   4e-26    
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg                118   4e-26    
ref|XP_011650829.1|  PREDICTED: protein ECERIFERUM 1-like               118   4e-26    
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    118   4e-26    
gb|KGN56666.1|  hypothetical protein Csa_3G127770                       118   4e-26    
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein              118   4e-26    
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g             118   4e-26    
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                    118   5e-26    
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                    118   5e-26    
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg             118   5e-26    
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like               117   7e-26    
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like               117   7e-26    
ref|XP_002526512.1|  sterol desaturase, putative                        117   8e-26    
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like               117   8e-26    
ref|XP_010691966.1|  PREDICTED: protein ECERIFERUM 1-like               117   8e-26    
gb|ABG66132.1|  CER1 protein, putative, expressed                       117   8e-26    
gb|EEC67150.1|  hypothetical protein OsI_33995                          117   1e-25    
gb|KDP28917.1|  hypothetical protein JCGZ_14688                         117   1e-25    
gb|AFW70401.1|  hypothetical protein ZEAMMB73_833522                    108   1e-25    
ref|NP_001064826.1|  Os10g0471100                                       117   1e-25    
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940          117   1e-25    
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like               117   1e-25    
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like               115   2e-25    
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like               116   2e-25    
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    115   3e-25    
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    115   3e-25    
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    115   4e-25    
emb|CBI16761.3|  unnamed protein product                                115   4e-25    
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like               115   4e-25    
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3          115   4e-25    
ref|XP_006661851.1|  PREDICTED: protein ECERIFERUM 1-like               115   4e-25    
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1    115   4e-25    
ref|XP_011650828.1|  PREDICTED: protein ECERIFERUM 1-like               115   5e-25    
gb|KGN56664.1|  hypothetical protein Csa_3G127750                       115   5e-25    
gb|KCW76791.1|  hypothetical protein EUGRSUZ_D011442                    113   5e-25    
ref|XP_004954341.1|  PREDICTED: protein ECERIFERUM 1-like               115   6e-25    
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like               112   7e-25    
ref|XP_006857470.1|  PREDICTED: protein ECERIFERUM 1                    114   8e-25    
emb|CDP09363.1|  unnamed protein product                                114   1e-24    
ref|XP_003580122.1|  PREDICTED: protein ECERIFERUM 1-like               114   2e-24    
ref|XP_009760059.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3    113   2e-24    
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like               113   2e-24    
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like               113   3e-24    
ref|XP_011628155.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    113   3e-24    
gb|EAY87991.1|  hypothetical protein OsI_09413                          112   5e-24    
ref|NP_001048490.1|  Os02g0814200                                       112   6e-24    
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g             112   6e-24    
gb|AFV29804.1|  sterol desaturase-like protein                          106   9e-24    
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like               111   1e-23    
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2    111   1e-23    
gb|EMS58603.1|  hypothetical protein TRIUR3_05201                       109   1e-23    
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g             110   2e-23    
gb|AFV29812.1|  sterol desaturase-like protein                          105   2e-23    
ref|XP_003570374.1|  PREDICTED: protein ECERIFERUM 1-like               110   2e-23    
ref|XP_004153200.1|  PREDICTED: protein ECERIFERUM 1-like               110   2e-23    
gb|AFV29820.1|  sterol desaturase-like protein                          104   3e-23    
gb|KHN40120.1|  Protein WAX2                                            110   3e-23    
gb|EMS48098.1|  Protein WAX2                                            110   4e-23    
ref|XP_003625020.1|  Protein WAX2                                       109   4e-23    
tpg|DAA60918.1|  TPA: putative ribosomal protein S4 (RPS4A) famil...    107   4e-23    
gb|EMT06855.1|  Protein WAX2                                            109   5e-23    
gb|AFV29806.1|  sterol desaturase-like protein                          103   5e-23    
ref|XP_011085187.1|  PREDICTED: protein ECERIFERUM 1-like               109   6e-23    
ref|XP_008361247.1|  PREDICTED: protein ECERIFERUM 1-like               108   1e-22    
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898    110   1e-22    
gb|ABG47420.1|  putative CER1                                           108   1e-22    
gb|KEH23596.1|  fatty acid hydroxylase superfamily protein              107   2e-22    



>ref|XP_009798188.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   387 bits (994),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL +IP D+TEVFLTGATSKLGRAIALYLC ++VRVLMLT 
Sbjct  420  KHPNLRVRVVHGNTLTAAVILKEIPNDITEVFLTGATSKLGRAIALYLCTKQVRVLMLTS  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ QK LVQVTKYQAAKNCKTWIVGKWITP+EQNFAP GAHFHQFVV
Sbjct  480  STERFQKIQKEAPAEYQKYLVQVTKYQAAKNCKTWIVGKWITPREQNFAPTGAHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+LPFRRDCTYGDLAAM+LP DVQGLG+CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  540  PPVLPFRRDCTYGDLAAMRLPLDVQGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV+RID+VWEAALKHGLKPV++F
Sbjct  600  AIDVNRIDLVWEAALKHGLKPVSSF  624



>gb|KJB23542.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=384

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  180  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  239

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP++Q++AP G HFHQFVV
Sbjct  240  STERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVV  299

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  300  PPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVG  359

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALKHGL+PV++
Sbjct  360  AIDVDRIDIVWKAALKHGLRPVSS  383



>ref|XP_010047031.1| PREDICTED: protein ECERIFERUM 3 [Eucalyptus grandis]
 gb|KCW78780.1| hypothetical protein EUGRSUZ_C00214 [Eucalyptus grandis]
Length=624

 Score =   381 bits (979),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL+D+P+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  420  KHPNLKVRVVHGNTLTAAVILNDLPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+KI+KEAPADCQ  LVQVTKYQAA+ CKTWIVGKWITP+EQ++APPGA FHQFVV
Sbjct  480  STERFEKIKKEAPADCQNYLVQVTKYQAARTCKTWIVGKWITPREQSWAPPGARFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILPFRRDCTYGDLAAM+LP DVQGLG+CEYTM+RGVVHACHAGG VHSLEGW+HHEVG
Sbjct  540  PPILPFRRDCTYGDLAAMRLPDDVQGLGSCEYTMDRGVVHACHAGGVVHSLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW AALKHGLKPV+T
Sbjct  600  AIDVDRIDLVWNAALKHGLKPVST  623



>ref|XP_011079338.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=625

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL+DIP+DV+EVFLTGATSKLGRAIALYLC++RVRVLMLT 
Sbjct  420  KHPNLKVRVVHGNTLTAAVILNDIPKDVSEVFLTGATSKLGRAIALYLCRKRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+KIQ EAPADCQK LVQVTKYQAA+NCKTWIVGKWITP+EQNFAP G HFHQFVV
Sbjct  480  STERFRKIQTEAPADCQKYLVQVTKYQAAQNCKTWIVGKWITPREQNFAPAGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAMKLP DV+GLG CEYTMERGVVHACHAGG VH+LEGWSHHEVG
Sbjct  540  PPILQFRRDCTYGDLAAMKLPEDVEGLGCCEYTMERGVVHACHAGGVVHALEGWSHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALK+GLKPV++
Sbjct  600  AIDVDRIDLVWKAALKNGLKPVSS  623



>ref|XP_008443806.1| PREDICTED: protein ECERIFERUM 3 [Cucumis melo]
Length=611

 Score =   379 bits (972),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  407  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRKVRVLMLTL  466

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+KIQKEAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  467  STERFEKIQKEAPADCQNYLVQVTKYQAARNCKTWIVGKWITPREQSWAPSGTHFHQFVV  526

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLGNCEYTM RGVVHACHAGG VH LEGW+HHEVG
Sbjct  527  PPILAFRRDCTYGDLAAMRLPEDVQGLGNCEYTMSRGVVHACHAGGVVHHLEGWTHHEVG  586

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            A+DV RID+VWEAALKHGLKPV+T
Sbjct  587  ALDVDRIDLVWEAALKHGLKPVST  610



>ref|XP_007013964.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOY31583.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=632

 Score =   378 bits (971),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  420  KHPDLKVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP+EQ++AP GAHFHQFVV
Sbjct  480  STERFQKIQKEAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPREQSWAPSGAHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  540  PPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVHKLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VWEAALKHGL+PV++
Sbjct  600  AIDVDRIDLVWEAALKHGLRPVSS  623



>ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3 [Cucumis sativus]
 gb|KGN65271.1| hypothetical protein Csa_1G294020 [Cucumis sativus]
Length=625

 Score =   376 bits (966),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  421  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRKVRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+KIQKEAP DCQ  LVQVTKYQAA+NCKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  481  STERFEKIQKEAPVDCQNYLVQVTKYQAARNCKTWIVGKWITPREQSWAPSGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLGNCEYTM RGVVHACHAGG VH LEGW+HHEVG
Sbjct  541  PPILAFRRDCTYGDLAAMRLPEDVQGLGNCEYTMSRGVVHACHAGGVVHHLEGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            A+DV RID+VWEAALKHGLKPV+T
Sbjct  601  ALDVDRIDLVWEAALKHGLKPVST  624



>ref|XP_009587593.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=628

 Score =   375 bits (963),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL +IPEDVTE FL+GATSKLGR IALYLC+R+VRVLMLT 
Sbjct  420  KHPNLKVRVVHGNTLTAAVILKEIPEDVTEAFLSGATSKLGRVIALYLCRRQVRVLMLTS  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ QK LVQVTKY+AA+NCKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  480  STERFQKIQKEAPAEYQKYLVQVTKYEAARNCKTWIVGKWITPREQSYAPKGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLG+CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  540  PPILSFRRDCTYGDLAAMRLPEDVQGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA+KHGLKPV++ 
Sbjct  600  AIDVDRIDLVWEAAMKHGLKPVSSL  624



>ref|XP_011016520.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=227

 Score =   360 bits (924),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++I EDV EVFLTGATSKLGRAIALYLCQRRVRVLMLT 
Sbjct  16   KHPNLKVRVVHGNTLTAAVILNEIREDVKEVFLTGATSKLGRAIALYLCQRRVRVLMLTS  75

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF+K+QKEAP + Q  LVQVTKYQAA+ CKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  76   SKERFRKVQKEAPLEYQSYLVQVTKYQAARGCKTWIVGKWITPGEQSWAPTGTHFHQFVV  135

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP +VQGLGNCEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  136  PPILSFRRDCTYGDLAAMRLPDEVQGLGNCEYTMDRGVVHACHAGGVVHLLEGWAHHEVG  195

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW AALKHGLKPV+ 
Sbjct  196  AIDVDRIDLVWNAALKHGLKPVSN  219



>ref|XP_002270946.1| PREDICTED: protein ECERIFERUM 3 [Vitis vinifera]
 emb|CBI36611.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVILH+IP+ V EVFLTGATSKLGRAIALYLCQR+VRVLMLT 
Sbjct  422  KHPNLKVRVVHGNTLTAAVILHEIPQGVKEVFLTGATSKLGRAIALYLCQRKVRVLMLTL  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAP + Q  LVQVTKYQAA+NCKTWIVGKWITP++QN+AP GAHFHQFVV
Sbjct  482  STERFQKIQREAPVEFQNYLVQVTKYQAAQNCKTWIVGKWITPRQQNWAPSGAHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILPFRRDCTYGDLAA+KLP DVQGLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  542  PPILPFRRDCTYGDLAALKLPEDVQGLGSCEYTMERGVVHACHAGGVVHVLEGWTHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            A+DV RIDVVW+AALKHGLKPV 
Sbjct  602  ALDVDRIDVVWKAALKHGLKPVN  624



>gb|KJB23543.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=611

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  407  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  466

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP++Q++AP G HFHQFVV
Sbjct  467  STERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVV  526

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  527  PPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVG  586

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALKHGL+PV++
Sbjct  587  AIDVDRIDIVWKAALKHGLRPVSS  610



>gb|KJB23541.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=624

 Score =   373 bits (957),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  420  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP++Q++AP G HFHQFVV
Sbjct  480  STERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  540  PPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALKHGL+PV++
Sbjct  600  AIDVDRIDIVWKAALKHGLRPVSS  623



>gb|KJB23544.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=625

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  421  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP++Q++AP G HFHQFVV
Sbjct  481  STERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  541  PPILAFRRDCTYGDLAAMRLPDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALKHGL+PV++
Sbjct  601  AIDVDRIDIVWKAALKHGLRPVSS  624



>gb|KHG27245.1| Protein WAX2 [Gossypium arboreum]
Length=624

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  420  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP++Q++AP G HFHQFVV
Sbjct  480  STERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  540  PPILAFRRDCTYGDLAAMRLPDDVKGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALKHGL+PV++
Sbjct  600  AIDVDRIDIVWKAALKHGLRPVSS  623



>ref|XP_009766364.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL +IPE+VTE FL+GATSKLGR IALYLC+R+VRVLMLT 
Sbjct  420  KHPNLKVRVVHGNTLTAAVILKEIPENVTEAFLSGATSKLGRVIALYLCRRQVRVLMLTS  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ QK LVQVTKY+AA+NCKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  480  STERFQKIQKEAPAEYQKYLVQVTKYEAARNCKTWIVGKWITPREQSYAPKGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLG+CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  540  PPILSFRRDCTYGDLAAMRLPEDVQGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW AA+KHGLKPV++
Sbjct  600  AIDVDRIDLVWAAAMKHGLKPVSS  623



>emb|CDP02895.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAV L++IP+DVTEVFL+G+TSKLGRAIALYLC++RVRVLMLT 
Sbjct  421  KHPDLEVRVVHGNTLTAAVTLNEIPDDVTEVFLSGSTSKLGRAIALYLCRKRVRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP + QK LVQV+KYQAA+NCKTWIVGKWITP+EQ FAPPG HFHQFVV
Sbjct  481  STERFQKIQKEAPTEYQKYLVQVSKYQAAQNCKTWIVGKWITPREQRFAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAMKLP DV+GLG CEYTM+RGVVHACHAGG VHSLEGW+HHEVG
Sbjct  541  PPILRFRRDCTYGDLAAMKLPEDVEGLGCCEYTMDRGVVHACHAGGLVHSLEGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RIDVVWEAALKHGLKPV++
Sbjct  601  AIDVDRIDVVWEAALKHGLKPVSS  624



>ref|XP_012071608.1| PREDICTED: protein ECERIFERUM 3 [Jatropha curcas]
 gb|KDP38762.1| hypothetical protein JCGZ_04115 [Jatropha curcas]
Length=628

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLCQRRVRVLMLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCQRRVRVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEAP DCQ  LVQVTKYQAA+NCKTWIVGKWITP+EQ++AP GAHFHQFVV
Sbjct  483  STERFHKIQKEAPLDCQSYLVQVTKYQAAQNCKTWIVGKWITPREQSWAPKGAHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLG+CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  543  PPILSFRRDCTYGDLAAMRLPEDVQGLGSCEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            AIDV RID+VW AALK+GLKPV+
Sbjct  603  AIDVDRIDLVWNAALKNGLKPVS  625



>ref|XP_008223562.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Prunus mume]
Length=638

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFL+GATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILNEIPKDVEEVFLSGATSKLGRAIALYLCRRKVRVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPADCQ  LVQVTKYQAA+NCK WIVGKWITP+EQ +AP GAHFHQFVV
Sbjct  483  STERFQKIQKEAPADCQHYLVQVTKYQAARNCKAWIVGKWITPREQRWAPSGAHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLG+CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  543  PPILHFRRDCTYGDLAAMRLPDDVQGLGSCEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            A+DV RIDVVW+AALKHGLKPV++
Sbjct  603  ALDVDRIDVVWKAALKHGLKPVSS  626



>ref|XP_007221983.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
 gb|EMJ23182.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
Length=629

 Score =   369 bits (947),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFL+GATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILNEIPKDVEEVFLSGATSKLGRAIALYLCRRKVRVLMLTM  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPADCQ  LVQVTKYQAA+NCK WIVGKWITP+EQ +AP GAHFHQFVV
Sbjct  483  STERFQKIQKEAPADCQHYLVQVTKYQAARNCKAWIVGKWITPREQRWAPSGAHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  543  PPILHFRRDCTYGDLAAMRLPDDVQGLGCCEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            A+DV RIDVVW+AALKHGLKPV++  S
Sbjct  603  ALDVDRIDVVWKAALKHGLKPVSSSKS  629



>ref|XP_006343719.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=630

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL +IPE+V+EVFLTGATSKLGR IALYLC+R+VRVLMLT 
Sbjct  422  KHPNLKVRVVHGNTLTAAVILKEIPENVSEVFLTGATSKLGRVIALYLCRRQVRVLMLTM  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP + +K LVQ+TKYQAAKNCK WIVGKWITP+EQ++AP G HFHQFVV
Sbjct  482  STERFQKIQKEAPVEYKKYLVQITKYQAAKNCKAWIVGKWITPREQSYAPKGTHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQG+ +CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  542  PPILAFRRDCTYGDLAAMRLPEDVQGVSSCEYTMERGVVHACHAGGVVHSLEGWTHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            AIDVHRID+VW+AA+KHG KPV+
Sbjct  602  AIDVHRIDLVWDAAMKHGFKPVS  624



>ref|XP_004242647.1| PREDICTED: protein ECERIFERUM 3 [Solanum lycopersicum]
Length=630

 Score =   368 bits (945),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL +IP++V+EVFLTGATSKLGR IALYLC+R+VRVLMLT 
Sbjct  422  KHPNLKVRVVHGNTLTAAVILKEIPQNVSEVFLTGATSKLGRVIALYLCRRQVRVLMLTM  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP + QK LVQVTKY+AAKNCKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  482  STERFQKIQKEAPVEYQKYLVQVTKYEAAKNCKTWIVGKWITPREQSYAPKGTHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQG+  CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  542  PPILAFRRDCTYGDLAAMRLPEDVQGVSTCEYTMERGVVHACHAGGVVHSLEGWTHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            AIDV+RID+VW+AA+KHGLKPV+
Sbjct  602  AIDVNRIDLVWDAAMKHGLKPVS  624



>gb|KJB83325.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=527

 Score =   364 bits (935),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  321  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  380

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKI KE P DCQ  LVQVTKYQAA+NCKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  381  STERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVV  440

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILP RRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGWSHHEVG
Sbjct  441  PPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVG  500

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAALKHGLKPV++ N+
Sbjct  501  AIDVDRIDLVWEAALKHGLKPVSSVNN  527



>ref|XP_003549515.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
Length=632

 Score =   367 bits (943),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLCQ++V+VLMLT 
Sbjct  423  KHPNLRVRVVHGNTLTAAVILNEIPQDVKEVFLTGATSKLGRAIALYLCQKKVKVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            ST+RFQ+IQKEAP + Q  LVQVTKYQAA+NCKTWIVGKWITP+EQ +AP G HFHQFVV
Sbjct  483  STDRFQRIQKEAPPENQSYLVQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FR+DCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VHSLEGWSHHEVG
Sbjct  543  PPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWSHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV+RID+VWEAALKHGL+PV++F  K
Sbjct  603  AIDVNRIDLVWEAALKHGLRPVSSFTQK  630



>gb|KDO62363.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62364.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62365.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=567

 Score =   365 bits (938),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNT TAAVIL+++P+DV EVFLTGATSKLGRAIALYLC++RVRVLMLT 
Sbjct  356  KHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTL  415

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP DCQ  LVQVTKYQAA++ KTWIVGKWITP+EQN+APPG HFHQFVV
Sbjct  416  STERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVV  475

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  476  PPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  535

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +ID+VWEAALKHG KPV++  ++
Sbjct  536  AIDVDKIDLVWEAALKHGFKPVSSLRNR  563



>gb|KDO62360.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62361.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=632

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNT TAAVIL+++P+DV EVFLTGATSKLGRAIALYLC++RVRVLMLT 
Sbjct  421  KHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP DCQ  LVQVTKYQAA++ KTWIVGKWITP+EQN+APPG HFHQFVV
Sbjct  481  STERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  541  PPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +ID+VWEAALKHG KPV++  ++
Sbjct  601  AIDVDKIDLVWEAALKHGFKPVSSLRNR  628



>ref|XP_003542310.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
 gb|KHN34764.1| Protein WAX2 [Glycine soja]
Length=629

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLCQ++V+VLMLT 
Sbjct  423  KHPNLRVRVVHGNTLTAAVILNEIPQDVKEVFLTGATSKLGRAIALYLCQKKVKVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            ST+RFQ+IQKEAP + Q  LVQVTKYQAA+NCKTWIVGKWITP+EQ +AP G HFHQFVV
Sbjct  483  STDRFQRIQKEAPPEYQSYLVQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILPFR+DCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VHSLEGW HHEVG
Sbjct  543  PPILPFRKDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWPHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFN  313
            AIDV+RID+VWEAALKHGL+PV++F 
Sbjct  603  AIDVNRIDLVWEAALKHGLRPVSSFT  628



>gb|KHG30512.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=627

 Score =   365 bits (938),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  421  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKI KEAP DCQ  LVQVTKYQAA+NCKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  481  STERFQKILKEAPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILP RRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGWSHHEVG
Sbjct  541  PPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAALKHGLKPV++ N+
Sbjct  601  AIDVDRIDLVWEAALKHGLKPVSSVNN  627



>gb|KHN17538.1| Protein WAX2 [Glycine soja]
Length=632

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLCQ++V+VLMLT 
Sbjct  423  KHPNLRVRVVHGNTLTAAVILNEIPQDVKEVFLTGATSKLGRAIALYLCQKKVKVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            ST+RFQ+IQKEAP + Q  LVQVTKYQAA+NCKTWIVGKWITP+EQ +AP G HFHQFVV
Sbjct  483  STDRFQRIQKEAPPENQSYLVQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FR+DCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VHSLEGW HHEVG
Sbjct  543  PPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWPHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV+RID+VWEAALKHGL+PV++F  K
Sbjct  603  AIDVNRIDLVWEAALKHGLRPVSSFTQK  630



>ref|XP_010687696.1| PREDICTED: protein ECERIFERUM 3 [Beta vulgaris subsp. vulgaris]
Length=623

 Score =   365 bits (937),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP++V EVFLTGATSKLGRAIALYL ++ VRVLMLT 
Sbjct  422  KHPNLRVRVVHGNTLTAAVILNEIPDNVEEVFLTGATSKLGRAIALYLSRKHVRVLMLTL  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP DCQK LVQVTKYQAAKNCK WIVGKWITP+EQ++AP GAHFHQFVV
Sbjct  482  STERFQKIQKEAPVDCQKYLVQVTKYQAAKNCKAWIVGKWITPREQSWAPRGAHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAMKLP DVQGLG+CEYTM+RGVVHACHAGG VHSLEGW+HHEVG
Sbjct  542  PPILHFRRDCTYGDLAAMKLPQDVQGLGSCEYTMDRGVVHACHAGGVVHSLEGWTHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW+AA+K+G KPV
Sbjct  602  AIDVDRIDVVWKAAMKYGFKPV  623



>gb|KJB83324.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=595

 Score =   364 bits (934),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  389  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  448

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKI KE P DCQ  LVQVTKYQAA+NCKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  449  STERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVV  508

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILP RRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGWSHHEVG
Sbjct  509  PPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVG  568

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAALKHGLKPV++ N+
Sbjct  569  AIDVDRIDLVWEAALKHGLKPVSSVNN  595



>gb|KEH32582.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=633

 Score =   365 bits (937),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLCQ++VRVLMLT 
Sbjct  423  KHPNLKVRVVHGNTLTAAVILNEIPQDVEEVFLTGATSKLGRAIALYLCQKKVRVLMLTI  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            ST+RFQKIQKEAP + Q  LVQVTKYQAA+NCK WIVGKWITP+EQ++AP G HFHQFVV
Sbjct  483  STDRFQKIQKEAPLEYQSYLVQVTKYQAAQNCKAWIVGKWITPREQSWAPSGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VHSLEGW+HHEVG
Sbjct  543  PPILSFRRDCTYGDLAAMRLPEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWTHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            A+DV+RID+VWEAALKHGL+PV++
Sbjct  603  ALDVNRIDLVWEAALKHGLRPVSS  626



>gb|KJB83323.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=624

 Score =   364 bits (935),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  418  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKI KE P DCQ  LVQVTKYQAA+NCKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  478  STERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILP RRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGWSHHEVG
Sbjct  538  PPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAALKHGLKPV++ N+
Sbjct  598  AIDVDRIDLVWEAALKHGLKPVSSVNN  624



>gb|KJB83318.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=627

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  421  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKI KE P DCQ  LVQVTKYQAA+NCKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  481  STERFQKILKETPVDCQNYLVQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPILP RRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGWSHHEVG
Sbjct  541  PPILPIRRDCTYGDLAAMRLPPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAALKHGLKPV++ N+
Sbjct  601  AIDVDRIDLVWEAALKHGLKPVSSVNN  627



>ref|XP_002325096.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
 gb|EEF03661.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
Length=652

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IPEDV EVFLTGATSKLGRAIALYL QRRVRVLMLT 
Sbjct  442  KHPNLRVRVVHGNTLTAAVILNEIPEDVKEVFLTGATSKLGRAIALYLSQRRVRVLMLTS  501

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+KIQKEAP + Q   VQVTKYQAA++CKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  502  STERFEKIQKEAPLEYQSYFVQVTKYQAARSCKTWIVGKWITPREQSWAPTGTHFHQFVV  561

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI  FRRDCTYGDLAAM+LP DVQGLGNCEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  562  PPIFSFRRDCTYGDLAAMRLPDDVQGLGNCEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  621

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            A+DV RIDVVW AALKHGLKPV+ 
Sbjct  622  ALDVDRIDVVWNAALKHGLKPVSN  645



>ref|XP_006453492.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
 ref|XP_006474093.1| PREDICTED: protein ECERIFERUM 3-like [Citrus sinensis]
 gb|ESR66732.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
Length=632

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HPNLKVRVVHGNT TAAVIL+++P+DV EVFLTGATSKLGRAIALYLC++RVRVLMLT 
Sbjct  421  NHPNLKVRVVHGNTCTAAVILNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP DCQ  LVQVTKYQAA++ KTWIVGKWITP+EQN+APPG HFHQFVV
Sbjct  481  STERFQKIQKEAPIDCQNYLVQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  541  PPILHFRRDCTYGDLAAMRLPDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +ID+VWEAALKHG KPV++  ++
Sbjct  601  AIDVDKIDLVWEAALKHGFKPVSSLRNR  628



>ref|XP_011018104.1| PREDICTED: protein ECERIFERUM 3 [Populus euphratica]
Length=632

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  422  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTS  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+KIQKEAP + Q   VQVTKYQAA++CKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  482  STERFEKIQKEAPLEYQSYFVQVTKYQAARSCKTWIVGKWITPREQSWAPTGTHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQG GNCEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  542  PPILSFRRDCTYGDLAAMRLPDDVQGRGNCEYTMDRGVVHACHAGGVVHLLEGWTHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            A+DV RIDVVW AALKHGLKPV+ 
Sbjct  602  ALDVDRIDVVWNAALKHGLKPVSN  625



>ref|XP_002308430.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
 gb|EEE91953.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
Length=633

 Score =   363 bits (931),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++I EDV EVFLTGATSKLGRAIALYLCQRRVRVLMLT 
Sbjct  422  KHPNLKVRVVHGNTLTAAVILNEIREDVKEVFLTGATSKLGRAIALYLCQRRVRVLMLTS  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQK+QKEAP + Q  LVQVTKYQAA+ CKTWIVGKWITP EQ++AP G HFHQFVV
Sbjct  482  SKERFQKVQKEAPLEYQSYLVQVTKYQAARGCKTWIVGKWITPGEQSWAPTGTHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLGNCEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  542  PPILSFRRDCTYGDLAAMRLPVDVQGLGNCEYTMDRGVVHACHAGGMVHLLEGWAHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW AALKHGLKPV+ 
Sbjct  602  AIDVDRIDLVWNAALKHGLKPVSN  625



>gb|KHG27244.1| Protein WAX2 [Gossypium arboreum]
Length=666

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  420  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCKTWIVGKWITP++Q++AP G HFHQFVV
Sbjct  480  STERFQKIQREAPADCQNYLVQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  540  PPILAFRRDCTYGDLAAMRLPDDVKGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHG  337
            AIDV RID+VW+AALKHG
Sbjct  600  AIDVDRIDIVWKAALKHG  617



>ref|XP_006350059.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=629

 Score =   360 bits (925),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPE-DVTEVFLTGATSKLGRAIALYLCQRRVRVLMLT  754
            K+PNLKVRVVHGNTLTAAVIL+ IP+ DV EVFLTGATSKLGRAIALYLC ++VRVLMLT
Sbjct  420  KYPNLKVRVVHGNTLTAAVILNQIPKHDVNEVFLTGATSKLGRAIALYLCTKQVRVLMLT  479

Query  753  HSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFV  574
             STERFQKI KEAP + QK LV VTKYQAA+NCKTWIVGKWITP+EQ FAP GAHFHQFV
Sbjct  480  SSTERFQKILKEAPYEYQKYLVHVTKYQAARNCKTWIVGKWITPREQKFAPVGAHFHQFV  539

Query  573  VPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
            VPP+LP+R DCTYGDLAAM+LP  V+GLG+CEYTMERGVVHACHAGG VHSLEGW+HHEV
Sbjct  540  VPPVLPYRSDCTYGDLAAMRLPPHVKGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEV  599

Query  393  GAIDVHRIDVVWEAALKHGLKPVTTF  316
            GAIDV RID+VWEAALKHGL PV++F
Sbjct  600  GAIDVQRIDLVWEAALKHGLMPVSSF  625



>ref|XP_004309858.1| PREDICTED: protein ECERIFERUM 3 [Fragaria vesca subsp. vesca]
Length=630

 Score =   360 bits (924),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+D  EVFLTGATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  421  KHPDLRVRVVHGNTLTAAVILNEIPKDCQEVFLTGATSKLGRAIALYLCRRKVRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQK+QKEAPA+ Q  LVQVTKYQAA+ CKTWIVGKWITP+EQ +AP GAHFHQFVV
Sbjct  481  STERFQKVQKEAPAEFQSYLVQVTKYQAAQTCKTWIVGKWITPREQRWAPSGAHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI  FRRDCTYGDLAAM+LP DV+GLG+CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  541  PPIFHFRRDCTYGDLAAMRLPDDVEGLGSCEYTMDRGVVHACHAGGVVHFLEGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VW+AALKHGLKPV++
Sbjct  601  AIDVDRIDLVWDAALKHGLKPVSS  624



>ref|XP_011070158.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=626

 Score =   358 bits (918),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 188/204 (92%), Gaps = 1/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++I +DVTEVFLTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  420  KHPNLKVRVVHGNTLTAAVILNEI-KDVTEVFLTGATSKLGRAIALYLCKKGVRVLMLTL  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+ IQKEAPADCQK L+ VTKYQAA+NCKTWIVGKWITP+EQ+FAP G  FHQFVV
Sbjct  479  STERFRMIQKEAPADCQKNLIHVTKYQAAQNCKTWIVGKWITPREQSFAPSGTQFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+ P RRDCTYG+LAAMKLP D +GLG CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  539  PPVSPSRRDCTYGNLAAMKLPDDAEGLGCCEYTMERGVVHACHAGGMVHSLEGWTHHEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AI+V RID+VWEAAL+HGLKPV+T
Sbjct  599  AIEVDRIDLVWEAALRHGLKPVST  622



>emb|CDY32747.1| BnaA02g08090D [Brassica napus]
Length=630

 Score =   357 bits (916),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTM  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAPA+ Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SIERFQKIQKEAPAEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPAGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  544  PPILKFRRNCTYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA++HGL  V++  +
Sbjct  604  AIDVDRIDLVWEAAMRHGLSSVSSLTN  630



>gb|ACN25216.1| unknown [Zea mays]
 gb|AFW87580.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=361

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  160  KHPNLRVRVVHGNTLTAAVILNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTL  219

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  220  STERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVV  279

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  280  PPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  339

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A++V RIDVVWEAALKHGL P
Sbjct  340  ALEVDRIDVVWEAALKHGLTP  360



>ref|XP_004507787.1| PREDICTED: protein ECERIFERUM 3-like [Cicer arietinum]
Length=633

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL+++P+DV EVFLTGATSKLGRAIALYLCQ++VRVLMLT 
Sbjct  424  KHPNLKVRVVHGNTLTAAVILNELPQDVEEVFLTGATSKLGRAIALYLCQKKVRVLMLTI  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S +RFQKI KEAP + Q  LVQVTKYQAA+NCKTWIVGKWITP+EQ++AP G HFHQFVV
Sbjct  484  SNDRFQKILKEAPVEYQSYLVQVTKYQAAQNCKTWIVGKWITPREQSWAPRGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DV+G+G CEYTM+RGVVHACHAGG VHSLEGWSHHEVG
Sbjct  544  PPILSFRRDCTYGDLAAMRLPEDVEGIGCCEYTMDRGVVHACHAGGVVHSLEGWSHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV+RID+VW+AALKHGL+ V++
Sbjct  604  AIDVNRIDLVWQAALKHGLRLVSS  627



>ref|XP_009609208.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Nicotiana tomentosiformis]
Length=638

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 186/208 (89%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  433  KHPNLKVRVVHGNTLTAAVILNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTQ  492

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAPADCQK LVQV+KYQ AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  493  STERFMKIQREAPADCQKFLVQVSKYQGAKQCKTWILGKWATPREQSWAPSGTHFYQFVV  552

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++PFRRD TYG LAAM+LP DV GLG CEYTM RGVVHACHAGG VH LEGW+HHEVG
Sbjct  553  PPVIPFRRDSTYGKLAAMRLPKDVTGLGTCEYTMGRGVVHACHAGGLVHHLEGWTHHEVG  612

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHGLKP+  +NS+
Sbjct  613  AIDVDQIDVVWEAALKHGLKPL--YNSR  638



>ref|XP_009609207.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Nicotiana tomentosiformis]
Length=640

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 186/208 (89%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  435  KHPNLKVRVVHGNTLTAAVILNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTQ  494

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAPADCQK LVQV+KYQ AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  495  STERFMKIQREAPADCQKFLVQVSKYQGAKQCKTWILGKWATPREQSWAPSGTHFYQFVV  554

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++PFRRD TYG LAAM+LP DV GLG CEYTM RGVVHACHAGG VH LEGW+HHEVG
Sbjct  555  PPVIPFRRDSTYGKLAAMRLPKDVTGLGTCEYTMGRGVVHACHAGGLVHHLEGWTHHEVG  614

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHGLKP+  +NS+
Sbjct  615  AIDVDQIDVVWEAALKHGLKPL--YNSR  640



>ref|XP_008794400.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=619

 Score =   355 bits (910),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVR+VHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLCQ+++RVLMLT 
Sbjct  418  KHPDLKVRIVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCQKKIRVLMLTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP +CQ  LVQVTKYQAA+NCKTWIVGKW +P+EQ +APPG HFHQFVV
Sbjct  478  SAERFQKIQKEAPPECQHYLVQVTKYQAAQNCKTWIVGKWSSPREQRWAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQ LG+CEYT+ERGVVHACHAGG VH LEGW+HHEVG
Sbjct  538  PPIIGFRRDCTYGKLAAMRLPQDVQALGSCEYTLERGVVHACHAGGVVHLLEGWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  598  AIDVDRIDVVWRAALKHGLTPV  619



>ref|XP_011082697.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=635

 Score =   355 bits (910),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYL +++V+VLMLT 
Sbjct  434  KHPNLKVRVVHGNTLTAAVILNEIPQDVGEVFLTGATSKLGRAIALYLARQKVKVLMLTL  493

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEAPADCQK LVQVTKYQAA++CKTWI+GKW+ P+EQ +AP G HFHQFVV
Sbjct  494  STERFAKIQKEAPADCQKYLVQVTKYQAAQHCKTWIIGKWLMPREQYWAPSGTHFHQFVV  553

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDCTYG LAAM+LP DV+GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  554  PPIIPFRRDCTYGKLAAMRLPDDVEGLGTCEYTMERGVVHACHAGGLVHFLEGWKHHEVG  613

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AI+V +IDVVWEAAL+HGLKP+
Sbjct  614  AINVDQIDVVWEAALRHGLKPL  635



>gb|EYU24562.1| hypothetical protein MIMGU_mgv1a002930mg [Erythranthe guttata]
Length=624

 Score =   354 bits (908),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVILH+IP++V EVFLTGATSKLGRAIALYL +R V+VLMLT 
Sbjct  423  KHPNLKVRVVHGNTLTAAVILHEIPQNVDEVFLTGATSKLGRAIALYLARRNVKVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEAP +CQK LVQVTKYQAA++CK WI+GKW TP+EQ +AP G HFHQFVV
Sbjct  483  STERFTKIQKEAPIECQKYLVQVTKYQAAQHCKNWIIGKWTTPREQYWAPKGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDCTYG LAAMKLP+D+QGLG+CEYTMERGVVHACHAGG +H LEGW H+EVG
Sbjct  543  PPIIPFRRDCTYGKLAAMKLPNDIQGLGSCEYTMERGVVHACHAGGVIHFLEGWKHNEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AI+V +IDVVW+AALKHGLKP+
Sbjct  603  AINVDQIDVVWKAALKHGLKPI  624



>ref|NP_001131238.1| gl1 protein [Zea mays]
Length=361

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  160  KHPNLRVRVVHGNTLTAAVILNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTL  219

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  220  STERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVV  279

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAA +LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  280  PPIIGFRRDCTYGKLAATRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  339

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A++V RIDVVWEAALKHGL P
Sbjct  340  ALEVDRIDVVWEAALKHGLTP  360



>gb|AFW87579.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=436

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  235  KHPNLRVRVVHGNTLTAAVILNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTL  294

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  295  STERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVV  354

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  355  PPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  414

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A++V RIDVVWEAALKHGL P
Sbjct  415  ALEVDRIDVVWEAALKHGLTP  435



>ref|XP_002437383.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
 gb|EER88750.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
Length=623

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  422  KHPNLRVRVVHGNTLTAAVILNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMLTL  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEAP++ Q+ LVQVTKYQAA++CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  482  STERFLKIQKEAPSEFQQFLVQVTKYQAAQSCKTWIVGKWLSPREQRWAPPGTHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  542  PPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AALKHGL P
Sbjct  602  AIDVDRIDVVWKAALKHGLTP  622



>ref|XP_009126813.1| PREDICTED: protein ECERIFERUM 3 [Brassica rapa]
Length=630

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+ V EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKGVEEVFLTGATSKLGRAIALYLCRRGVRVLMLTM  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAPA+ Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SIERFQKIQKEAPAEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPAGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  544  PPILKFRRNCTYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA++HGL  V++  +
Sbjct  604  AIDVDRIDLVWEAAMRHGLSSVSSLTN  630



>emb|CDY02769.1| BnaC02g11200D [Brassica napus]
Length=630

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+ V EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKGVEEVFLTGATSKLGRAIALYLCRRGVRVLMLTM  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAPA+ Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SIERFQKIQKEAPAEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPAGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  544  PPILKFRRNCTYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA++HGL  V++  +
Sbjct  604  AIDVDRIDLVWEAAMRHGLSSVSSLTN  630



>emb|CDY50795.1| BnaCnng19590D [Brassica napus]
Length=630

 Score =   353 bits (905),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SMERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  544  PPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVHMLEGWEHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA++HGL+ V++ 
Sbjct  604  AIDVDRIDLVWEAAMRHGLRSVSSL  628



>ref|XP_009788358.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=638

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 186/208 (89%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  433  KHPNLKVRVVHGNTLTAAVILNEIPRDVHEVFLTGATSKLGRAIALYLARRRVRVLMLTQ  492

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KI++EAPADCQK LVQV KYQ AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  493  STERFMKIRREAPADCQKFLVQVPKYQGAKQCKTWILGKWATPREQSWAPSGTHFYQFVV  552

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++PFRRDCTYG LAAM+LP DV GLG+CEYTM RGVVHACHAGG +H LEGW+HHEVG
Sbjct  553  PPVIPFRRDCTYGKLAAMRLPKDVTGLGSCEYTMGRGVVHACHAGGLLHLLEGWTHHEVG  612

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHG KP+  +NS+
Sbjct  613  AIDVDQIDVVWEAALKHGFKPL--YNSR  638



>gb|KJB27033.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=610

 Score =   351 bits (901),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRV HGNTLTAAVI+++IP+DV EVFLTG+TSKLGRAIALYLC+RR+RVLMLT 
Sbjct  406  KHPQLKVRVCHGNTLTAAVIVNEIPKDVKEVFLTGSTSKLGRAIALYLCRRRIRVLMLTL  465

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPAD Q  LV VTKYQAA+NCKTWI GKWITP EQ++AP G HFHQFVV
Sbjct  466  STERFQKIQKEAPADTQNYLVHVTKYQAAQNCKTWIAGKWITPWEQSWAPSGTHFHQFVV  525

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL  RRDCTYGDLAAM+LP DV+GLG+CEY +ERGVVHACHAGGAVH LEGW+HHE+G
Sbjct  526  PPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIG  585

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
             IDV RID+VWEAALKHG +PV
Sbjct  586  PIDVDRIDLVWEAALKHGFRPV  607



>ref|XP_009120300.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Brassica rapa]
Length=630

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRQGVRVLMLTL  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  544  PPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVHMLEGWEHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA++HGL+ V++ 
Sbjct  604  AIDVDRIDLVWEAAMRHGLRSVSSL  628



>ref|XP_010929210.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Elaeis guineensis]
Length=619

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  418  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP +CQ  LVQVTKYQAA+NC+TWIVGKW++P EQ  APPG HFHQFVV
Sbjct  478  SAERFQKIQKEAPPECQHYLVQVTKYQAAQNCETWIVGKWLSPLEQRCAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG+LAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  538  PPIIGFRRDCTYGNLAAMRLPQDVQGLGMCEYTMQRGVVHACHAGGVVHFLEGWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  598  AIDVDRIDVVWRAALKHGLTPV  619



>dbj|BAB08850.1| lipid transfer protein; glossy1 homolog [Arabidopsis thaliana]
Length=566

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  360  KHPDLRVRVVHGNTLTAAVILYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  419

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  420  SMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  479

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAMKLP DV+GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  480  PPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVG  539

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  540  AIDVDRIDLVWEAAMKYGLSAVSSLTN  566



>gb|KJB27032.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=625

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRV HGNTLTAAVI+++IP+DV EVFLTG+TSKLGRAIALYLC+RR+RVLMLT 
Sbjct  421  KHPQLKVRVCHGNTLTAAVIVNEIPKDVKEVFLTGSTSKLGRAIALYLCRRRIRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPAD Q  LV VTKYQAA+NCKTWI GKWITP EQ++AP G HFHQFVV
Sbjct  481  STERFQKIQKEAPADTQNYLVHVTKYQAAQNCKTWIAGKWITPWEQSWAPSGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL  RRDCTYGDLAAM+LP DV+GLG+CEY +ERGVVHACHAGGAVH LEGW+HHE+G
Sbjct  541  PPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIG  600

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
             IDV RID+VWEAALKHG +PV
Sbjct  601  PIDVDRIDLVWEAALKHGFRPV  622



>emb|CDY51280.1| BnaA10g11680D [Brassica napus]
Length=630

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRQGVRVLMLTL  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  544  PPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVHMLEGWEHHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA++HGL+ V++ 
Sbjct  604  AIDVDRIDLVWEAAMRHGLRSVSSL  628



>ref|XP_010278025.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
 ref|XP_010278026.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
Length=619

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++I +DV EVFLTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  418  KHPNLRVRVVHGNTLTAAVILNEIGKDVKEVFLTGATSKLGRAIALYLCRKGVRVLMLTQ  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            +TERFQKIQKEAP +CQ  LVQVTK+QA +NCK WIVGKW+TP+EQ +APPG HFHQFVV
Sbjct  478  ATERFQKIQKEAPLECQNFLVQVTKHQAGQNCKAWIVGKWLTPREQRWAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI  FRRDCTYGDLAAM+LP DV+GLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  538  PPIFQFRRDCTYGDLAAMRLPKDVEGLGCCEYTMDRGVVHACHAGGLVHCLEGWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +ID+VW AALKHGL PV
Sbjct  598  AIDVDKIDMVWNAALKHGLTPV  619



>dbj|BAJ85039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +  EVFLTGATSKLGRAIALYLC++R+RV+MLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILNEIPSNTKEVFLTGATSKLGRAIALYLCRKRIRVIMLTM  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQAA+NCKTW+VGKW++P+EQ +APPG HFHQFVV
Sbjct  483  SSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  543  PPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWQHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            A+DV RIDVVW+AALKHGL PV
Sbjct  603  ALDVDRIDVVWKAALKHGLTPV  624



>ref|NP_001146749.1| uncharacterized protein LOC100280351 [Zea mays]
 gb|ACL54673.1| unknown [Zea mays]
 gb|AFW70400.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=440

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLM T 
Sbjct  239  KHPDLRVRVVHGNTLTAAVILNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMFTV  298

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAP + Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  299  SSERFVKIQREAPPEYQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVV  358

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGL +CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  359  PPIIGFRRDCTYGKLAAMRLPKDVQGLSSCEYTMERGVVHACHAGGVVHFLEGWGHHEVG  418

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW+AALKHGL PV
Sbjct  419  AIDVDRIDVVWKAALKHGLAPV  440



>gb|ACF79426.1| unknown [Zea mays]
Length=404

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+   EVFLTGATSKLGRAIALYLC++RVRV+M+T 
Sbjct  203  KHPDLRVRVVHGNTLTAAVILNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTL  262

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q+ LVQVTKY++A++C+TWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  263  STERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVV  322

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  323  PPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVG  382

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAALKHGL+P
Sbjct  383  AIDVDRIDVVWEAALKHGLRP  403



>ref|XP_009387454.1| PREDICTED: protein ECERIFERUM 3-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAV+L++IP D  EVFLTGATSKLGRAIALYLC++ +RVLMLT 
Sbjct  416  KHPDLRVRVVHGNTLTAAVMLNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTL  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF  IQKEAPADCQ  LVQVTK QAA+NCKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  476  SAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVV  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  536  PPIIGFRRDCTYGSLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHYLEGWTHHEVG  595

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW+AALKHGL PV
Sbjct  596  AIDVDRIDVVWKAALKHGLTPV  617



>ref|XP_009400348.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYLC++ +RVLMLT 
Sbjct  416  KHPDLKVRVVHGNTLTAAVILNEIPRDVKEVFLTGATSKLGRAIALYLCKKNIRVLMLTL  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEAP DCQ  LVQVTKYQAA++CKTWIVGKW++ +EQ +APPG HFHQFVV
Sbjct  476  STERFLKIQKEAPEDCQHHLVQVTKYQAAQHCKTWIVGKWLSLREQRWAPPGTHFHQFVV  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  536  PPIIGFRRDCTYGSLAAMRLPKDVRGLGSCEYTMERGVVHACHAGGVVHCLEGWMHHEVG  595

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  596  AIDVDRIDVVWRAALKHGLTPV  617



>emb|CDX88639.1| BnaA03g10100D [Brassica napus]
Length=631

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  425  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  485  STERFQKIQKEAPAEFQNHLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPEGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR CTYGDLAAM+LP DVQG+G CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPILNFRRKCTYGDLAAMRLPKDVQGVGTCEYTMERGVVHACHAGGLVHMLEGWEHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFN  313
            AIDV RID+VWEAA+++GL  V++ +
Sbjct  605  AIDVDRIDIVWEAAMRNGLSSVSSLS  630



>ref|XP_006401167.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
 dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42620.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
Length=631

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIAL+LC+R VRVLMLT 
Sbjct  425  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALHLCRRGVRVLMLTL  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQ+EAPA+ Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  485  SVERFQKIQREAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG+CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPILNFRRNCTYGDLAAMRLPKDVQGLGHCEYTMDRGVVHACHAGGVVHMLEGWEHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VWEAA+K+GL+PV++
Sbjct  605  AIDVDRIDLVWEAAMKYGLRPVSS  628



>ref|XP_009417462.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   349 bits (896),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKL RAIALYLC++RVRVLMLT 
Sbjct  419  KHPDLRVRVVHGNTLTAAVILNEIPLNVPEVFLTGATSKLSRAIALYLCRKRVRVLMLTL  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP +CQ+ LVQVTKYQA +NCKTWIVGKWI+ +EQ  APPG HFHQFVV
Sbjct  479  STERFQKIQKEAPVECQEYLVQVTKYQAGQNCKTWIVGKWISLREQRCAPPGTHFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEYT+ERG+VHACHAGG VH LEGW+HHEVG
Sbjct  539  PPIISFRRDCTYGKLAAMRLPQDVQGLGMCEYTLERGIVHACHAGGVVHLLEGWTHHEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  599  AIDVDRIDVVWRAALKHGLTPV  620



>ref|NP_200588.2| protein ECERIFERUM 3 [Arabidopsis thaliana]
 sp|Q8H1Z0.1|CER3_ARATH RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS 
POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein 
YORE-YORE [Arabidopsis thaliana]
 gb|AAN06975.1| cuticle protein [Arabidopsis thaliana]
 dbj|BAC81644.1| YORE-YORE protein [Arabidopsis thaliana]
 dbj|BAD06945.1| faceless pollen-1 [Arabidopsis thaliana]
 gb|AED96953.1| protein ECERIFERUM 3 [Arabidopsis thaliana]
Length=632

 Score =   349 bits (896),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  426  KHPDLRVRVVHGNTLTAAVILYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  486  SMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAMKLP DV+GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  606  AIDVDRIDLVWEAAMKYGLSAVSSLTN  632



>dbj|BAJ87617.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   349 bits (896),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +  EVFLTGATSKLGRAIALYLC++R+RV+MLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILNEIPSNTKEVFLTGATSKLGRAIALYLCRKRIRVIMLTM  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQAA+NCKTW+VGKW++P+EQ +APPG HFHQFVV
Sbjct  483  SSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP D QGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  543  PPIIGFRRDCTYGKLAAMRLPKDAQGLGSCEYTMERGVVHACHAGGVVHFLEGWQHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            A+DV RIDVVW+AALKHGL PV
Sbjct  603  ALDVDRIDVVWKAALKHGLTPV  624



>ref|XP_009387453.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   350 bits (897),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAV+L++IP D  EVFLTGATSKLGRAIALYLC++ +RVLMLT 
Sbjct  446  KHPDLRVRVVHGNTLTAAVMLNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTL  505

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF  IQKEAPADCQ  LVQVTK QAA+NCKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  506  SAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVV  565

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW+HHEVG
Sbjct  566  PPIIGFRRDCTYGSLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHYLEGWTHHEVG  625

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW+AALKHGL PV
Sbjct  626  AIDVDRIDVVWKAALKHGLTPV  647



>ref|XP_009390985.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAA+IL++IP DV EVFLTGATSKLGRAIALYLC++ +RVLMLT 
Sbjct  416  KHPDLRVRVVHGNTLTAAIILNEIPMDVKEVFLTGATSKLGRAIALYLCRKNIRVLMLTL  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKE PAD Q  LVQVTKYQAA+NCKTWIVGKW+  +EQ +APPG HFHQFVV
Sbjct  476  STERFVKIQKEVPADYQHHLVQVTKYQAAQNCKTWIVGKWLLLREQRWAPPGTHFHQFVV  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++ FRRDCTYG+LAAM+LP DVQGLG+CEYTMERG+VHACHAGG VH LEGW+HHEVG
Sbjct  536  PPVIGFRRDCTYGNLAAMRLPKDVQGLGSCEYTMERGIVHACHAGGIVHCLEGWTHHEVG  595

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL+PV
Sbjct  596  AIDVDRIDVVWNAALKHGLQPV  617



>ref|XP_002864528.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40787.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
Length=632

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  426  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ER+QKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  486  SVERYQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAMKLP DV+GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  606  AIDVDRIDLVWEAAMKYGLSAVSSLTN  632



>ref|XP_008658046.1| PREDICTED: uncharacterized protein LOC100192547 isoform X1 [Zea 
mays]
 gb|AFW87577.1| gl1 protein [Zea mays]
Length=622

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  421  KHPNLRVRVVHGNTLTAAVILNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  481  STERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  541  PPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A++V RIDVVWEAALKHGL P
Sbjct  601  ALEVDRIDVVWEAALKHGLTP  621



>ref|NP_001266321.1| gl1 protein [Zea mays]
 gb|ACG43105.1| gl1 protein [Zea mays]
Length=622

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  421  KHPNLRVRVVHGNTLTAAVILNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  481  STERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  541  PPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A++V RIDVVWEAALKHGL P
Sbjct  601  ALEVDRIDVVWEAALKHGLTP  621



>emb|CDO98263.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   350 bits (897),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAV L++IP DV EVFLTG+TSKLGRAIALYL +RRVRVLMLT 
Sbjct  466  KHPDLKVRVVHGNTLTAAVTLNEIPRDVDEVFLTGSTSKLGRAIALYLARRRVRVLMLTQ  525

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEAP + QK LVQVTKYQAAK CKTWI+GKW TP EQ++AP G HFHQFVV
Sbjct  526  STERFLKIQKEAPEELQKFLVQVTKYQAAKQCKTWIIGKWTTPGEQSWAPSGTHFHQFVV  585

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++PFRRDCT+G LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  586  PPVIPFRRDCTFGKLAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVVHFLEGWKHHEVG  645

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDVVW+AAL+HGLKP+
Sbjct  646  AIDVDQIDVVWKAALRHGLKPM  667



>ref|XP_010483318.1| PREDICTED: protein ECERIFERUM 3 [Camelina sativa]
 gb|AIE57504.1| CER3 [Camelina sativa]
Length=632

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTG+TSKLGRAIALYLC+R VRVLMLT 
Sbjct  426  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGSTSKLGRAIALYLCRRGVRVLMLTL  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  486  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DV+GL  CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPILKFRRNCTYGDLAAMRLPKDVEGLATCEYTMERGVVHACHAGGVVHMLEGWEHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  606  AIDVDRIDLVWEAAMKYGLSSVSSLTN  632



>ref|XP_006279594.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
 gb|EOA12492.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
Length=629

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILYEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  483  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP +V+GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  543  PPILKFRRNCTYGDLAAMRLPKNVEGLGTCEYTMERGVVHACHAGGVVHMLEGWEHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  603  AIDVDRIDLVWEAAMKYGLSSVSSLTN  629



>ref|XP_010545441.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Tarenaya hassleriana]
Length=629

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  422  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEA  + Q  LVQVTKYQAA++CKTWIVGKW+TP+EQ +APPGAHFHQFVV
Sbjct  482  STERFQKIQKEAAVEDQNYLVQVTKYQAAQHCKTWIVGKWMTPREQRWAPPGAHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++ FR++C+YGDLAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  542  PPVIRFRKNCSYGDLAAMRLPVDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWDHHEVG  601

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID+VWE+AL+ G   +++
Sbjct  602  AIDVDRIDLVWESALRLGFTSLSS  625



>gb|ACN25689.1| unknown [Zea mays]
 gb|AFW87576.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=635

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  434  KHPNLRVRVVHGNTLTAAVILNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTL  493

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  494  STERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVV  553

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  554  PPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  613

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A++V RIDVVWEAALKHGL P
Sbjct  614  ALEVDRIDVVWEAALKHGLTP  634



>ref|XP_004965700.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=622

 Score =   347 bits (891),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  421  KHPNLRVRVVHGNTLTAAVILNEIPSNVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTV  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAPA+ Q+ LVQVTKYQAA++CKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  481  STERFLKIQREAPAESQQFLVQVTKYQAAQSCKTWIVGKWLSPREQRWAPAGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  541  PPIIGFRRDCTYGKLAAMRLPKDVEGLGCCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AALKHGL P
Sbjct  601  AIDVDRIDVVWKAALKHGLTP  621



>emb|CDY11848.1| BnaC03g12740D [Brassica napus]
Length=631

 Score =   347 bits (891),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL+++P+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  425  KHPDLRVRVVHGNTLTAAVILNEVPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  485  STERFQKIQKEAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPEGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL F R CTYGDLAAM+LP DVQG+G CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPILNFTRKCTYGDLAAMRLPKDVQGVGTCEYTMERGVVHACHAGGLVHMLEGWEHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA+++GL  V++ 
Sbjct  605  AIDVDRIDIVWEAAMRNGLSSVSSL  629



>ref|XP_010443488.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   347 bits (891),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  426  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  486  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP +V+GL  CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPILKFRRNCTYGDLAAMRLPKNVEGLATCEYTMERGVVHACHAGGVVHMLEGWEHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  606  AIDVDRIDLVWEAAMKYGLSSVSSLTN  632



>ref|XP_008804902.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Phoenix dactylifera]
Length=619

 Score =   347 bits (889),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             H +LKVRVVHGNTLTAAVIL++IP+D  E+FLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  418  NHRDLKVRVVHGNTLTAAVILNEIPKDAKEIFLTGATSKLGRAIALYLCRKKIRVLMLTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP +CQ  LVQVTKYQAA+NCKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  478  SAERFQKIQKEAPPECQHYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEYTM+RG+VHACHAGG VH LEGW+HHEVG
Sbjct  538  PPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTMDRGMVHACHAGGVVHFLEGWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW AALKHGL P
Sbjct  598  AIDVDRIDVVWRAALKHGLAP  618



>ref|XP_002451653.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
 gb|EES04629.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
Length=630

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +V EVF+TGATSKLGRAIALYLC++++RVLM T 
Sbjct  429  KHPDLRVRVVHGNTLTAAVILNEIPSNVKEVFMTGATSKLGRAIALYLCRKKIRVLMFTM  488

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAP + Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  489  SSERFVKIQREAPPEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVV  548

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  549  PPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWDHHEVG  608

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  609  AIDVDRIDVVWNAALKHGLAPV  630



>emb|CDY11847.1| BnaC03g12730D [Brassica napus]
Length=635

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  429  KHPDLKVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  488

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP+  QK LVQVTKY +A++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  489  SVERFQKIQKEAPSKFQKYLVQVTKYNSAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  548

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTY +LAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  549  PPILKFRRNCTYDELAAMRLPKDVQGLGTCEYTMDRGVVHACHAGGLVHMLEGWEHHEVG  608

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            A+DV RID+VWEAA++HGL  V++ 
Sbjct  609  AVDVDRIDIVWEAAMRHGLSSVSSL  633



>ref|XP_011073242.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Sesamum indicum]
Length=641

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAA IL++IP+DV EVFLTGATSKLGRAIALYL +R+V+VLMLT 
Sbjct  440  KHPDLRVRVVHGNTLTAAAILNEIPKDVDEVFLTGATSKLGRAIALYLARRKVKVLMLTL  499

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF KIQ+EAP DCQK LVQVTKYQAAK+CKTWI+GKW TP++Q  AP G HFHQFVV
Sbjct  500  SKERFLKIQEEAPVDCQKYLVQVTKYQAAKHCKTWIIGKWTTPRQQYHAPSGTHFHQFVV  559

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDC YG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  560  PPIIPFRRDCKYGKLAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVVHLLEGWKHHEVG  619

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDVVWEAAL+HGLKP+
Sbjct  620  AIDVDQIDVVWEAALRHGLKPL  641



>ref|XP_011073241.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Sesamum indicum]
Length=643

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAA IL++IP+DV EVFLTGATSKLGRAIALYL +R+V+VLMLT 
Sbjct  442  KHPDLRVRVVHGNTLTAAAILNEIPKDVDEVFLTGATSKLGRAIALYLARRKVKVLMLTL  501

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF KIQ+EAP DCQK LVQVTKYQAAK+CKTWI+GKW TP++Q  AP G HFHQFVV
Sbjct  502  SKERFLKIQEEAPVDCQKYLVQVTKYQAAKHCKTWIIGKWTTPRQQYHAPSGTHFHQFVV  561

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDC YG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  562  PPIIPFRRDCKYGKLAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVVHLLEGWKHHEVG  621

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDVVWEAAL+HGLKP+
Sbjct  622  AIDVDQIDVVWEAALRHGLKPL  643



>gb|EMS67420.1| Protein WAX2 [Triticum urartu]
Length=697

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +  EVFLTGATSKLGRAIALYLC++++RV+MLT 
Sbjct  377  KHPDLRVRVVHGNTLTAAVILNEIPSNTKEVFLTGATSKLGRAIALYLCRKKIRVIMLTM  436

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQAA+NCKTW+VGKW++P+EQ +APPG HFHQFVV
Sbjct  437  SSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVV  496

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEY+MERGVVHACHAGG VH LEGW HHEVG
Sbjct  497  PPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYSMERGVVHACHAGGVVHFLEGWEHHEVG  556

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A+DV RIDVVW+AALKHGL P
Sbjct  557  ALDVDRIDVVWKAALKHGLTP  577



>ref|XP_010452800.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   345 bits (885),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL+++P+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  426  KHPDLRVRVVHGNTLTAAVILYELPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  486  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP +V+GL  CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPILKFRRNCTYGDLAAMRLPKNVEGLATCEYTMERGVVHACHAGGVVHMLEGWEHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
            AIDV RID+VWEAA+K+GL  V++  +
Sbjct  606  AIDVDRIDLVWEAAMKYGLSSVSSLTN  632



>ref|XP_003570600.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   345 bits (884),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL++IP +  +VFLTGATSKLGRAIALYLC++++RV+MLT 
Sbjct  425  KHPELRVRVVHGNTLTAAVILNEIPSNAKDVFLTGATSKLGRAIALYLCRKKIRVMMLTM  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  485  SSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWEHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            A+DV RIDVVW+AALKHGL P
Sbjct  605  ALDVDRIDVVWKAALKHGLTP  625



>ref|XP_002270075.1| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   344 bits (883),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL +IP++ T+VFLTGATSKLGRAI+LYLC++++ VLMLT 
Sbjct  419  KHPNLRVRVVHGNTLTAAVILKEIPQNATQVFLTGATSKLGRAISLYLCRKKIFVLMLTQ  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF+ IQ+EAP DCQ+ LVQVTKYQAA+ CKTWI+GKW TP EQ++APPG HFHQFVV
Sbjct  479  SSERFESIQREAPIDCQQFLVQVTKYQAAQYCKTWIIGKWCTPSEQSWAPPGTHFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP DV+GLG CEYTMERGV+HACHAGG VH L+GW+HHEVG
Sbjct  539  PPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDV W AAL HG KPV
Sbjct  599  AIDVDQIDVAWTAALSHGFKPV  620



>ref|XP_010318689.1| PREDICTED: protein ECERIFERUM 3 isoform X3 [Solanum lycopersicum]
Length=607

 Score =   344 bits (882),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  402  KHPNLRVRVVHGNTLTAAVILNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTK  461

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EA  +CQK LVQVT  + AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  462  STERFMKIQREATVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVV  521

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDCTYG LAAM+LP DV GLG CEYTM RG+VHACHAGG VH LEGW+HHEVG
Sbjct  522  PPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRGIVHACHAGGLVHLLEGWTHHEVG  581

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHGLKP+  +NS 
Sbjct  582  AIDVDQIDVVWEAALKHGLKPL--YNSS  607



>emb|CBI25244.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   344 bits (883),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL +IP++ T+VFLTGATSKLGRAI+LYLC++++ VLMLT 
Sbjct  421  KHPNLRVRVVHGNTLTAAVILKEIPQNATQVFLTGATSKLGRAISLYLCRKKIFVLMLTQ  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF+ IQ+EAP DCQ+ LVQVTKYQAA+ CKTWI+GKW TP EQ++APPG HFHQFVV
Sbjct  481  SSERFESIQREAPIDCQQFLVQVTKYQAAQYCKTWIIGKWCTPSEQSWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP DV+GLG CEYTMERGV+HACHAGG VH L+GW+HHEVG
Sbjct  541  PPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDV W AAL HG KPV
Sbjct  601  AIDVDQIDVAWTAALSHGFKPV  622



>gb|ACN25333.1| unknown [Zea mays]
 gb|ACN28101.1| unknown [Zea mays]
 gb|AFW70399.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=627

 Score =   344 bits (883),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLM T 
Sbjct  426  KHPDLRVRVVHGNTLTAAVILNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMFTV  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAP + Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  486  SSERFVKIQREAPPEYQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGL +CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPIIGFRRDCTYGKLAAMRLPKDVQGLSSCEYTMERGVVHACHAGGVVHFLEGWGHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW+AALKHGL PV
Sbjct  606  AIDVDRIDVVWKAALKHGLAPV  627



>gb|AAR90847.1| glossy1 protein [Zea mays]
Length=621

 Score =   344 bits (882),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+   EVFLTGATSKLGRAIALYLC++RVRV+M+T 
Sbjct  420  KHPDLRVRVVHGNTLTAAVILNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q+ LVQVTKY++A++C+TWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  480  STERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  540  PPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAALKHGL+P
Sbjct  600  AIDVDRIDVVWEAALKHGLRP  620



>ref|XP_010318688.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Solanum lycopersicum]
Length=641

 Score =   344 bits (883),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  436  KHPNLRVRVVHGNTLTAAVILNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTK  495

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EA  +CQK LVQVT  + AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  496  STERFMKIQREATVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVV  555

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDCTYG LAAM+LP DV GLG CEYTM RG+VHACHAGG VH LEGW+HHEVG
Sbjct  556  PPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRGIVHACHAGGLVHLLEGWTHHEVG  615

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHGLKP+  +NS 
Sbjct  616  AIDVDQIDVVWEAALKHGLKPL--YNSS  641



>ref|XP_006341693.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=646

 Score =   345 bits (884),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  441  KHPNLRVRVVHGNTLTAAVILNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTK  500

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EAP +CQK LVQVT  + AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  501  STERFMKIQREAPVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVV  560

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDCTYG LAAM+LP DV GLG CEYTM R +VHACHAGG VH LEGW+HHEVG
Sbjct  561  PPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRDIVHACHAGGLVHLLEGWTHHEVG  620

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHGLKP+  +NS 
Sbjct  621  AIDVDQIDVVWEAALKHGLKPL--YNSS  646



>tpg|DAA61563.1| TPA: glossy1 [Zea mays]
Length=621

 Score =   344 bits (882),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+   EVFLTGATSKLGRAIALYLC++RVRV+M+T 
Sbjct  420  KHPDLRVRVVHGNTLTAAVILNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q+ LVQVTKY++A++C+TWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  480  STERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  540  PPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAALKHGL+P
Sbjct  600  AIDVDRIDVVWEAALKHGLRP  620



>ref|NP_001058237.1| Os06g0653000 [Oryza sativa Japonica Group]
 dbj|BAD37412.1| putative Gl1 [Oryza sativa Japonica Group]
 dbj|BAF20151.1| Os06g0653000 [Oryza sativa Japonica Group]
 gb|EEE66138.1| hypothetical protein OsJ_22195 [Oryza sativa Japonica Group]
Length=627

 Score =   344 bits (882),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  426  KHPDLRVRVVHGNTLTAAVILNEIPGDVAEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  485

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF  IQ+EAPA+ Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  486  STERFMNIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVV  545

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEYTM RGVVHACHAGG VH LEGW HHEVG
Sbjct  546  PPIIGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWDHHEVG  605

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RID VW AAL+HGL P
Sbjct  606  AIDVDRIDAVWNAALRHGLTP  626



>ref|XP_004235875.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Solanum lycopersicum]
Length=643

 Score =   344 bits (883),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 182/208 (88%), Gaps = 2/208 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT 
Sbjct  438  KHPNLRVRVVHGNTLTAAVILNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTK  497

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQ+EA  +CQK LVQVT  + AK CKTWI+GKW TP+EQ++AP G HF+QFVV
Sbjct  498  STERFMKIQREATVECQKYLVQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVV  557

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFRRDCTYG LAAM+LP DV GLG CEYTM RG+VHACHAGG VH LEGW+HHEVG
Sbjct  558  PPIIPFRRDCTYGKLAAMRLPKDVTGLGTCEYTMGRGIVHACHAGGLVHLLEGWTHHEVG  617

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNSK  307
            AIDV +IDVVWEAALKHGLKP+  +NS 
Sbjct  618  AIDVDQIDVVWEAALKHGLKPL--YNSS  643



>gb|EAZ01917.1| hypothetical protein OsI_23945 [Oryza sativa Indica Group]
Length=631

 Score =   344 bits (882),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  430  KHPDLRVRVVHGNTLTAAVILNEIPGDVAEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  489

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF  IQ+EAPA+ Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  490  STERFMNIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVV  549

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEYTM RGVVHACHAGG VH LEGW HHEVG
Sbjct  550  PPIIGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWDHHEVG  609

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RID VW AAL+HGL P
Sbjct  610  AIDVDRIDAVWNAALRHGLTP  630



>gb|AAB87722.1| glossy1 homolog, partial [Oryza sativa Japonica Group]
Length=555

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALY C++++RVLMLT 
Sbjct  354  KHPDLRVRVVHGNTLTAAVILNEIPGDVAEVFLTGATSKLGRAIALYFCRKKIRVLMLTL  413

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF  IQ+EAPA+ Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  414  STERFMNIQREAPAEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVV  473

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEYTM RGVVHACHAGG VH LEGW HHEVG
Sbjct  474  PPIIGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWDHHEVG  533

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RID VW AAL+HGL P
Sbjct  534  AIDVDRIDAVWNAALRHGLTP  554



>gb|KHG04939.1| Protein WAX2 [Gossypium arboreum]
Length=625

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRV HGNTL+AAVI+ +IP+DV EVFLTG+TSKLGRAIALYL +R VRVLMLT 
Sbjct  421  KHPQLKVRVCHGNTLSAAVIVKEIPKDVKEVFLTGSTSKLGRAIALYLSRRHVRVLMLTS  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAP D Q  LV VTKYQAA+NCKTWI GKWITP EQ++AP G HFHQFVV
Sbjct  481  STERFQKIQKEAPTDTQNYLVHVTKYQAAQNCKTWIAGKWITPWEQSWAPSGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL  RRDCTYGDLAAM+LP DV+GLG+CEY +ERGVVHACHAGGAVH LEGW+HHE+G
Sbjct  541  PPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIG  600

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
             IDV RID+VWEAALKHG +PV
Sbjct  601  PIDVDRIDLVWEAALKHGFRPV  622



>ref|NP_001046080.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAD28002.1| putative glossy1 protein [Oryza sativa Japonica Group]
 dbj|BAF07994.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAG90034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL++IP +V +VFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  427  KHPELRVRVVHGNTLTAAVILNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTL  486

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQ A+NCKTW+VGKW++P+EQ +AP G HFHQFVV
Sbjct  487  SSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVV  546

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  547  PPIIGFRRDCTYGKLAAMRLPKDVQGLGYCEYTMERGVVHACHAGGVVHFLEGWEHHEVG  606

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AALKHGL P
Sbjct  607  AIDVDRIDVVWKAALKHGLTP  627



>gb|EEC72610.1| hypothetical protein OsI_06088 [Oryza sativa Indica Group]
Length=628

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL++IP +V +VFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  427  KHPELRVRVVHGNTLTAAVILNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTL  486

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQ A+NCKTW+VGKW++P+EQ +AP G HFHQFVV
Sbjct  487  SSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVV  546

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  547  PPIIGFRRDCTYGKLAAMRLPKDVQGLGYCEYTMERGVVHACHAGGVVHFLEGWEHHEVG  606

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AALKHGL P
Sbjct  607  AIDVDRIDVVWKAALKHGLTP  627



>gb|AGT16346.1| glossy1 protein [Saccharum hybrid cultivar R570]
 gb|AGT16349.1| glossy1 protein [Saccharum hybrid cultivar R570]
Length=622

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+   EVFLTGATSKLGRAIALYLC++RVRV+M+T 
Sbjct  421  KHPDLRVRVVHGNTLTAAVILNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTL  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q+ LVQVTKY++A++C+TWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  481  STERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  541  PPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RI VVWEAALKHGL+P
Sbjct  601  AIDVDRIGVVWEAALKHGLRP  621



>ref|NP_001105247.1| glossy1 [Zea mays]
 gb|AAR97643.1| Gl1 protein [Zea mays]
Length=621

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+   EVFLTGATSKLGRAIALYLC++RVRV+M+T 
Sbjct  420  KHPDLRVRVVHGNTLTAAVILNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q+ LVQVTKY++A++C+TWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  480  STERFQKIQKEAPAEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEY++ERG+VHACHAGG VH LEG++HHEVG
Sbjct  540  PPIIGFRRDCTYGKLAAMRLPKDVRGLGACEYSLERGLVHACHAGGVVHFLEGYTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAALKHGL+P
Sbjct  600  AIDVDRIDVVWEAALKHGLRP  620



>ref|XP_003563334.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  425  KHPDLKVRVVHGNTLTAAVILNEIPSNVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q  LVQVTKYQAAKNCKTW+VGKW++P+EQ +A  G HFHQFVV
Sbjct  485  SSERFLKIQREAPAEFQPFLVQVTKYQAAKNCKTWLVGKWLSPREQRWAAAGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++ FRRDC+YG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPVMEFRRDCSYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RID VW AALKHGL P
Sbjct  605  AIDVDRIDQVWHAALKHGLSP  625



>ref|XP_002270033.2| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL +IP++ T+VFLTGATSKLG AI+LYLC++++ VLMLT 
Sbjct  419  KHPNLRVRVVHGNTLTAAVILKEIPQNATQVFLTGATSKLGTAISLYLCRKKIFVLMLTQ  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF+ IQ+EAP DCQ+ LVQVTKYQAA++CKTWI+GKW TP+EQ++APPG HFHQFVV
Sbjct  479  SSERFESIQREAPIDCQQFLVQVTKYQAAQHCKTWIIGKWCTPREQSWAPPGTHFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP DV+GLG CEYTMERGV+HACHAGG VH L+GW+HHEVG
Sbjct  539  PPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDV W AAL HG KPV
Sbjct  599  AIDVDQIDVAWTAALSHGFKPV  620



>ref|XP_004951702.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Setaria italica]
Length=626

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLM T 
Sbjct  425  KHPDLRVRVVHGNTLTAAVILNEIPSNVKEVFLTGATSKLGRAIALYLCRKKIRVLMFTM  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAP + Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  485  SSERFVKIQREAPPEFQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GL +CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPIIGFRRDCTYGKLAAMRLPKDVRGLSSCEYTMERGVVHACHAGGVVHFLEGWDHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  605  AIDVDRIDVVWRAALKHGLAPV  626



>emb|CBI25242.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   342 bits (878),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 181/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL +IP++ T+VFLTGATSKLG AI+LYLC++++ VLMLT 
Sbjct  421  KHPNLRVRVVHGNTLTAAVILKEIPQNATQVFLTGATSKLGTAISLYLCRKKIFVLMLTQ  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF+ IQ+EAP DCQ+ LVQVTKYQAA++CKTWI+GKW TP+EQ++APPG HFHQFVV
Sbjct  481  SSERFESIQREAPIDCQQFLVQVTKYQAAQHCKTWIIGKWCTPREQSWAPPGTHFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP DV+GLG CEYTMERGV+HACHAGG VH L+GW+HHEVG
Sbjct  541  PPILGFRRDCTYGKLAAMRLPEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVG  600

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDV W AAL HG KPV
Sbjct  601  AIDVDQIDVAWTAALSHGFKPV  622



>ref|XP_010914062.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Elaeis guineensis]
Length=619

 Score =   342 bits (877),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KH +LKVRVVHGNTLTAAVIL++I +DV E+FLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  418  KHQHLKVRVVHGNTLTAAVILNEIHKDVKEIFLTGATSKLGRAIALYLCRKRIRVLMLTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP +CQ  LVQVTKYQAA++CKTWIVGKW++P EQ +APPG  FHQFVV
Sbjct  478  SAERFQKIQKEAPPECQHYLVQVTKYQAAQSCKTWIVGKWLSPWEQTWAPPGTQFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  538  PPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTMDRGVVHACHAGGVVHFLEGWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW AALKHGL P
Sbjct  598  AIDVDRIDVVWRAALKHGLTP  618



>emb|CDX88640.1| BnaA03g10090D [Brassica napus]
Length=600

 Score =   341 bits (875),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL+ +P+DV EVFL GATSKLGRAIALYLC+R VRVLMLT 
Sbjct  394  KHPDLRVRVVHGNTLTAAVILNGVPKDVKEVFLIGATSKLGRAIALYLCRRGVRVLMLTL  453

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP++ QK LVQVTKY  A++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  454  SVERFQKIQKEAPSEFQKYLVQVTKYNFAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  513

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTY +LAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  514  PPILKFRRNCTYDELAAMRLPKDVQGLGTCEYTMDRGVVHACHAGGLVHMLEGWEHHEVG  573

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA++HGL  V++ 
Sbjct  574  AIDVDRIDLVWEAAMRHGLSSVSSL  598



>dbj|BAK04216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  344  KHPDLRVRVVHGNTLTAAVILNEIPGSVKEVFLTGATSKLGRAIALYLCRKRIRVLMLTL  403

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKY AAK  KTW+VGKW++P+EQ +AP G HFHQFVV
Sbjct  404  SSERFLKIQREAPAEFQQYLVQVTKYHAAKTVKTWLVGKWLSPREQRWAPAGTHFHQFVV  463

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  464  PPVIEFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  523

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AAL+HGL P
Sbjct  524  AIDVDRIDVVWKAALRHGLSP  544



>ref|XP_009132107.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=631

 Score =   342 bits (876),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHG TLTAAV L++IP+DV EVFLTGAT KLGRAIALYLC+R VRVLMLT 
Sbjct  425  KHPDLRVRVVHGYTLTAAVNLNEIPKDVKEVFLTGATFKLGRAIALYLCRRGVRVLMLTL  484

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPA+ Q  LVQVTKY AA++CK+WIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  485  STERFQKIQKEAPAEFQNYLVQVTKYNAAQHCKSWIVGKWLTPREQSWAPEGTHFHQFVV  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR CTYGDLAAM+LP DVQG+G CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  545  PPILNFRRKCTYGDLAAMRLPKDVQGVGTCEYTMERGVVHACHAGGLVHMLEGWEHHEVG  604

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFN  313
            AIDV RID+VWEAA+++GL  V++ +
Sbjct  605  AIDVDRIDIVWEAAMRNGLSSVSSLS  630



>ref|XP_004956872.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=620

 Score =   341 bits (875),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+  +EVF+TGATSKLGRAIALYLC++RVRV+M+T 
Sbjct  419  KHPDLRVRVVHGNTLTAAVILNEIPKGTSEVFMTGATSKLGRAIALYLCRKRVRVMMMTL  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERFQ+IQKEAP + Q+ LVQVTKY++A++C+TWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  479  SSERFQRIQKEAPPEFQQYLVQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  539  PPIIGFRRDCTYGKLAAMRLPKDVQGLGTCEYSLERGVVHACHAGGVVHFLEGYTHHEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAAL+HGL+P
Sbjct  599  AIDVDRIDVVWEAALRHGLRP  619



>ref|XP_006657201.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=623

 Score =   341 bits (874),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYLC++ ++VLMLT 
Sbjct  422  KHPNLRVRVVHGNTLTAAVILNEIPGDVAEVFLTGATSKLGRAIALYLCRKNIKVLMLTL  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF  IQ+EAPA+ Q+ LVQVTKYQAA+ CKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  482  STERFMTIQREAPAEFQQYLVQVTKYQAAQKCKTWIVGKWLSPREQRWAPAGTHFHQFVV  541

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEYTM RGVVHACHAGG VH LEGW HHE G
Sbjct  542  PPIMGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWEHHEXG  601

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW AALKHGL P
Sbjct  602  AIDVDRIDVVWNAALKHGLTP  622



>ref|XP_010904609.1| PREDICTED: protein ECERIFERUM 3-like [Elaeis guineensis]
Length=617

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC++++RV+MLT 
Sbjct  416  KHPNLKVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRKKIRVMMLTL  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF KIQKEA  +CQ  LVQVTK QAA++CKTWIVGKW++P+EQ++A  G HFHQFVV
Sbjct  476  STERFLKIQKEASPECQHYLVQVTKCQAAQSCKTWIVGKWLSPREQHWASSGTHFHQFVV  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTY  LAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGWSHHEVG
Sbjct  536  PPIIGFRRDCTYWKLAAMRLPQDVQGLGTCEYTMERGVVHACHAGGVVHCLEGWSHHEVG  595

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AI V RIDVVW AA+KHGL PV
Sbjct  596  AIAVDRIDVVWRAAMKHGLTPV  617



>ref|XP_008775261.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=441

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL  IP+DVTEVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  240  KHPNLKVRVVHGNTLTAAVILDKIPKDVTEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  299

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF KIQKEA  +CQ  LVQVTK +AA+NCKTWI GKW++ +EQ  AP G HFHQFVV
Sbjct  300  SPERFLKIQKEASPECQHYLVQVTKCEAAQNCKTWIAGKWLSAREQRCAPSGTHFHQFVV  359

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FR+DCTYG LAAM+LP DVQGLG CE+ MERGVVHACH+GG VH LEGWSHHEVG
Sbjct  360  PPIINFRKDCTYGKLAAMRLPQDVQGLGTCEHAMERGVVHACHSGGVVHCLEGWSHHEVG  419

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDVVW AA+KHGL PV
Sbjct  420  AIDVDQIDVVWRAAMKHGLTPV  441



>ref|XP_009120299.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Brassica rapa]
Length=630

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRQGVRVLMLTL  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP + Q  LVQVTKY AA+NCKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  484  SVERFQKIQKEAPVEFQNYLVQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+CTYGDLAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH  EG  H EVG
Sbjct  544  PPILNFRRNCTYGDLAAMRLPEDVQGLGTCEYTMDRGVVHACHAGGVVHMREGGEHQEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPVTTF  316
            AIDV RID+VWEAA++HGL+ V++ 
Sbjct  604  AIDVDRIDLVWEAAMRHGLRSVSSL  628



>ref|XP_006646964.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=633

 Score =   340 bits (872),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VR+VHGNTLTAAVIL++IP +V +VFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  432  KHPELRVRIVHGNTLTAAVILNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTL  491

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQ A+NCKTW+VGKW++P+EQ +AP G HFHQFVV
Sbjct  492  SSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVV  551

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DV+GLG CEYTM RGVVHACHAGG VH LEGW HHEVG
Sbjct  552  PPIMGFRRDCTYGKLAAMRLPEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWEHHEVG  611

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AALKHGL P
Sbjct  612  AIDVDRIDVVWKAALKHGLTP  632



>ref|XP_010536953.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 3-like [Tarenaya 
hassleriana]
Length=621

 Score =   339 bits (870),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL+++P+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  415  KHPNLRVRVVHGNTLTAAVILNEVPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  474

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEA    Q  LVQVTKYQAA++CKTWIVGKW+TP+EQ +AP G HFHQFVV
Sbjct  475  STERFQKIQKEAAVGHQNYLVQVTKYQAAQHCKTWIVGKWLTPREQRWAPKGTHFHQFVV  534

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FR++C+YGDLAAM+LP DV GLG CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  535  PPILRFRKNCSYGDLAAMRLPPDVNGLGTCEYTMERGVVHACHAGGVVHMLEGWDHHEVG  594

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RID+VW AAL+ G  P
Sbjct  595  AIDVDRIDIVWSAALRLGFAP  615



>ref|XP_008643558.1| PREDICTED: uncharacterized protein LOC100280351 isoform X1 [Zea 
mays]
Length=747

 Score =   343 bits (879),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +V EVFLTGATSKLGRAIALYLC++++RVLM T 
Sbjct  546  KHPDLRVRVVHGNTLTAAVILNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMFTV  605

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAP + Q+ LVQVTKYQAA+NCKTWIVGKW++P+EQ +AP G HFHQFVV
Sbjct  606  SSERFVKIQREAPPEYQQYLVQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVV  665

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGL +CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  666  PPIIGFRRDCTYGKLAAMRLPKDVQGLSSCEYTMERGVVHACHAGGVVHFLEGWGHHEVG  725

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW+AALKHGL PV
Sbjct  726  AIDVDRIDVVWKAALKHGLAPV  747



>ref|NP_001063227.1| Os09g0426800 [Oryza sativa Japonica Group]
 dbj|BAD33619.1| putative Gl1 protein [Oryza sativa Japonica Group]
 dbj|BAF25141.1| Os09g0426800 [Oryza sativa Japonica Group]
 gb|EAZ09166.1| hypothetical protein OsI_31436 [Oryza sativa Indica Group]
Length=619

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL++IP+  TEVF+TGATSKLGRAIALYLC+++VRV+M+T 
Sbjct  418  KHPGLRVRVVHGNTLTAAVILNEIPQGTTEVFMTGATSKLGRAIALYLCRKKVRVMMMTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EA  + Q+ LVQVTKY++A++CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  478  STERFQKIQREATPEHQQYLVQVTKYRSAQHCKTWIVGKWLSPREQRWAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  538  PPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVWEAAL+HGL+PV
Sbjct  598  AIDVDRIDVVWEAALRHGLRPV  619



>gb|EAZ44800.1| hypothetical protein OsJ_29433 [Oryza sativa Japonica Group]
Length=621

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL++IP+  TEVF+TGATSKLGRAIALYLC+++VRV+M+T 
Sbjct  420  KHPGLRVRVVHGNTLTAAVILNEIPQGTTEVFMTGATSKLGRAIALYLCRKKVRVMMMTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQ+EA  + Q+ LVQVTKY++A++CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  480  STERFQKIQREATPEHQQYLVQVTKYRSAQHCKTWIVGKWLSPREQRWAPPGTHFHQFVV  539

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEY++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  540  PPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVG  599

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVWEAAL+HGL+PV
Sbjct  600  AIDVDRIDVVWEAALRHGLRPV  621



>dbj|BAJ85064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=660

 Score =   339 bits (869),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  459  KHPDLRVRVVHGNTLTAAVILNEIPGSVKEVFLTGATSKLGRAIALYLCRKRIRVLMLTL  518

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF KIQ+EAPA+ Q+ LVQVTKY AAK  KTW+VGKW++P+EQ +AP G HFHQFVV
Sbjct  519  SSERFLKIQREAPAEFQQYLVQVTKYHAAKTVKTWLVGKWLSPREQRWAPAGTHFHQFVV  578

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++ FRRDCTYG LAAM+LP DVQGLG+CEYTMERGVVHACHAGG VH LEGW HHEVG
Sbjct  579  PPVIEFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVG  638

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW+AAL+HGL P
Sbjct  639  AIDVDRIDVVWKAALRHGLSP  659



>ref|XP_003578148.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
 ref|XP_010238185.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=619

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+  TEVF+TGATSKLGRAIALYLC++++RV+M+T 
Sbjct  418  KHPDLRVRVVHGNTLTAAVILNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEA A+ Q+ LVQVTKY++A  CKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  478  STERFQKIQKEAAAEHQQYLVQVTKYRSAGQCKTWIVGKWLSPREQRWAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP D +GLG+CE+++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  538  PPILGFRRDCTYGKLAAMRLPKDARGLGSCEFSLERGVVHACHAGGVVHFLEGYTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAALKHGL+P
Sbjct  598  AIDVGRIDVVWEAALKHGLRP  618



>dbj|BAK02959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   336 bits (861),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+  TEVF+TGATSKLGRAIALYLC++++RV+M+T 
Sbjct  418  KHPDLRVRVVHGNTLTAAVILNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEA A+ Q+ LVQVTK+Q+A+ C+TWIVGKW++P+EQ +A PG HFHQFVV
Sbjct  478  STERFQKIQKEAAAEHQQYLVQVTKFQSAEQCRTWIVGKWLSPREQRWASPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP D +GLG+CE+++ERGVVHACHAGG VH LEG++HHEVG
Sbjct  538  PPILGFRRDCTYGKLAAMRLPKDARGLGSCEFSLERGVVHACHAGGVVHFLEGYAHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVWEAALKHG++PV
Sbjct  598  AIDVDRIDVVWEAALKHGIRPV  619



>dbj|BAK04110.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/235 (69%), Positives = 185/235 (79%), Gaps = 33/235 (14%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +  EVFLTGATSKLGRAIALYLC++R+RV+MLT 
Sbjct  332  KHPDLRVRVVHGNTLTAAVILNEIPSNTKEVFLTGATSKLGRAIALYLCRKRIRVIMLTM  391

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK---------------------------  652
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQAA+NCK                           
Sbjct  392  SSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKVSPAFSHPIADQSVVLYRPCMMMCYMM  451

Query  651  ------TWIVGKWITPKEQNFAPPGAHFHQFVVPPILPFRRDCTYGDLAAMKLPHDVQGL  490
                  TW+VGKW++P+EQ +APPG HFHQFVVPPI+ FRRDCTYG LAAM+LP DVQGL
Sbjct  452  VTLGVQTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGL  511

Query  489  GNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAIDVHRIDVVWEAALKHGLKPV  325
            G+CEYTMERGVVHACHAGG VH LEGW HHEVGA+DV RIDVVW+AALKHGL PV
Sbjct  512  GSCEYTMERGVVHACHAGGVVHFLEGWQHHEVGALDVDRIDVVWKAALKHGLTPV  566



>gb|EYU21788.1| hypothetical protein MIMGU_mgv1a025856mg [Erythranthe guttata]
Length=633

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 179/202 (89%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VR+VHGNTLTAAVIL++IP D+ EVFLTGATSKLGRAIALYL +R+V+V+MLT 
Sbjct  432  KHPNLRVRLVHGNTLTAAVILNEIPRDIDEVFLTGATSKLGRAIALYLARRKVKVMMLTP  491

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF KI+KEAP   +  LVQVTKYQAAKNCKTWI+GKW TP++Q +AP G HFHQFVV
Sbjct  492  SEERFLKIKKEAPLGFENYLVQVTKYQAAKNCKTWIIGKWTTPRQQYYAPSGTHFHQFVV  551

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+PFR DC+YG LAAMKLP DV+GLG+CEYTMERGVVHACHAGG VH LEGW H+EVG
Sbjct  552  PPIIPFRLDCSYGKLAAMKLPEDVEGLGSCEYTMERGVVHACHAGGVVHLLEGWKHNEVG  611

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDVVW+AAL+HG KP+
Sbjct  612  AIDVDQIDVVWKAALRHGFKPL  633



>gb|ERN07159.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
Length=555

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KH NLKV+VVHGNTLTAAVIL+++P  V EVFLTG+TSKLGRAIALYL ++ VRVLMLT 
Sbjct  354  KHRNLKVKVVHGNTLTAAVILNELPNGVKEVFLTGSTSKLGRAIALYLARKGVRVLMLTL  413

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQ IQKEAP + QK LVQVTKYQA +NCKTWIVGKWI P+EQ +AP G HFHQFVV
Sbjct  414  SQERFQIIQKEAPVEYQKNLVQVTKYQAGQNCKTWIVGKWILPREQKWAPSGTHFHQFVV  473

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL  RRDCTYG LAAM LP DV+GLG CEYTM RG+VHACHAGG VH LEGW+HHEVG
Sbjct  474  PPILRLRRDCTYGKLAAMHLPDDVEGLGTCEYTMGRGIVHACHAGGVVHLLEGWTHHEVG  533

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AI V RID+VWEAALKHGLKPV
Sbjct  534  AISVDRIDLVWEAALKHGLKPV  555



>ref|XP_006845484.2| PREDICTED: protein ECERIFERUM 3 [Amborella trichopoda]
Length=620

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KH NLKV+VVHGNTLTAAVIL+++P  V EVFLTG+TSKLGRAIALYL ++ VRVLMLT 
Sbjct  419  KHRNLKVKVVHGNTLTAAVILNELPNGVKEVFLTGSTSKLGRAIALYLARKGVRVLMLTL  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQ IQKEAP + QK LVQVTKYQA +NCKTWIVGKWI P+EQ +AP G HFHQFVV
Sbjct  479  SQERFQIIQKEAPVEYQKNLVQVTKYQAGQNCKTWIVGKWILPREQKWAPSGTHFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL  RRDCTYG LAAM LP DV+GLG CEYTM RG+VHACHAGG VH LEGW+HHEVG
Sbjct  539  PPILRLRRDCTYGKLAAMHLPDDVEGLGTCEYTMGRGIVHACHAGGVVHLLEGWTHHEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AI V RID+VWEAALKHGLKPV
Sbjct  599  AISVDRIDLVWEAALKHGLKPV  620



>emb|CDX88642.1| BnaA03g10070D [Brassica napus]
Length=637

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL+ +P+DV EVFLTGATSKLGRAIALYLC+R VRVLMLT 
Sbjct  429  KHPDLRVRVVHGNTLTAAVILNGVPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTL  488

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQ IQKEAPA+ Q  LVQVTKY +A++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  489  SAERFQNIQKEAPAEFQNYLVQVTKYNSAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  548

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRR+ TY +LAA++LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW HHEVG
Sbjct  549  PPILKFRRNYTYDELAAVRLPKDVQGLGTCEYTMDRGVVHACHAGGLVHMLEGWEHHEVG  608

Query  390  AIDVH--RIDVVWEAALKHGLKPVTTF  316
            A+DV   RID+VWEAA++HGL  +++ 
Sbjct  609  AVDVEPLRIDLVWEAAMRHGLSSLSSL  635



>ref|XP_004973574.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=618

 Score =   328 bits (842),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 177/201 (88%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL +IPE   EVFLTGATSKLGRAIALYLC++RVRV+MLT 
Sbjct  417  KHPGLRVRVVHGNTLTAAVILREIPEGTAEVFLTGATSKLGRAIALYLCRKRVRVMMLTA  476

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQK+Q+EAP + ++ LV+VTKYQ+A++CKTWI GKW++P +Q +AP G HFHQFVV
Sbjct  477  SEERFQKVQEEAPPEARQYLVRVTKYQSAQHCKTWIAGKWLSPGDQRWAPAGTHFHQFVV  536

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYGDLAAM+LP DVQGLG CEYT+ RGVVHACHAGG VH LEG+  HEVG
Sbjct  537  PPILRFRRDCTYGDLAAMRLPDDVQGLGVCEYTLGRGVVHACHAGGVVHFLEGYEGHEVG  596

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVWEAAL+HGL+P
Sbjct  597  AIDVDRIDVVWEAALRHGLRP  617



>gb|EYU37115.1| hypothetical protein MIMGU_mgv1a021583mg [Erythranthe guttata]
Length=609

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 168/204 (82%), Gaps = 17/204 (8%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRV                 DVTEV LTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  421  KHPNLKVRV-----------------DVTEVSLTGATSKLGRAIALYLCRKGVRVLMLTL  463

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF+ IQ EAPA+ Q  LVQVTKYQAA+NCKTWIVGKWITP+EQ FAPPGAHFHQFVV
Sbjct  464  SAERFKNIQIEAPAEFQNNLVQVTKYQAAQNCKTWIVGKWITPREQKFAPPGAHFHQFVV  523

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+  FRRDCTYGDLAAM+LP DVQGLG CEYTMERGVVHACHAGG VHSLEGW+HHEVG
Sbjct  524  PPVFQFRRDCTYGDLAAMRLPEDVQGLGVCEYTMERGVVHACHAGGVVHSLEGWTHHEVG  583

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
            AIDV RID VWEAA+K+G KP++ 
Sbjct  584  AIDVERIDPVWEAAMKYGFKPISN  607



>ref|XP_004252089.1| PREDICTED: protein ECERIFERUM 3-like [Solanum lycopersicum]
Length=248

 Score =   308 bits (789),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 167/195 (86%), Gaps = 8/195 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPE-DVTEVFLTGATSKLGRAIALYLCQRRVRVLMLT  754
            K+PNLKVRVVHGNTLTA VI++ I + DV EVFL+GA       IALYLC ++VRVLM T
Sbjct  61   KYPNLKVRVVHGNTLTAGVIVNQITKHDVNEVFLSGA-------IALYLCTKQVRVLMST  113

Query  753  HSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFV  574
             S+ERFQKI KEAP + QK LV VTKYQAAKNCKT IVGKWITP+EQ FAP GAHFHQFV
Sbjct  114  SSSERFQKILKEAPYEYQKYLVHVTKYQAAKNCKTCIVGKWITPREQKFAPVGAHFHQFV  173

Query  573  VPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
            VPPILP+R DCTYGDLAAM+LP  V+GLG+CEYTMERGVVHACHAGG VHSLEGW+HHEV
Sbjct  174  VPPILPYRNDCTYGDLAAMRLPPHVKGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEV  233

Query  393  GAIDVHRIDVVWEAA  349
            GAIDV RID+VWEAA
Sbjct  234  GAIDVQRIDLVWEAA  248



>gb|ADE77418.1| unknown [Picea sitchensis]
Length=283

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = -2

Query  924  PNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTHST  745
            P+L+VRVVHGNTLTAAVIL+++  DV EVFLTGATSKLGR IALYLC++ +RV+MLT+S 
Sbjct  83   PDLRVRVVHGNTLTAAVILNELNPDVKEVFLTGATSKLGRVIALYLCRKGIRVMMLTYSK  142

Query  744  ERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPP  565
            ERF+ IQ EAP + Q  LVQVTKY+AA+NCKTWIVGKWI  KEQ +AP G H HQFVVPP
Sbjct  143  ERFKSIQSEAPPEFQNFLVQVTKYEAAQNCKTWIVGKWIAYKEQTWAPVGCHLHQFVVPP  202

Query  564  ILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAI  385
            I   R+DCTYG LA M+LP  V+GL  CEYTM R  VHACHAGG +HSLEGW HHEVGAI
Sbjct  203  IFELRKDCTYGKLAGMQLPDAVEGLSTCEYTMPRRCVHACHAGGILHSLEGWEHHEVGAI  262

Query  384  DVHRIDVVWEAALKHGLKPV  325
            DV++ID+VWEAAL HG KP+
Sbjct  263  DVNKIDMVWEAALNHGFKPM  282



>gb|ERM99525.1| hypothetical protein AMTR_s00088p00066300 [Amborella trichopoda]
Length=364

 Score =   307 bits (787),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+PNL+VRVVHGNTLTAAVIL +I E V +VFLTGATSKLGRAIA+YLC R+VRVLMLT+
Sbjct  161  KNPNLRVRVVHGNTLTAAVILREINEKVDDVFLTGATSKLGRAIAIYLCIRKVRVLMLTN  220

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S +RF+ I  EAP + +K LV VT+Y   KNCKTWIVGKW++ ++Q +APPG +FHQF +
Sbjct  221  SKKRFESILHEAPVEYRKFLVHVTRYDEGKNCKTWIVGKWMSARDQRWAPPGTYFHQFAI  280

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            P I   RRDC YG +AA++LP DVQGLG+CEY M RGVVHACHAGG VH LEGW HHEVG
Sbjct  281  PVITESRRDCKYGKMAAIRLPEDVQGLGSCEYVMGRGVVHACHAGGMVHLLEGWKHHEVG  340

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            AIDV  IDVVW  ALKHG KPVT
Sbjct  341  AIDVDMIDVVWNKALKHGFKPVT  363



>ref|XP_001781794.1| predicted protein [Physcomitrella patens]
 gb|EDQ53442.1| predicted protein [Physcomitrella patens]
Length=625

 Score =   315 bits (806),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVI+  +P DV EVF+TGATSKLGRAIALYLC R +RVLMLT 
Sbjct  421  KHPNLKVRVVHGNTLTAAVIIKTLPPDVKEVFMTGATSKLGRAIALYLCARGIRVLMLTT  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF  IQ+EAPADC+  L+ VTKYQA KNCKTWIVGKW   K+Q +APPG  FHQFVV
Sbjct  481  STERFDAIQREAPADCRNNLIHVTKYQAGKNCKTWIVGKWTFAKDQQWAPPGTFFHQFVV  540

Query  570  PPILPFRRDCTYGDLAAMKLPHD-VQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
            P I   R+DCTYG LA M LP + V+GL  CE+TMERG VHACHAGG +H+LEGW+HHEV
Sbjct  541  PVISEVRKDCTYGQLAGMVLPKEGVKGLRTCEFTMERGAVHACHAGGMIHTLEGWTHHEV  600

Query  393  GAIDVHRIDVVWEAALKHGLKPV  325
            G+IDV RIDVVWEAA++HG  P+
Sbjct  601  GSIDVSRIDVVWEAAMRHGFAPI  623



>ref|XP_002961424.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
 gb|EFJ36684.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
Length=620

 Score =   310 bits (795),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAA++L ++P + +EVFLTG+TSK+GRAIALYLC+R VR++MLT 
Sbjct  418  KHPNLKVRVVHGNTLTAALVLRELPAETSEVFLTGSTSKIGRAIALYLCRRNVRIMMLTT  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ER+Q I  EAPADC+  LVQVTKYQA + CKTWIVGKW T ++Q++AP G+HFHQFVV
Sbjct  478  SRERYQSIVDEAPADCRHNLVQVTKYQAGQTCKTWIVGKWATSQDQSWAPHGSHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+  +R+DCTYG LA MKLP  V+G+ +CEYT +RGVV ACHAGG VH+LE W+HHEVG
Sbjct  538  PPVHEYRKDCTYGKLAGMKLPQSVEGVHSCEYTFDRGVVAACHAGGLVHALENWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            +ID+  ID+VWEAALKHGL+PV
Sbjct  598  SIDIDHIDLVWEAALKHGLEPV  619



>ref|XP_002990278.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
 gb|EFJ08693.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
Length=620

 Score =   310 bits (794),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAA++L ++P + +EVFLTG+TSK+GRAIALYLC+R VR++MLT 
Sbjct  418  KHPNLKVRVVHGNTLTAALVLRELPAETSEVFLTGSTSKIGRAIALYLCRRNVRIMMLTT  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ER+Q I  EAPADC+  LVQVTKYQA + CKTWIVGKW T ++Q++AP G+HFHQFVV
Sbjct  478  SRERYQSIVDEAPADCRHNLVQVTKYQAGQTCKTWIVGKWATSQDQSWAPHGSHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+  +R+DCTYG LA MKLP  V+G+ +CEYT +RGVV ACHAGG VH+LE W+HHEVG
Sbjct  538  PPVHEYRKDCTYGKLAGMKLPQSVEGVHSCEYTFDRGVVAACHAGGLVHALENWTHHEVG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            +ID+  ID+VWEAALKHGL+PV
Sbjct  598  SIDIDHIDLVWEAALKHGLEPV  619



>gb|EMT23422.1| Protein WAX2 [Aegilops tauschii]
Length=694

 Score =   312 bits (799),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 184/258 (71%), Gaps = 56/258 (22%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP +  EVFLTGATSKLGRAIALYLC++++RV+MLT 
Sbjct  437  KHPDLRVRVVHGNTLTAAVILNEIPSNTKEVFLTGATSKLGRAIALYLCRKKIRVVMLTM  496

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAA-------------------------------  664
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQAA                               
Sbjct  497  SSERFLKIQREAPAEFQQYLVQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVV  556

Query  663  -------KNC------------------KTWIVGKWITPKEQNFAPPGAHFHQFVVPPIL  559
                   ++C                   TW+VGKW++P+EQ +APPG HFHQFVVPPI+
Sbjct  557  PPIIGFRRDCTYRRSNHPIAHQFVPLCYDTWLVGKWLSPREQRWAPPGTHFHQFVVPPII  616

Query  558  PFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAIDV  379
             FRRDCTYG LAAM+LP DVQGLG+CEY+MERGVVHACHAGG VH LEGW HHEVGA+DV
Sbjct  617  GFRRDCTYGKLAAMRLPKDVQGLGSCEYSMERGVVHACHAGGVVHFLEGWEHHEVGALDV  676

Query  378  HRIDVVWEAALKHGLKPV  325
             RIDVVW+AALKHGL PV
Sbjct  677  DRIDVVWKAALKHGLTPV  694



>gb|ADE75704.1| unknown [Picea sitchensis]
Length=623

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -2

Query  924  PNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTHST  745
            P+L+VRVVHGNTLTAAVIL+++  DV EVFLTGATSKLGR IALYLC++ +RV+MLT+S 
Sbjct  423  PDLRVRVVHGNTLTAAVILNELNPDVKEVFLTGATSKLGRVIALYLCRKGIRVMMLTYSK  482

Query  744  ERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPP  565
            ERF+ IQ EAP + Q  LVQVTKY+AA+NCKTWIVGKWI  KEQ +AP G H HQFVVPP
Sbjct  483  ERFKSIQSEAPPEFQNFLVQVTKYEAAQNCKTWIVGKWIAYKEQTWAPVGCHLHQFVVPP  542

Query  564  ILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAI  385
            I   R+DCTYG LA M+LP  V+GL  CEYTM R  VHACHAGG +HSLEGW HHEVGAI
Sbjct  543  IFELRKDCTYGKLAGMQLPDAVEGLSTCEYTMPRRCVHACHAGGILHSLEGWEHHEVGAI  602

Query  384  DVHRIDVVWEAALKHGLKPV  325
            DV++ID+VWEAALKHG KP+
Sbjct  603  DVNKIDMVWEAALKHGFKPM  622



>ref|XP_006836672.2| PREDICTED: protein ECERIFERUM 3 [Amborella trichopoda]
Length=626

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+PNL+VRVVHGNTLTAAVIL +I E V +VFLTGATSKLGRAIA+YLC R+VRVLMLT+
Sbjct  423  KNPNLRVRVVHGNTLTAAVILREINEKVDDVFLTGATSKLGRAIAIYLCIRKVRVLMLTN  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S +RF+ I  EAP + +K LV VT+Y   KNCKTWIVGKW++ ++Q +APPG +FHQF +
Sbjct  483  SKKRFESILHEAPVEYRKFLVHVTRYDEGKNCKTWIVGKWMSARDQRWAPPGTYFHQFAI  542

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            P I   RRDC YG +AA++LP DVQGLG+CEY M RGVVHACHAGG VH LEGW HHEVG
Sbjct  543  PVITESRRDCKYGKMAAIRLPEDVQGLGSCEYVMGRGVVHACHAGGMVHLLEGWKHHEVG  602

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            AIDV  IDVVW  ALKHG KPVT
Sbjct  603  AIDVDMIDVVWNKALKHGFKPVT  625



>ref|XP_010914063.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Elaeis guineensis]
Length=596

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 159/201 (79%), Gaps = 23/201 (11%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KH +LKVRVVHG                       ATSKLGRAIALYLC++R+RVLMLT 
Sbjct  418  KHQHLKVRVVHG-----------------------ATSKLGRAIALYLCRKRIRVLMLTL  454

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKIQKEAP +CQ  LVQVTKYQAA++CKTWIVGKW++P EQ +APPG  FHQFVV
Sbjct  455  SAERFQKIQKEAPPECQHYLVQVTKYQAAQSCKTWIVGKWLSPWEQTWAPPGTQFHQFVV  514

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI+ FRRDCTYG LAAM+LP DVQGLG CEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  515  PPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTMDRGVVHACHAGGVVHFLEGWTHHEVG  574

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            AIDV RIDVVW AALKHGL P
Sbjct  575  AIDVDRIDVVWRAALKHGLTP  595



>ref|XP_001783415.1| predicted protein [Physcomitrella patens]
 gb|EDQ51755.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   295 bits (754),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KH +L++RVVHGNTLTAAVIL++IP+DV E+FLTGATSKLGRAIALY C R VRVLMLT 
Sbjct  424  KHKDLRIRVVHGNTLTAAVILNEIPKDVKEIFLTGATSKLGRAIALYFCHRGVRVLMLTT  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S +RF+ IQ E     ++ ++QVTKYQA +NCK W++GKW TP EQ +APPG HFHQFVV
Sbjct  484  SRDRFEMIQSELAPQHRENMIQVTKYQAGQNCKRWVLGKWATPSEQKWAPPGTHFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP++  R+DCTYG L+AM++P +++GL +CE TM RGVVHACHAGG VH+LEGW  HEVG
Sbjct  544  PPVMECRKDCTYGKLSAMQVPKEMKGLRSCEMTMPRGVVHACHAGGLVHALEGWEFHEVG  603

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RID  W AALK G KPV
Sbjct  604  AIDVGRIDETWAAALKQGFKPV  625



>ref|XP_001782380.1| predicted protein [Physcomitrella patens]
 gb|EDQ52834.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVI+  +P DV EVF+ GATSKLGRAIALYLC R +RV+MLT 
Sbjct  418  KHPNLRVRVVHGNTLTAAVIIKTLPSDVKEVFMNGATSKLGRAIALYLCSRGIRVMMLTT  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S +RF  IQ+EAP + +  L+ VTKYQA   CKTWIVGKW   K+Q +APPG HFHQFVV
Sbjct  478  SKDRFDTIQREAPGEFKNNLIHVTKYQAGSKCKTWIVGKWTWQKDQQWAPPGTHFHQFVV  537

Query  570  PPILPFRRDCTYGDLAAMKLP-HDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
            P I  +R+DCTYG LA MKLP   V+GL  CE  MER  VHACHAGG VH+LEGW+HHEV
Sbjct  538  PAIGEWRKDCTYGRLAGMKLPDRGVKGLRTCEMNMERRAVHACHAGGLVHALEGWTHHEV  597

Query  393  GAIDVHRIDVVWEAALKHGLKPV  325
            GAIDV RIDVVW AA++HG   +
Sbjct  598  GAIDVDRIDVVWAAAMRHGFAAI  620



>emb|CAN62442.1| hypothetical protein VITISV_009194 [Vitis vinifera]
Length=459

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 160/202 (79%), Gaps = 13/202 (6%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL +IP++ T+VFLTGATSKLGRAI+LYLC++++ VLMLT 
Sbjct  271  KHPNLRVRVVHGNTLTAAVILKEIPQNATQVFLTGATSKLGRAISLYLCRKKIXVLMLTQ  330

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+ERF+ IQ+EAP DCQ+ LVQVTKYQAA++CKTWI+GKW TP+EQ++APPG HFHQFVV
Sbjct  331  SSERFESIQREAPIDCQQFLVQVTKYQAAQHCKTWIIGKWCTPREQSWAPPGTHFHQFVV  390

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL FRRDCTYG LAAM+LP DV+GLG CE      V+   +  G             G
Sbjct  391  PPILGFRRDCTYGKLAAMRLPEDVEGLGXCEV-----VLFISYKVGLTMRF--------G  437

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV +IDV W AAL HG KPV
Sbjct  438  AIDVDQIDVAWTAALSHGFKPV  459



>emb|CAN69291.1| hypothetical protein VITISV_043141 [Vitis vinifera]
Length=155

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            MLT STERFQKIQ+EAP + Q  LVQVTKYQAA+NCKTWIVGKWITP++QN+AP GAHFH
Sbjct  1    MLTLSTERFQKIQREAPVEFQNYLVQVTKYQAAQNCKTWIVGKWITPRQQNWAPSGAHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPPILPFRRDCTYGDLAA+KLP DVQGLG+CEYTMERGVVHACHAGG VH LEGW+H
Sbjct  61   QFVVPPILPFRRDCTYGDLAALKLPEDVQGLGSCEYTMERGVVHACHAGGVVHVLEGWTH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKPVT  322
            HEVGA+DV RIDVVW+AALKHGLKPV 
Sbjct  121  HEVGALDVDRIDVVWKAALKHGLKPVN  147



>ref|XP_002975687.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
 gb|EFJ23316.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
Length=628

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAV+L+++P +V EVFLTGATSKLGRAIALYLC++ VRVLMLT 
Sbjct  427  KHPDLRVRVVHGNTLTAAVVLNELPAEVEEVFLTGATSKLGRAIALYLCRKGVRVLMLTS  486

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S  R++ I  EA A+ ++ LV VTKYQA + CK WI+GKW+T +EQ FAP G HFHQFVV
Sbjct  487  SRSRYESILSEAAAEHRRNLVHVTKYQAGQYCKRWIIGKWVTEREQGFAPVGTHFHQFVV  546

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+   R DCTYG L  MKLP DV G+  CEY  +RGVV ACHAGG +H+LE WSHHEVG
Sbjct  547  PPVQEVRSDCTYGKLVGMKLPKDVAGVHTCEYINDRGVVAACHAGGLLHALEEWSHHEVG  606

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            +IDV RID VW+AAL  G   V
Sbjct  607  SIDVERIDTVWQAALSRGFTQV  628



>ref|XP_002960347.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
 gb|EFJ37886.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
Length=626

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+ NL+V++VHGNTLTAAV+++++  D  EVFLTG+TSK+GRA+ALYLC+R VRVLMLT+
Sbjct  424  KYTNLRVKIVHGNTLTAAVVINELRPDAKEVFLTGSTSKIGRALALYLCRRGVRVLMLTN  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ER++ + K+AP + QK LVQVTKYQA +NCKTWIVGKWI  K+Q++APPG  FHQFVV
Sbjct  484  SRERYEAVVKDAPVEFQKNLVQVTKYQAGQNCKTWIVGKWIFAKDQSWAPPGTFFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+   R+D TYG L+ M LP + +GL  CE+TM RGVVHACHAGG +H+LEGW HHE+G
Sbjct  544  PPVAEIRKDVTYGKLSGMYLPKNHEGLHFCEFTMPRGVVHACHAGGLLHALEGWDHHEIG  603

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            +ID+  ID VW+AAL+ G  P
Sbjct  604  SIDIENIDKVWQAALRQGFAP  624



>ref|XP_002967368.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
 gb|EFJ31967.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
Length=626

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 164/201 (82%), Gaps = 0/201 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+ NL+V++VHGNTLTAAV+++++  D  EVFLTG+TSK+GRA+ALYLC+R VRVLMLT+
Sbjct  424  KYTNLRVKIVHGNTLTAAVVINELRPDAKEVFLTGSTSKIGRALALYLCRRGVRVLMLTN  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ER++ + K+AP + QK LVQVTKYQA +NCKTWIVGKWI  K+Q++APPG  FHQFVV
Sbjct  484  SRERYEAVVKDAPVEFQKNLVQVTKYQAGQNCKTWIVGKWIFAKDQSWAPPGTFFHQFVV  543

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+   R+D TYG L+ M LP + +GL  CE+TM RGVVHACHAGG +H+LEGW HHE+G
Sbjct  544  PPVAEIRKDVTYGKLSGMYLPKNHEGLHFCEFTMPRGVVHACHAGGLLHALEGWDHHEIG  603

Query  390  AIDVHRIDVVWEAALKHGLKP  328
            +ID+  ID VW+AAL+ G  P
Sbjct  604  SIDIENIDKVWQAALRQGFAP  624



>ref|XP_007154832.1| hypothetical protein PHAVU_003G1516001g [Phaseolus vulgaris]
 gb|ESW26826.1| hypothetical protein PHAVU_003G1516001g [Phaseolus vulgaris]
Length=151

 Score =   264 bits (674),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            MLT ST+RFQ+IQKEAP + Q  LVQVTKYQAA+NCKTWIVGKWITP+EQ +AP G HFH
Sbjct  1    MLTLSTDRFQRIQKEAPVEYQNYLVQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPPIL FR+DCTYGDLAAM+LP DV+GLG CEYTMERGVVHACHAGG VHSLEGW H
Sbjct  61   QFVVPPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMERGVVHACHAGGVVHSLEGWDH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKPVTTFNS  310
            HEVGA+DV+RID+VWEAALKHGL+PV+ F  
Sbjct  121  HEVGALDVNRIDLVWEAALKHGLRPVSRFTQ  151



>gb|AEW67744.1| WAX2 protein [Eutrema halophilum]
Length=157

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  780  RRVRVLMLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAP  601
            R VRVLMLT S ERFQ+IQ+EAPA+ Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP
Sbjct  1    RGVRVLMLTLSVERFQRIQREAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAP  60

Query  600  PGAHFHQFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHS  421
             G HFHQFVVPPIL FRR+CTYGDLAAM+LP DVQGLG+CEYTM+RGVVHACHAGG VH 
Sbjct  61   AGTHFHQFVVPPILNFRRNCTYGDLAAMRLPKDVQGLGHCEYTMDRGVVHACHAGGVVHM  120

Query  420  LEGWSHHEVGAIDVHRIDVVWEAALKHGLKPVTT  319
            LEGW HHEVGAIDV RID+VWEAA+K+GL+PV++
Sbjct  121  LEGWEHHEVGAIDVDRIDLVWEAAMKYGLRPVSS  154



>gb|AFK49575.1| unknown [Lotus japonicus]
Length=153

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            MLT S +RF++IQKEAP + Q  LVQVTKYQAA++CKTWI GKWITP+EQ++AP G HFH
Sbjct  1    MLTLSADRFKRIQKEAPQEYQSYLVQVTKYQAAQHCKTWIAGKWITPREQSWAPRGTHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPPILPFRRDCTYG+LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VHSLEGW+H
Sbjct  61   QFVVPPILPFRRDCTYGELAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVVHSLEGWTH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKPVTTFNS  310
            HEVGAIDV RIDVVW+AALKHGL+PV++ ++
Sbjct  121  HEVGAIDVDRIDVVWKAALKHGLRPVSSGST  151



>ref|XP_002460243.1| hypothetical protein SORBIDRAFT_02g025230 [Sorghum bicolor]
 gb|EER96764.1| hypothetical protein SORBIDRAFT_02g025230 [Sorghum bicolor]
Length=146

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            M+T STERFQKIQKEAPA+ Q+ LVQVTKY+AA++C+TWIVGKW++P+EQ +APPG HFH
Sbjct  1    MMTLSTERFQKIQKEAPAEFQQYLVQVTKYRAAQHCRTWIVGKWLSPREQRWAPPGTHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPPI+ FRRDCTYG LAAM+LP DVQGLG CEY++ERGVVHACHAGG VH LEG++H
Sbjct  61   QFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKP  328
            HEVGAIDVHRIDVVWEAALKHGL+P
Sbjct  121  HEVGAIDVHRIDVVWEAALKHGLRP  145



>gb|AAK68765.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72130.1| Unknown protein [Arabidopsis thaliana]
Length=151

 Score =   253 bits (647),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            MLT S ERFQKIQKEAP + Q  LVQVTKY AA++CKTWIVGKW+TP+EQ++AP G HFH
Sbjct  1    MLTLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPPIL FRR+CTYGDLAAMKLP DV+GLG CEYTMERGVVHACHAGG VH LEGW H
Sbjct  61   QFVVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKPVTTFNS  310
            HEVGAIDV RID+VWEAA+K+GL  V++  +
Sbjct  121  HEVGAIDVDRIDLVWEAAMKYGLSAVSSLTN  151



>gb|KHG04940.1| Protein WAX2 [Gossypium arboreum]
Length=571

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 147/202 (73%), Gaps = 37/202 (18%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRV HGNTL+AAVI+ +IP+DV EVFLTG+TSKLGRAIALYL +R VRVL    
Sbjct  404  KHPQLKVRVCHGNTLSAAVIVKEIPKDVKEVFLTGSTSKLGRAIALYLSRRHVRVL----  459

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
                                             TWI GKWITP EQ++AP G HFHQFVV
Sbjct  460  ---------------------------------TWIAGKWITPWEQSWAPSGTHFHQFVV  486

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPIL  RRDCTYGDLAAM+LP DV+GLG+CEY +ERGVVHACHAGGAVH LEGW+HHE+G
Sbjct  487  PPILASRRDCTYGDLAAMRLPEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIG  546

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
             IDV RID+VWEAALKHG +PV
Sbjct  547  PIDVDRIDLVWEAALKHGFRPV  568



>gb|ACF79563.1| unknown [Zea mays]
Length=146

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            MLT STERF KIQ+EAP + Q+ +VQVTKYQAA+ CKTWIVGKW++P+EQ +APPG HFH
Sbjct  1    MLTLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPPI+ FRRDCTYG LAAM+LP DV+GLG+CEYTMERGVVHACHAGG VH LEGW H
Sbjct  61   QFVVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKP  328
            HEVGA++V RIDVVWEAALKHGL P
Sbjct  121  HEVGALEVDRIDVVWEAALKHGLTP  145



>ref|XP_009387452.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAV+L++IP D  EVFLTGATSKLGRAIALYLC++ +RVLMLT 
Sbjct  416  KHPDLRVRVVHGNTLTAAVMLNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTL  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF  IQKEAPADCQ  LVQVTK QAA+NCKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  476  SAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVV  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHA  439
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CE      +   C +
Sbjct  536  PPIIGFRRDCTYGSLAAMRLPKDVQGLGSCEVVQTYSLPAKCRS  579



>ref|XP_009387450.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAV+L++IP D  EVFLTGATSKLGRAIALYLC++ +RVLMLT 
Sbjct  446  KHPDLRVRVVHGNTLTAAVMLNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTL  505

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF  IQKEAPADCQ  LVQVTK QAA+NCKTWIVGKW++P+EQ +APPG HFHQFVV
Sbjct  506  SAERFLNIQKEAPADCQHHLVQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVV  565

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHA  439
            PPI+ FRRDCTYG LAAM+LP DVQGLG+CE      +   C +
Sbjct  566  PPIIGFRRDCTYGSLAAMRLPKDVQGLGSCEVVQTYSLPAKCRS  609



>ref|XP_003061467.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54097.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 147/203 (72%), Gaps = 0/203 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL VRVVHGNTLTAA IL  IP+DV E+FLTGATSKLGRAIALYL  + VRV+M T 
Sbjct  419  KHPNLNVRVVHGNTLTAAAILQKIPDDVREIFLTGATSKLGRAIALYLSAKGVRVVMYTT  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF+KI+ EA    QK +VQ T  +  +  K W+VGK  +PK+Q  AP  A FHQFVV
Sbjct  479  SKERFEKIRGEARRQDQKNIVQATTLEEGRGIKDWVVGKHCSPKDQEKAPKHATFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PPI   RRDC Y +L A  LP D +   +CE TMERG VHACHAG  VH+LEGW+++EVG
Sbjct  539  PPIPETRRDCVYTNLPAFALPKDAKDFRSCEMTMERGHVHACHAGALVHALEGWTYNEVG  598

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
            AID  RID  WEAA+KHG K  T
Sbjct  599  AIDHTRIDSTWEAAMKHGFKLAT  621



>ref|XP_009132284.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=580

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVH NTLTAAVIL+ +P+DV EVFL GATSKLGRAIALYLC+R VRVLMLT 
Sbjct  429  KHPDLRVRVVHVNTLTAAVILNGVPKDVKEVFLIGATSKLGRAIALYLCRRGVRVLMLTL  488

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF+KIQKEAP++ QK LVQVTKY +A++CKTWIVGKW+TP+EQ++AP G HFHQFVV
Sbjct  489  SVERFEKIQKEAPSEFQKYLVQVTKYNSAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVV  548

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCE  478
            PPIL FRR+CTY +LAAM+LP DVQGLG CE
Sbjct  549  PPILKFRRNCTYDELAAMRLPKDVQGLGTCE  579



>ref|XP_002509294.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70552.1| predicted protein [Micromonas sp. RCC299]
Length=620

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 148/199 (74%), Gaps = 0/199 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAA IL  IP DV E+FLTG+TSKLGRAIALYL  R VRV+M T 
Sbjct  419  KHPNLRVRVVHGNTLTAAAILKKIPADVKEIFLTGSTSKLGRAIALYLSARGVRVVMYTT  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            + +RF+KI+ EA  + ++LLVQ T  +     K W+VGK+ + ++Q  AP  A FHQFVV
Sbjct  479  AKDRFEKIKAEAREEHRELLVQATTLEEGSGIKDWVVGKFCSARDQAKAPKHATFHQFVV  538

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+   RRDC Y DL A KLP + +   +CE TMERG VHACHAG  VH+LEGW+++EVG
Sbjct  539  PPLEESRRDCAYTDLPAFKLPKEAKDFRSCEMTMERGHVHACHAGALVHALEGWTYNEVG  598

Query  390  AIDVHRIDVVWEAALKHGL  334
            AID  +IDV W+AA+KHG 
Sbjct  599  AIDHTKIDVTWDAAVKHGF  617



>ref|XP_005822223.1| hypothetical protein GUITHDRAFT_158756 [Guillardia theta CCMP2712]
 gb|EKX35243.1| hypothetical protein GUITHDRAFT_158756 [Guillardia theta CCMP2712]
Length=538

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L++R+VHGNTLTAA +LH IP  V E F+ GATSKLGRAI+LYL ++ V+V M+T 
Sbjct  331  KHPDLRLRLVHGNTLTAAAVLHKIPRGVEEAFVVGATSKLGRAISLYLARKGVKVTMMTQ  390

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERF+ I+ + PA  +  L      +  +NC  W+VG+++TP EQ  AP G  FHQFVV
Sbjct  391  SRERFEGIRSDCPAAYRGNLKHSLSIEDGRNCSCWVVGRFLTPAEQKVAPRGTTFHQFVV  450

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
            PP+   R+DC+Y  L A  LP    G  +CE TMER  VHACHAG  VH LEGW+HHEVG
Sbjct  451  PPLPELRKDCSYTSLPAFTLPDSATGFRSCEMTMERRNVHACHAGALVHLLEGWTHHEVG  510

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AID  RIDV WEAA +HG + V
Sbjct  511  AIDPDRIDVTWEAAERHGFRLV  532



>emb|CEF99557.1| Uncharacterised domain Wax2, C-terminal [Ostreococcus tauri]
Length=621

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 138/197 (70%), Gaps = 0/197 (0%)
 Frame = -2

Query  921  NLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTHSTE  742
            +LK RVVHGNTLTAA IL  IP D  E+FLTGATSKLGRAIALY  +R VRV+M T S E
Sbjct  423  SLKTRVVHGNTLTAAAILQKIPNDCKEIFLTGATSKLGRAIALYCAERGVRVVMYTTSEE  482

Query  741  RFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPPI  562
            RF+ I+ EAP   Q L VQ T      N K W++GK  + K+Q  AP GA FHQFVVPPI
Sbjct  483  RFEMIRAEAPKKDQHLFVQSTSLTDGANIKDWVIGKHCSMKDQKSAPRGATFHQFVVPPI  542

Query  561  LPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAID  382
               R+DC Y DL A KLP + +   +CE TM RG VHACHAG  VH+LEGW HHEVGAID
Sbjct  543  PESRKDCVYTDLPAFKLPRESKDFRSCEMTMPRGHVHACHAGALVHALEGWDHHEVGAID  602

Query  381  VHRIDVVWEAALKHGLK  331
              RID+ WEAALKHG  
Sbjct  603  HTRIDLTWEAALKHGFS  619



>ref|XP_003081883.1| faceless pollen-1 (ISS) [Ostreococcus tauri]
Length=675

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 138/197 (70%), Gaps = 0/197 (0%)
 Frame = -2

Query  921  NLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTHSTE  742
            +LK RVVHGNTLTAA IL  IP D  E+FLTGATSKLGRAIALY  +R VRV+M T S E
Sbjct  477  SLKTRVVHGNTLTAAAILQKIPNDCKEIFLTGATSKLGRAIALYCAERGVRVVMYTTSEE  536

Query  741  RFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPPI  562
            RF+ I+ EAP   Q L VQ T      N K W++GK  + K+Q  AP GA FHQFVVPPI
Sbjct  537  RFEMIRAEAPKKDQHLFVQSTSLTDGANIKDWVIGKHCSMKDQKSAPRGATFHQFVVPPI  596

Query  561  LPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAID  382
               R+DC Y DL A KLP + +   +CE TM RG VHACHAG  VH+LEGW HHEVGAID
Sbjct  597  PESRKDCVYTDLPAFKLPRESKDFRSCEMTMPRGHVHACHAGALVHALEGWDHHEVGAID  656

Query  381  VHRIDVVWEAALKHGLK  331
              RID+ WEAALKHG  
Sbjct  657  HTRIDLTWEAALKHGFS  673



>ref|XP_001420263.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98556.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=621

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 138/196 (70%), Gaps = 0/196 (0%)
 Frame = -2

Query  921  NLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTHSTE  742
            +LK RVVHGNTLTAA IL  IP +  E+FLTGATSKLGRAIALY  +R +RV+M T S E
Sbjct  423  SLKTRVVHGNTLTAAAILQKIPSECKEIFLTGATSKLGRAIALYCVERGMRVVMYTTSEE  482

Query  741  RFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPPI  562
            RF+KI+ EA    Q LLVQ T        K W++GK    K+QN AP GA FHQFVVPPI
Sbjct  483  RFEKIRNEAAKKDQHLLVQSTSLSDGAKIKDWVIGKHCPEKDQNMAPRGAIFHQFVVPPI  542

Query  561  LPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAID  382
               R+DC Y DL A KLP + +   +CE TM+RG +HACHAG  VHSLEGW HHEVGAID
Sbjct  543  PETRKDCVYTDLPAFKLPKEAKDFRSCEMTMKRGHIHACHAGALVHSLEGWDHHEVGAID  602

Query  381  VHRIDVVWEAALKHGL  334
              RID  WEAALKHG 
Sbjct  603  HTRIDTTWEAALKHGF  618



>gb|AAA33934.1| lipid transfer protein, partial [Senecio odorus]
Length=524

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++I EDV EVFLTGATSKLGRAIALYLC+R V VLMLT 
Sbjct  388  KHPNLKVRVVHGNTLTAAVILNEINEDVKEVFLTGATSKLGRAIALYLCRRGVHVLMLTL  447

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQ IQ+EAP+ C+K LVQVTKYQAAKNCKTW++GKWITP +Q +AP G HFHQFVV
Sbjct  448  STERFQNIQEEAPSKCRKNLVQVTKYQAAKNCKTWVIGKWITPGQQRWAPSGTHFHQFVV  507

Query  570  PPILPFRR  547
            PPIL FRR
Sbjct  508  PPILAFRR  515



>ref|XP_010103144.1| Protein WAX2 [Morus notabilis]
 gb|EXB94909.1| Protein WAX2 [Morus notabilis]
Length=623

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 116/151 (77%), Gaps = 26/151 (17%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVRVVHGNTLTAAVIL++IP+DVTE                          MLT 
Sbjct  423  KHPNLKVRVVHGNTLTAAVILNEIPKDVTE--------------------------MLTI  456

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQKEAPADCQ  LVQ+TKY AA+NCKTWIVGKWITP+EQ +AP G HFHQFVV
Sbjct  457  STERFQKIQKEAPADCQSYLVQITKYHAAQNCKTWIVGKWITPREQGWAPSGTHFHQFVV  516

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCE  478
            PPIL FRRDCTYGDLAAM+LP DV+GLG+CE
Sbjct  517  PPILSFRRDCTYGDLAAMRLPEDVEGLGSCE  547



>ref|XP_011012180.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=527

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 124/176 (70%), Gaps = 2/176 (1%)
 Frame = -2

Query  846  TEVFLTGATSKLGRAIALYLCQRRVRVLMLTHSTERFQKIQKEAPADCQKLLVQVTKYQA  667
            ++ FL    +  GR    +   R      L  + E   K  +EA     +L V+V    A
Sbjct  346  SKTFLISFYNLRGRLHETWSVPRFGFQYFLPFAKEGINKHIEEAILRANRLGVKVISLAA  405

Query  666  AKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPPILPFRRDCTYGDLAAMKLPHDVQGLG  487
                KTWIVGKWITP EQ++AP G HFHQFVVPPIL FRRDCTYGDLAAM+LP +VQGLG
Sbjct  406  LN--KTWIVGKWITPGEQSWAPTGTHFHQFVVPPILSFRRDCTYGDLAAMRLPDEVQGLG  463

Query  486  NCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAIDVHRIDVVWEAALKHGLKPVTT  319
            NCEYTM+RGVVHACHAGG VH LEGW+HHEVGAIDV RID+VW AALKHGLKPV+ 
Sbjct  464  NCEYTMDRGVVHACHAGGVVHLLEGWAHHEVGAIDVDRIDLVWNAALKHGLKPVSN  519



>ref|XP_002993505.1| hypothetical protein SELMODRAFT_137211 [Selaginella moellendorffii]
 gb|EFJ05397.1| hypothetical protein SELMODRAFT_137211 [Selaginella moellendorffii]
Length=146

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -2

Query  762  MLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFH  583
            MLT S  R++ I  EA A+ ++ LV VTKYQA + CK WI+GKW+T +EQ FAP G HFH
Sbjct  1    MLTSSRSRYESILSEAAAEHRRNLVHVTKYQAGQYCKRWIIGKWVTEREQGFAPVGTHFH  60

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
            QFVVPP+   R DCTYG L  M+LP DV G+  CEY  +RGVV ACHAGG +H+LE WSH
Sbjct  61   QFVVPPVQEVRSDCTYGKLVGMRLPKDVAGVHTCEYINDRGVVAACHAGGLLHALEEWSH  120

Query  402  HEVGAIDVHRIDVVWEAALKHGLKPV  325
            HEVG+IDV RID VW+AAL  G   V
Sbjct  121  HEVGSIDVERIDTVWQAALSRGFTQV  146



>ref|XP_007509665.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19468.1| predicted protein [Bathycoccus prasinos]
Length=681

 Score =   208 bits (530),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 139/251 (55%), Gaps = 55/251 (22%)
 Frame = -2

Query  921  NLK-VRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRR-VRVLMLTHS  748
            NLK  +VVHGNTLTAA I+  IPE+V E+FLTGATSKLGRAIALY+  ++  RVLM T S
Sbjct  428  NLKNTKVVHGNTLTAAAIIDKIPENVKEIFLTGATSKLGRAIALYMATKKNCRVLMCTTS  487

Query  747  TERFQKIQKEAPADCQKLLVQV--------------------------------------  682
             ERF+KI+ E P   + LL +V                                      
Sbjct  488  EERFEKIKMECPEKFRHLLFRVNNANEKVEITQESTSNVLKKSGSFLLSRLGSLKNNNNN  547

Query  681  --------------TKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVVPPILPFRRD  544
                          T Y + + C+ W+VG+     EQ+ AP    FHQFVVPPI   R D
Sbjct  548  NNREVETEEKNDTKTNYSSGRTCRNWVVGRHCDKNEQSLAPSKTTFHQFVVPPIPETRSD  607

Query  543  CTYGDLAAMKLPH-DVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAIDVHRID  367
            C Y DL A +LP  + +    CE TMERG VHACHAG  +H+LEGW HHEVGAID  +ID
Sbjct  608  CAYTDLPAFRLPEKEAKDFKTCEMTMERGCVHACHAGALIHALEGWQHHEVGAIDPEKID  667

Query  366  VVWEAALKHGL  334
            V W+A+ KHG 
Sbjct  668  VTWKASKKHGF  678



>gb|EPS58637.1| hypothetical protein M569_16175, partial [Genlisea aurea]
Length=320

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VR+VHGNTLTAAVIL+ IP +VTEVFLTGATSKLGRAIALYLC++RV VLMLT 
Sbjct  186  KHPNLRVRIVHGNTLTAAVILNKIPAEVTEVFLTGATSKLGRAIALYLCKKRVTVLMLTA  245

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERF+ IQKEA AD +K LVQVT ++AA+NCKTWI+GKWIT ++Q +AP G HFHQFVV
Sbjct  246  STERFRDIQKEAAADGRKFLVQVTGHEAAQNCKTWIMGKWITQEQQRWAPAGTHFHQFVV  305

Query  570  PPI  562
            PPI
Sbjct  306  PPI  308



>ref|XP_002528208.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF34165.1| sterol desaturase, putative [Ricinus communis]
Length=578

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 134/211 (64%), Gaps = 59/211 (28%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++I +DVTEVFLTGATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  424  KHPDLRVRVVHGNTLTAAVILNEISKDVTEVFLTGATSKLGRAIALYLCRRKVRVLMLTL  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            STERFQKIQK                +A  +C++++V   +T                  
Sbjct  484  STERFQKIQK----------------EAPLDCQSYLVQ--VT------------------  507

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
                                    Q   NC+YTM+RGVVHACHAGG VH LEGWSHHEVG
Sbjct  508  ----------------------KYQAAQNCKYTMDRGVVHACHAGGVVHLLEGWSHHEVG  545

Query  390  AIDVHRIDVVWEAALKHGLKPVTT-FNSKLT  301
            AIDV RID+VW AALKHGLKPV+   N KL 
Sbjct  546  AIDVDRIDLVWNAALKHGLKPVSNVINQKLN  576



>ref|XP_010929211.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Elaeis guineensis]
Length=561

 Score =   193 bits (490),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 124/202 (61%), Gaps = 58/202 (29%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  418  KHPDLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S ERFQKI                                     Q  APP         
Sbjct  478  SAERFQKI-------------------------------------QKEAPP---------  491

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
                    +C +  +   K     Q   NCEYTM+RGVVHACHAGG VH LEGW+HHEVG
Sbjct  492  --------ECQHYLVQVTK----YQAAQNCEYTMQRGVVHACHAGGVVHFLEGWTHHEVG  539

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            AIDV RIDVVW AALKHGL PV
Sbjct  540  AIDVDRIDVVWRAALKHGLTPV  561



>ref|XP_001756318.1| predicted protein [Physcomitrella patens]
 gb|EDQ78714.1| predicted protein [Physcomitrella patens]
Length=628

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 133/202 (66%), Gaps = 3/202 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            ++P+LKVR+V G TLTAAV+++ +P+   EVFL G +S L R++ +YL +R VRVL+LT+
Sbjct  425  RNPHLKVRIVTGLTLTAAVVINRLPKQTKEVFLVG-SSDLIRSVEIYLVRRGVRVLVLTN  483

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFV-  574
            S   F   Q +     Q+L+V V  +Q  ++C+ WI+ +++  K+  +APPGA  H    
Sbjct  484  SPRYFGSTQPKVTKVNQQLIVNVMSFQEGQHCREWILDEYVEGKDLKWAPPGADLHHVCQ  543

Query  573  -VPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHE  397
               P+   R+DCTY    AM +P  ++GL +CE  + RGV+ A HA G VHSLE W+H+E
Sbjct  544  GSKPLPRTRKDCTYAMYPAMHVPKSMKGLRSCEGGLPRGVISASHAAGVVHSLEKWTHNE  603

Query  396  VGAIDVHRIDVVWEAALKHGLK  331
            VG IDV RID VW AALKHG +
Sbjct  604  VGPIDVERIDTVWAAALKHGFQ  625



>gb|ADE77466.1| unknown [Picea sitchensis]
Length=228

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 126/213 (59%), Gaps = 9/213 (4%)
 Frame = -2

Query  930  KHPNLK---VRVVHGNTLTAAVILHDIPE-DVTEVFLT-GATSKLGRAIALYLCQRRVRV  766
            +H NL+   VR+V G+TL AA +L+ I E + +EV L  G  SK+G  I   LC+R +RV
Sbjct  15   RHENLRHLRVRIVDGSTLAAAFVLNSIREKETSEVLLILGGASKVGSGITRVLCERGIRV  74

Query  765  LMLTHSTERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHF  586
             +L  S E+FQK +   P +    L QVT YQ+  NCKTWIVG W+T ++Q  AP G  F
Sbjct  75   QLLVDSEEQFQKSKMGVPWEFTHNLFQVTSYQSCINCKTWIVGSWLTREDQMKAPKGTRF  134

Query  585  HQFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWS  406
              F+  PI   R DCTY  + AM +P +++ L  CE  + R V+ A   GG VH+LE W+
Sbjct  135  IPFLPFPIPNVREDCTYQTVPAMSVPKNLENLHACENGLPRRVMSAWRVGGIVHALEEWN  194

Query  405  HHEV-GAIDVHRIDVVWEAALKHGLKPVTTFNS  310
            HHE    ID   +  VW+AA KHG  P   FNS
Sbjct  195  HHECDDVIDSASVTRVWDAATKHGFLP---FNS  224



>gb|EMT05122.1| Protein WAX2 [Aegilops tauschii]
Length=465

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+  TEVF+TGATSKLGRAIALYLC++++RV+M+T 
Sbjct  292  KHPDLRVRVVHGNTLTAAVILNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTL  351

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQ  613
            STERFQKIQKEA A+ Q+ LVQVTK+Q+A+ CKTWIVGKW++P+EQ
Sbjct  352  STERFQKIQKEAAAEDQQYLVQVTKFQSAEQCKTWIVGKWLSPREQ  397



>gb|EMS58990.1| Protein WAX2 [Triticum urartu]
Length=532

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HPNL+VRVVHGNTLTAAVIL++IP+  TEVF+TGATSKLGRAIALYLC++++RV+M+T 
Sbjct  373  QHPNLRVRVVHGNTLTAAVILNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTL  432

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQ  613
            STERFQKIQKEA A+ Q+ LVQVTK+Q+A+ CKTWIVGKW++P+EQ
Sbjct  433  STERFQKIQKEAAAEDQQYLVQVTKFQSAEQCKTWIVGKWLSPREQ  478



>ref|XP_002989550.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
 gb|EFJ09426.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
Length=621

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 126/202 (62%), Gaps = 5/202 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP L ++VV G+TLT+A++L  +P+D +EVFL G   K+GRAIA YLC+ R   ++   
Sbjct  422  NHPGLSIKVVDGSTLTSAIVLDKLPKDASEVFLVGVEHKVGRAIANYLCRHRATEVLAKS  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S+  F+ ++K  P + Q  L+ VT +    N + WIVG+ +   EQ  AP GA F+QF  
Sbjct  482  SSYAFESLKKSVPQESQHKLLDVTCW----NLQAWIVGEPLRAMEQLHAPSGACFYQFTE  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
              +   R DC+Y  L AM+LP + +G+  CE +M RGVV A HAGG + ++E W+HHEVG
Sbjct  538  EAMEETRPDCSYAKLPAMRLPPEYKGIRACEGSMPRGVVQASHAGGILATMENWNHHEVG  597

Query  390  -AIDVHRIDVVWEAALKHGLKP  328
              IDV +ID V  AA+  G  P
Sbjct  598  NTIDVDKIDAVMRAAVNRGFVP  619



>ref|XP_002964260.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
 gb|EFJ34593.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
Length=615

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 125/202 (62%), Gaps = 10/202 (5%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP+L ++VV G+TLT+A++L  +P+D +EVFL GA  K+GRAIA YLC+ R        
Sbjct  421  NHPDLSIKVVDGSTLTSAIVLDKLPKDASEVFLVGAEHKVGRAIANYLCRHR--------  472

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            +TE    ++K  P + Q  LV V   +  ++CK WIVG+ +   EQ  AP GA F+QF  
Sbjct  473  ATE-VTSLKKSVPQESQHKLVAVESLEHGRHCKAWIVGEPLRAMEQLHAPSGACFYQFTE  531

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
              +   R DC Y  L AM+LP + +G+  CE +M RGVV A HAGG + ++E W+HHEVG
Sbjct  532  EAMEETRPDCLYAKLPAMRLPPEYKGIRACEGSMPRGVVQASHAGGILATMENWNHHEVG  591

Query  390  -AIDVHRIDVVWEAALKHGLKP  328
              IDV +ID V  AA+  G  P
Sbjct  592  NTIDVDKIDAVMRAAVNRGFVP  613



>gb|KJB23545.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=525

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+LKVRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  420  KHPDLKVRVVHGNTLTAAVILNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            STERFQKIQ+EAPADCQ  LVQVTKYQAA+NCK
Sbjct  480  STERFQKIQREAPADCQNYLVQVTKYQAAQNCK  512



>ref|XP_008223563.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Prunus mume]
Length=575

 Score =   165 bits (418),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP+DV EVFL+GATSKLGRAIALYLC+R+VRVLMLT 
Sbjct  423  KHPDLRVRVVHGNTLTAAVILNEIPKDVEEVFLSGATSKLGRAIALYLCRRKVRVLMLTL  482

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            STERFQKIQKEAPADCQ  LVQVTKYQAA+NCK
Sbjct  483  STERFQKIQKEAPADCQHYLVQVTKYQAARNCK  515


 Score = 39.7 bits (91),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -3

Query  650  HG*LGSGSHQKNKTLHPQEPIFTSLWFLQSCPSEETALMVILQP  519
            HG L +GSHQ++        IF S     SC SEETALMVILQP
Sbjct  532  HGLLANGSHQESNVGPQVVHIFISSLCHPSCISEETALMVILQP  575



>gb|EEC81004.1| hypothetical protein OsI_23762 [Oryza sativa Indica Group]
Length=126

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAAVIL++IP DV EVFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  34   KHPDLRVRVVHGNTLTAAVILNEIPGDVAEVFLTGATSKLGRAIALYLCRKKIRVLMLTL  93

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            STERF  IQ+EAPA+ Q+ LVQVTKYQAA+NCK
Sbjct  94   STERFMNIQREAPAEFQQYLVQVTKYQAAQNCK  126



>ref|XP_008804903.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Phoenix dactylifera]
Length=565

 Score =   147 bits (370),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             H +LKVRVVHGNTLTAAVIL++IP+D  E+FLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  418  NHRDLKVRVVHGNTLTAAVILNEIPKDAKEIFLTGATSKLGRAIALYLCRKKIRVLMLTL  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKN  658
            S ERFQKIQKEAP +CQ  LVQVTKYQAA+N
Sbjct  478  SAERFQKIQKEAPPECQHYLVQVTKYQAAQN  508


 Score = 48.5 bits (114),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -1

Query  649  MDSWEVDHTKRTKLCTPRSPFSPVCGSSNLALQKRLHLW*SCSHEttt*CSRS  491
            MD W+V  TK   + T R    PVCGSS   LQ+ LHLW +  HE +  C+R+
Sbjct  510  MDRWQVAITKGAAVGTTRHALPPVCGSSYYWLQEGLHLWKAGCHEASPGCTRT  562



>ref|XP_010545442.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Tarenaya hassleriana]
Length=523

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNL+VRVVHGNTLTAAVIL++IP+DV EVFLTGATSKLGRAIALYLC+RRVRVLMLT 
Sbjct  422  KHPNLRVRVVHGNTLTAAVILNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTL  481

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            STERFQKIQKEA  + Q  LVQVTKYQAA++CK
Sbjct  482  STERFQKIQKEAAVEDQNYLVQVTKYQAAQHCK  514



>gb|KJB83321.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=514

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  421  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            STERFQKI KE P DCQ  LVQVTKYQAA+NCK
Sbjct  481  STERFQKILKETPVDCQNYLVQVTKYQAAQNCK  513



>gb|KJB83322.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=569

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVVHGNTLTAAVIL++  +DV EVFLTGATSKLGRA ALYLC++RVRVLMLT 
Sbjct  421  KHPELKVRVVHGNTLTAAVILNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTS  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            STERFQKI KE P DCQ  LVQVTKYQAA+NCK
Sbjct  481  STERFQKILKETPVDCQNYLVQVTKYQAAQNCK  513


 Score =   114 bits (285),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  498  QGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAIDVHRIDVVWEAALKHGLKPVTT  319
            Q   NC+YTMERGVVHACHAGG VH LEGWSHHEVGAIDV RID+VWEAALKHGLKPV++
Sbjct  507  QAAQNCKYTMERGVVHACHAGGVVHQLEGWSHHEVGAIDVDRIDLVWEAALKHGLKPVSS  566

Query  318  FNS  310
             N+
Sbjct  567  VNN  569



>ref|XP_011073243.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Sesamum indicum]
Length=547

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP+L+VRVVHGNTLTAA IL++IP+DV EVFLTGATSKLGRAIALYL +R+V+VLMLT 
Sbjct  442  KHPDLRVRVVHGNTLTAAAILNEIPKDVDEVFLTGATSKLGRAIALYLARRKVKVLMLTL  501

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            S ERF KIQ+EAP DCQK LVQVTKYQAAK+CK
Sbjct  502  SKERFLKIQEEAPVDCQKYLVQVTKYQAAKHCK  534



>gb|EEE56435.1| hypothetical protein OsJ_05611 [Oryza sativa Japonica Group]
Length=550

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVVHGNTLTAAVIL++IP +V +VFLTGATSKLGRAIALYLC++++RVLMLT 
Sbjct  412  KHPELRVRVVHGNTLTAAVILNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTL  471

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCK  652
            S+ERF KIQ+EAPA+ Q+ LVQVTKYQ A+NCK
Sbjct  472  SSERFLKIQREAPAEFQQYLVQVTKYQPAQNCK  504



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 123/202 (61%), Gaps = 7/202 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            ++P LK+RVV G++L  A +L++IP+  TEV L G  +K+ R++AL LC+R ++V +   
Sbjct  412  RYPKLKLRVVDGSSLAVATVLNNIPKGTTEVLLVGNLTKVARSVALALCERGIQVNI--S  469

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            S   F+K+++   +  Q  LV ++K  AA   KTW+VG  +T K+Q  AP GA F  F  
Sbjct  470  SQYEFEKLKQSVAS--QSNLVVLSKSVAA--YKTWLVGDGLTEKQQLNAPKGALFIPFST  525

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R DC+Y    AM  P  +Q L +CE  + R  + A  A G VH+LEGW+ HE G
Sbjct  526  FPPKKVRSDCSYLHTPAMLAPASLQNLDSCENWLPRRALSAVRAAGIVHALEGWTEHECG  585

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
              ++  ++ VW+AALKHG +P+
Sbjct  586  E-NMLNVEEVWQAALKHGFRPL  606



>ref|XP_009118866.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=644

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 116/204 (57%), Gaps = 5/204 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP +KVRVV G+ LTAAV+++ +P+  T++ +TG  +K+   IA  LCQR V VL L  
Sbjct  435  KHPEMKVRVVDGSRLTAAVVINSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVLTLL-  493

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E ++K++   P +C+  LV +T    A N K W++G+  T +EQ  A  G  F  F  
Sbjct  494  -PEEYEKLRSLVPQECRDRLVLLTSETLASN-KVWLMGEGTTREEQEMATKGTLFIPFSQ  551

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  552  FPLKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWEMHECG  611

Query  390  AIDV--HRIDVVWEAALKHGLKPV  325
              ++    +D VWEA L HG +P+
Sbjct  612  TSNILLSDLDQVWEACLTHGFQPL  635



>gb|AHD24918.1| CER1 [Brassica napus]
Length=628

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 5/204 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP +KVRVV G+ LTAAV+++ +P+  T++ +TG  +K+   IA  LCQR V VL L  
Sbjct  419  KHPEMKVRVVDGSRLTAAVVINSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVLTLL-  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E ++K+    P +C+  L+ +T    A N K W++G+  T +EQ  A  G  F  F  
Sbjct  478  -PEEYEKLSSFVPKECRDRLILLTSETLASN-KVWLMGEGTTREEQEMATKGTLFIPFSQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  536  FPLKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWETHECG  595

Query  390  AIDV--HRIDVVWEAALKHGLKPV  325
              ++    +D VWEA L HG +P+
Sbjct  596  TSNILLSDLDQVWEACLSHGFQPL  619



>ref|XP_010505369.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=634

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 112/206 (54%), Gaps = 9/206 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  421  KHPKLKIRIVDGSSLAAEVVLHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKVMVL--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y    N   W+VG  ++ KEQ  A  G  F  F  
Sbjct  479  RKEEHSMLAEFLDDSCKENLVLTTNY----NPMIWLVGDGVSTKEQKMAKEGTMFLPFSQ  534

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  + R V+ A   GG VHSLEGW  HE G
Sbjct  535  FPPDKLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECG  594

Query  390  AIDVHRIDV--VWEAALKHGLKPVTT  319
             +D   ++   VWEAAL++G +P+ T
Sbjct  595  -LDNSILNSPRVWEAALRNGFQPLRT  619



>ref|XP_010509285.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=630

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 112/206 (54%), Gaps = 9/206 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  418  KHPKLKIRIVDGSSLAAEVVLHSIPIGTKEVLFRGQVTKVARAIVFSLCQNAIKVMVL--  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y    N   W+VG  ++ KEQ  A  G  F  F  
Sbjct  476  RKEEHSMLAEFLADSCKENLVLTTNY----NPMIWLVGDGVSTKEQKMAKEGTLFLPFSQ  531

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  + R V+ A   GG VHSLEGW  HE G
Sbjct  532  FPPDKLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECG  591

Query  390  AIDVHRIDV--VWEAALKHGLKPVTT  319
             +D   ++   VWEAAL++G +P+ T
Sbjct  592  -LDNSILNSPRVWEAALRNGFQPLRT  616



>gb|EMS51791.1| hypothetical protein TRIUR3_23680 [Triticum urartu]
Length=219

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 111/203 (55%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P L VR+V G+ L   V+L  IP D  +VFL   TSK+ RA+A+ LC R ++V+M  +
Sbjct  23   KYPKLGVRIVDGSGLATGVVLKSIPSDAKQVFLHTGTSKIARAVAMALCGRGIQVIM--N  80

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + +  ++ + P D    L    K  +    K W+V + I  KEQ  AP G  F     
Sbjct  81   RKKEYDMLKSQMPEDGASYL----KCSSNDITKIWLVER-IDDKEQRMAPKGTVFIPISQ  135

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DCTY    AMK+P  +Q + +CE  + R V+ A H  G +H LEGWS HE G
Sbjct  136  FPLKKVRKDCTYLSTPAMKIPDTMQNIHSCENWLPRRVMSAWHIAGILHVLEGWSVHECG  195

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
              D+   +  W AA++HG  P+T
Sbjct  196  D-DMMDSEKAWSAAIRHGFVPLT  217



>emb|CDY38059.1| BnaCnng09200D [Brassica napus]
Length=829

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 115/204 (56%), Gaps = 5/204 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP +KVRVV G+ LTAAV+++ +P+  T++ +TG  +K+   IA  LCQR V VL L  
Sbjct  620  KHPEMKVRVVDGSRLTAAVVINSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVLTLL-  678

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E ++K+    P +C+  L+ +T    A N K W++G+  T +EQ  A  G  F  F  
Sbjct  679  -PEEYEKLSSFVPKECRDRLILLTSETLASN-KVWLMGEGTTREEQEMATKGTLFIPFSQ  736

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  737  FPLKQLRRDCIYHTPPALIIPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWETHECG  796

Query  390  AIDV--HRIDVVWEAALKHGLKPV  325
              ++    +D VWEA L HG +P+
Sbjct  797  TSNILLSDLDQVWEACLSHGFQPL  820



>ref|XP_010517047.1| PREDICTED: protein CER1-like 2 isoform X2 [Camelina sativa]
Length=586

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 109/203 (54%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  381  KHPKLKIRIVDGSSLAAEVVLHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKVMVL--  438

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y    N   W+VG  ++ KEQ  A  G  F  F  
Sbjct  439  RKEEHSMLAEFLDDSCKENLVLTTNY----NPMIWLVGDGVSTKEQKMAKEGTLFLPFSQ  494

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  + R V+ A   GG VHSLEGW  HE G
Sbjct  495  FPPDKLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECG  554

Query  390  AID-VHRIDVVWEAALKHGLKPV  325
              + V     VWEAAL++G +P+
Sbjct  555  LDNSVLNSPRVWEAALRNGFQPL  577



>ref|XP_010517046.1| PREDICTED: protein CER1-like 2 isoform X1 [Camelina sativa]
Length=623

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 109/203 (54%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  418  KHPKLKIRIVDGSSLAAEVVLHSIPVRTREVLFRGQVTKVARAIVFSLCQNAIKVMVL--  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y    N   W+VG  ++ KEQ  A  G  F  F  
Sbjct  476  RKEEHSMLAEFLDDSCKENLVLTTNY----NPMIWLVGDGVSTKEQKMAKEGTLFLPFSQ  531

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  + R V+ A   GG VHSLEGW  HE G
Sbjct  532  FPPDKLRKDCVYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECG  591

Query  390  AID-VHRIDVVWEAALKHGLKPV  325
              + V     VWEAAL++G +P+
Sbjct  592  LDNSVLNSPRVWEAALRNGFQPL  614



>gb|KFK27319.1| hypothetical protein AALP_AA8G367000, partial [Arabis alpina]
Length=77

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -2

Query  540  TYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVGAIDVHRIDVV  361
            TYGDLAAM+LP DVQGLG CEYTMERGVVHACHAGG VH LEGW HHEVGAIDV RID+V
Sbjct  1    TYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLV  60

Query  360  WEAALKHGLKPVTTFNS  310
            WEAA+++GL  V++  +
Sbjct  61   WEAAMRNGLSSVSSLTN  77



>dbj|BAF01865.1| CER1 protein [Arabidopsis thaliana]
Length=373

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 116/203 (57%), Gaps = 4/203 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP++KVR+V G+ L AAV+++ +P+  T V +TG  +K+   IA  LCQR V+V  L  
Sbjct  169  NHPDMKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTL--  226

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++KI+   P +C+  LV +T  +A  + K W+VG+  T +EQ  A  G  F  F  
Sbjct  227  RLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQ  285

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  286  FPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECG  345

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
             ++ +  +D VWEA L HG +P+
Sbjct  346  TSLLLSDLDQVWEACLSHGFQPL  368



>emb|CDX93353.1| BnaC04g45430D [Brassica napus]
Length=625

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 113/208 (54%), Gaps = 9/208 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V++H IP  + EV + G  +K+ RAI   LCQ  ++V++L  
Sbjct  419  KHPKLKIRIVDGSSLAAQVVIHSIPVGIKEVLVRGQITKVARAIVRSLCQNGIKVMVLRE  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C + L+  T Y        W+VG  ++ +EQ  A  G HF  F  
Sbjct  479  --EEHCMLAEFLAGHCMENLILTTNYSPM----IWLVGDGLSNEEQKMAEQGTHFLPFSQ  532

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P   Q + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  533  FPPTELRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECG  592

Query  390  AIDVHRIDV--VWEAALKHGLKPVTTFN  313
             +DV  ++    WEAAL+HG +P+  F+
Sbjct  593  -LDVPMVNSHRAWEAALRHGFQPLVYFS  619



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score =   140 bits (353),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 108/203 (53%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P LKVR+V G++L AAV+L+ +P    ++ LTG  SK+ RAIA  LC R ++V+M   
Sbjct  421  KYPELKVRIVDGSSLAAAVVLNSVPAGTKQILLTGNVSKVARAIAFTLCNRGIQVMMT--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + F  ++ + P      L     Y      + WIVG  +   EQ  AP G  F  F  
Sbjct  479  KKQEFHILKLQMPESTASYLTLSNTYSP----QVWIVGDGLDDTEQRRAPTGTRFIPFSQ  534

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P     +DCTY    AMK+P  ++ + +CE  + R V+ A    G VH+LEGWS HE G
Sbjct  535  FPPKKLNKDCTYNTTPAMKIPETLENMHSCENWLPRRVMSAWRIAGIVHALEGWSAHECG  594

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
               +  I+ +W A L HG  P+T
Sbjct  595  ETMLD-IEKIWSATLHHGFLPLT  616



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score =   140 bits (353),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 117/203 (58%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKV+V+ G++L  A++L+ IP   T+V L G  +K+   IA  LCQ+ V+V   T 
Sbjct  421  KHPNLKVKVIDGSSLATAIVLNSIPNGTTQVLLRGKLTKVAYTIAFTLCQQGVQVA--TM  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + + K++    +  +  +++ +  Q     KTW+VG+ +T +EQ  AP G  F  +  
Sbjct  479  HKDDYVKLKNSFSSFGKNFIIEKSYTQ-----KTWLVGEGLTEEEQLKAPKGTLFITYSQ  533

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P + +R+DC+Y    AM +P  +Q + +CE  + R V+ A    G VH LEGWS HE  
Sbjct  534  FPPIKYRKDCSYHFTPAMLVPSSIQNVHSCENWLPRKVMSAWRIAGIVHCLEGWSEHECN  593

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
               +H ID VW + L+HG +P++
Sbjct  594  -YTMHNIDKVWRSTLQHGFQPLS  615



>gb|KJB67450.1| hypothetical protein B456_010G191300 [Gossypium raimondii]
Length=671

 Score =   140 bits (354),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 114/203 (56%), Gaps = 6/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKV++V G++L  AV+L+ IP+  T+V L G  +K+  A+A  LCQ+ ++V +L  
Sbjct  468  KHPQLKVKLVDGSSLAVAVLLNSIPKGTTQVLLRGNLTKVAFAVAFSLCQKGIQVTVLRE  527

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K+ K      +  LV    Y +   CK W+VG  +T +EQ  A  G  F  F  
Sbjct  528  --DEYEKLDKSLGTKSEGKLVISKSYSS---CKVWLVGDDLTEEEQRKANKGTLFIPFSQ  582

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DC Y    AM+ P  ++ + +CE  + R V+      G +H+LEGW  HE G
Sbjct  583  FPLKNLRKDCFYHTTPAMQAPKALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECG  642

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
               +  ID VWEA LKHG +P+T
Sbjct  643  Y-TISNIDKVWEACLKHGFQPLT  664



>ref|XP_004253318.1| PREDICTED: protein CER1-like 2 [Solanum lycopersicum]
Length=613

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 108/204 (53%), Gaps = 8/204 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP LK+R+V G +L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  409  RHPKLKIRIVDGGSLAAEVVLHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVL--  466

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y        W+VG  ++ KEQ  A  G  F  F  
Sbjct  467  RKEEHSMLAEFLDDKCKENLVLTTNYYPM----IWLVGDGLSTKEQKMAKDGTLFLPFSQ  522

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  523  FPPKTLRKDCFYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWKEHECG  582

Query  390  AIDVHRID--VVWEAALKHGLKPV  325
              D   I+   VWEAAL++G +P+
Sbjct  583  LDDNSIINPPRVWEAALRNGFQPL  606



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 118/203 (58%), Gaps = 4/203 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP++KVRVV G+ LTAAV+++ +P+  T V +TG  +K+   IA  LCQR V+V  L  
Sbjct  411  KHPDVKVRVVDGSRLTAAVVINSVPKSTTSVVMTGNLTKVAYTIASALCQRGVQVSTLF-  469

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K++   P +C+  LV +T  +A  + K W+VG+  T ++Q  A  G  F  F  
Sbjct  470  -PDEYEKLRSSVPRECRGHLVHLTS-EAFSSSKVWLVGEGTTREDQEKATNGTLFIPFSQ  527

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DC Y    A+ +P  +  + +CE  + R  + A    G +H++EGW  HE G
Sbjct  528  FPLKQLRKDCIYHTTPALIVPKSLVNIHSCENWLPRKAMSATRVAGILHAVEGWEMHECG  587

Query  390  A-IDVHRIDVVWEAALKHGLKPV  325
            A + +  +D VWEA L HG +P+
Sbjct  588  ASVLLSDLDQVWEACLSHGFQPL  610



>gb|AAC23640.1| CER1-like protein [Arabidopsis thaliana]
Length=635

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 108/204 (53%), Gaps = 8/204 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP LK+R+V G +L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  431  RHPKLKIRIVDGGSLAAEVVLHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVL--  488

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y        W+VG  ++ KEQ  A  G  F  F  
Sbjct  489  RKEEHSMLAEFLDDKCKENLVLTTNYYPM----IWLVGDGLSTKEQKMAKDGTLFLPFSQ  544

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  545  FPPKTLRKDCFYHTTPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWKEHECG  604

Query  390  AIDVHRID--VVWEAALKHGLKPV  325
              D   I+   VWEAAL++G +P+
Sbjct  605  LDDNSIINPPRVWEAALRNGFQPL  628



>ref|NP_850932.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 dbj|BAE98972.1| CER1 protein [Arabidopsis thaliana]
 gb|AEE27400.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=461

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 116/203 (57%), Gaps = 4/203 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP++KVR+V G+ L AAV+++ +P+  T V +TG  +K+   IA  LCQR V+V  L  
Sbjct  257  NHPDMKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTL--  314

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++KI+   P +C+  LV +T  +A  + K W+VG+  T +EQ  A  G  F  F  
Sbjct  315  RLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQ  373

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  374  FPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECG  433

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
             ++ +  +D VWEA L HG +P+
Sbjct  434  TSLLLSDLDQVWEACLSHGFQPL  456



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 114/202 (56%), Gaps = 3/202 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVV G+ L AAV+++ +P+  T V +TG  +K+  +IA  LCQR V+V  L  
Sbjct  444  KHPELKVRVVDGSRLAAAVVINSVPKTTTNVVMTGNLTKVAYSIASALCQRGVQVSTL--  501

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K++   P +C+  LV +T   +  + K W+VG+  T +EQ  A  G  F  F  
Sbjct  502  RLDEYEKLRSCVPQECRDHLVYLTT-DSLSSKKVWLVGEGTTREEQEKATKGTLFIPFSQ  560

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  561  FPLKQLRRDCIYHTTPALIVPKSLVNIHSCENWLPRKAMSATRVAGILHALEGWDMHECG  620

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
               +  +D VW+A L HG +P+
Sbjct  621  TSLLSDLDQVWDACLSHGFQPL  642



>ref|XP_006295717.1| hypothetical protein CARUB_v10024836mg [Capsella rubella]
 gb|EOA28615.1| hypothetical protein CARUB_v10024836mg [Capsella rubella]
Length=612

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 108/206 (52%), Gaps = 22/206 (11%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+++V GN+L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  418  KHPKLKIKIVDGNSLAAKVVLHSIPVGTKEVLFRGQITKVARAIVFSLCQNAIKVMVL--  475

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ L+             W+VG  ++ KEQ  A  G  F  F  
Sbjct  476  RKEEHSMLAEFLDDSCKENLI-------------WLVGDGLSTKEQKMAKEGTLFLPFSQ  522

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH  Q + +CE  +ER V+ A   GG VHSLEGW  HE G
Sbjct  523  FPPTNLRKDCVYHTTPAMIIPHSAQNIDSCENWLERRVMSAWRVGGIVHSLEGWEEHECG  582

Query  390  ----AIDVHRIDVVWEAALKHGLKPV  325
                 ++ HR   VWEAAL +G +P+
Sbjct  583  LDNSILNSHR---VWEAALLNGFQPL  605



>emb|CDY07774.1| BnaA03g17370D [Brassica napus]
Length=527

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 110/203 (54%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P LK+R+V G++L AAV++H IP D  EV   G  +K+GRAI + LCQ  ++V++L  
Sbjct  323  KYPKLKIRIVDGSSLAAAVVVHSIPVDTREVLFRGRITKIGRAIVISLCQNGIKVMVLRE  382

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    +       C++ LV  T Y        W+VG  ++ ++Q  A  G  F  F  
Sbjct  383  --EEHSMLNGFIGGHCKENLVLTTNYSPM----IWLVGDGLSKEDQKKARKGTLFIPFSQ  436

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P   Q + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  437  FPPSKLRKDCFYHTTPAMIIPDAAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECG  496

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
              + +     VWEAAL+HG KP+
Sbjct  497  LEVPMANPPRVWEAALRHGFKPL  519



>gb|KJB67446.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=528

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 112/202 (55%), Gaps = 6/202 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKV++V G++L  AV+L+ IP+  T+V L G  +K+  A+A  LCQ+ ++V +L  
Sbjct  325  KHPQLKVKLVDGSSLAVAVLLNSIPKGTTQVLLRGNLTKVAFAVAFALCQKGIQVTVLRE  384

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K+ K      +  LV    Y +   CK W+VG  +T +EQ  A  G  F  F  
Sbjct  385  --DEYEKLDKSLGTKSEGKLVTSKSYSS---CKVWLVGDDLTEEEQRKANKGTLFIPFSQ  439

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM+ P  ++ + +CE  + R V+      G +H+LEGW  HE G
Sbjct  440  LPPKKLRKDCFYHTTPAMQTPTALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECG  499

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
               +  ID VWEA LKHG +P+
Sbjct  500  -YTMSNIDKVWEACLKHGFQPL  520



>ref|XP_010535407.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Tarenaya hassleriana]
Length=584

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 117/202 (58%), Gaps = 3/202 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVV G++L AAV+++ IP+  T+V + G+ +K+  AIA  LC+R ++V  L  
Sbjct  377  KHPELRVRVVDGSSLAAAVVINSIPKGTTDVVMRGSLTKVAYAIASALCRRGIQVTALRR  436

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            +   ++++    PA+C+  L+  T  +   + K W+VG+ +  ++Q  A  G  F  F  
Sbjct  437  N--EYERLTLCVPAECKGRLLYSTS-KTLPSHKIWLVGEGMDERDQERATEGTVFIPFSP  493

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    A+ +P  ++   +CE  + R  + A  A G +H+LEGW  HE G
Sbjct  494  FPPKELRKDCIYHTTPALTVPKSLENFHSCENWLPRKAISATRAAGILHALEGWETHEHG  553

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            +  +H +D +W+A L HG +P+
Sbjct  554  STLLHDLDFIWDACLGHGFRPL  575



>ref|XP_009133199.1| PREDICTED: protein CER1-like 2 [Brassica rapa]
Length=622

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 110/203 (54%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P LK+R+V G++L AAV++H IP D  EV   G  +K+GRAI + LCQ  ++V++L  
Sbjct  418  KYPKLKIRIVDGSSLAAAVVVHSIPVDTREVLFRGRITKIGRAIVISLCQNGIKVMVLRE  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    +       C++ LV  T Y        W+VG  ++ ++Q  A  G  F  F  
Sbjct  478  --EEHSMLNGFIGGHCKENLVLTTNYSPM----IWLVGDGLSKEDQKKARKGTLFIPFSQ  531

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P   Q + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  532  FPPSKLRKDCFYHTTPAMIIPDAAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECG  591

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
              + +     VWEAAL+HG KP+
Sbjct  592  LEVPMANPPRVWEAALRHGFKPL  614



>ref|XP_010535406.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Tarenaya hassleriana]
Length=628

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 117/202 (58%), Gaps = 3/202 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP L+VRVV G++L AAV+++ IP+  T+V + G+ +K+  AIA  LC+R ++V  L  
Sbjct  421  KHPELRVRVVDGSSLAAAVVINSIPKGTTDVVMRGSLTKVAYAIASALCRRGIQVTALRR  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            +   ++++    PA+C+  L+  T  +   + K W+VG+ +  ++Q  A  G  F  F  
Sbjct  481  N--EYERLTLCVPAECKGRLLYSTS-KTLPSHKIWLVGEGMDERDQERATEGTVFIPFSP  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    A+ +P  ++   +CE  + R  + A  A G +H+LEGW  HE G
Sbjct  538  FPPKELRKDCIYHTTPALTVPKSLENFHSCENWLPRKAISATRAAGILHALEGWETHEHG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            +  +H +D +W+A L HG +P+
Sbjct  598  STLLHDLDFIWDACLGHGFRPL  619



>ref|XP_004253517.1| PREDICTED: protein CER1-like 1, partial [Solanum lycopersicum]
Length=215

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 117/207 (57%), Gaps = 6/207 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP LKV+VV G++L  AV+L+ IP+  ++V L G  SK+  +IAL LC+  ++V+ L  
Sbjct  14   RHPQLKVKVVDGSSLAVAVVLNSIPKGTSQVVLRGRFSKVANSIALVLCEGGIQVVTLDE  73

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E +++++ +   +    LV    Y  +K   TW+VG  ++  EQ  AP G  F  +  
Sbjct  74   --EDYKRLKAKLTPEAATNLVLSKSYNVSK---TWLVGDGLSKDEQLKAPKGTLFIPYSQ  128

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y +  AM  P  V+ + +CE  + R V+ A    G +H+LEGW+ HE G
Sbjct  129  FPPRKVRKDCFYFNTPAMIAPKHVENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECG  188

Query  390  AIDVHRIDVVWEAALKHGLKPVTTFNS  310
             + +     VW+A+LKHG  P+T  ++
Sbjct  189  DM-ILDTQKVWKASLKHGFCPLTKISA  214



>gb|KJB67445.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=624

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 112/202 (55%), Gaps = 6/202 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKV++V G++L  AV+L+ IP+  T+V L G  +K+  A+A  LCQ+ ++V +L  
Sbjct  421  KHPQLKVKLVDGSSLAVAVLLNSIPKGTTQVLLRGNLTKVAFAVAFALCQKGIQVTVLRE  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K+ K      +  LV    Y +   CK W+VG  +T +EQ  A  G  F  F  
Sbjct  481  --DEYEKLDKSLGTKSEGKLVTSKSYSS---CKVWLVGDDLTEEEQRKANKGTLFIPFSQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM+ P  ++ + +CE  + R V+      G +H+LEGW  HE G
Sbjct  536  LPPKKLRKDCFYHTTPAMQTPTALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECG  595

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
               +  ID VWEA LKHG +P+
Sbjct  596  -YTMSNIDKVWEACLKHGFQPL  616



>ref|XP_007041185.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
 gb|EOX97016.1| Fatty acid hydroxylase superfamily isoform 1 [Theobroma cacao]
Length=612

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 118/205 (58%), Gaps = 12/205 (6%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP L++R+V G++L AAV+++ IP++ T+V LTG  SK+G AIAL LCQ+ V+V  +  
Sbjct  415  RHPQLRIRLVDGSSLAAAVVVNSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAAM--  472

Query  750  STERFQKIQKEAPADCQ--KLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQF  577
            + + +QK+Q    +DCQ  K LV    Y    + K W+VG+ +T KEQ  A  G  F  F
Sbjct  473  NEDEYQKLQH---SDCQFGKNLVLAENY----DQKIWLVGEGLTDKEQLKATKGTVFVPF  525

Query  576  VVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHE  397
               P     +DC Y    AM  P  +  + +CE  + R V+ A    G VH LEGW+ HE
Sbjct  526  TQFPPKKLLKDCYYHTTPAMVAPKSLDNIHSCENWLARRVMSAWRVAGIVHGLEGWNVHE  585

Query  396  VGAIDVHRIDVVWEAALKHGLKPVT  322
             G   +  +D VWEA L HG  P++
Sbjct  586  CGQ-TMFSMDKVWEATLLHGFCPLS  609



>gb|KDO42773.1| hypothetical protein CISIN_1g041887mg [Citrus sinensis]
Length=223

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 112/204 (55%), Gaps = 7/204 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P LK++VV G++L  AV+ + IP+  T+V + G  +K+  A A  LCQ+ ++V+ L  
Sbjct  21   KNPELKIKVVDGSSLAVAVLTNSIPDGTTQVVIRGILTKVAYATAFALCQKGIQVVTLRE  80

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFV-  574
                         ++ + LLV  +  Q     K W+VG  +T +EQ+ A  G  F  F  
Sbjct  81   DEHEKLIRSFGGKSESKNLLVSRSYCQ-----KIWLVGNGLTEEEQSKAERGTMFVPFSQ  135

Query  573  VPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
             PP    R+DCTY    AM  P  ++ + +CE  + R V+ A   GG VH+LEGW+ HE 
Sbjct  136  FPPAKKRRKDCTYHLTPAMATPAALENVDSCENWLPRRVMSAWRIGGIVHALEGWNEHEC  195

Query  393  GAIDVHRIDVVWEAALKHGLKPVT  322
            G   +  +D VW+AAL+HG  P+T
Sbjct  196  G-YTISNVDTVWDAALRHGFVPLT  218



>ref|XP_007041186.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
 gb|EOX97017.1| Fatty acid hydroxylase superfamily isoform 2 [Theobroma cacao]
Length=620

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 118/205 (58%), Gaps = 12/205 (6%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP L++R+V G++L AAV+++ IP++ T+V LTG  SK+G AIAL LCQ+ V+V  +  
Sbjct  423  RHPQLRIRLVDGSSLAAAVVVNSIPQETTQVLLTGRISKVGYAIALALCQKGVQVAAM--  480

Query  750  STERFQKIQKEAPADCQ--KLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQF  577
            + + +QK+Q    +DCQ  K LV    Y    + K W+VG+ +T KEQ  A  G  F  F
Sbjct  481  NEDEYQKLQH---SDCQFGKNLVLAENY----DQKIWLVGEGLTDKEQLKATKGTVFVPF  533

Query  576  VVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHE  397
               P     +DC Y    AM  P  +  + +CE  + R V+ A    G VH LEGW+ HE
Sbjct  534  TQFPPKKLLKDCYYHTTPAMVAPKSLDNIHSCENWLARRVMSAWRVAGIVHGLEGWNVHE  593

Query  396  VGAIDVHRIDVVWEAALKHGLKPVT  322
             G   +  +D VWEA L HG  P++
Sbjct  594  CGQ-TMFSMDKVWEATLLHGFCPLS  617



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 116/203 (57%), Gaps = 4/203 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP++KVR+V G+ L AAV+++ +P+  T V +TG  +K+   IA  LCQR V+V  L  
Sbjct  421  NHPDMKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTL--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++KI+   P +C+  LV +T  +A  + K W+VG+  T +EQ  A  G  F  F  
Sbjct  479  RLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQ  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  538  FPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECG  597

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
             ++ +  +D VWEA L HG +P+
Sbjct  598  TSLLLSDLDQVWEACLSHGFQPL  620



>ref|XP_007219469.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
 gb|EMJ20668.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
Length=218

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 111/202 (55%), Gaps = 8/202 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            ++P LK++VV G++L  AVIL+ IP+  TEV L G  +K+  A A  LCQ+ ++V  L  
Sbjct  16   RYPELKMKVVDGSSLAVAVILNSIPKGTTEVLLRGNLTKVAYATAFALCQKGIQVATLNQ  75

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
            +   + K+ K       +L++  +  Q     K W+VG  ++ +EQ  AP G  F  F  
Sbjct  76   T--EYLKLTKSLNVTDSRLVLARSYAQ-----KIWLVGDGLSEEEQLRAPKGTLFVPFSQ  128

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AMK P  ++ +  CE  + R V+ A    G VH+LEGW  HE G
Sbjct  129  FPQKKLRKDCFYHYTPAMKTPPSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECG  188

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
              ++  ID VW+A L+HG +P+
Sbjct  189  -YNMSNIDKVWQATLQHGFQPL  209



>gb|KHG03871.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=599

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 111/202 (55%), Gaps = 6/202 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKV++V G++L  AV+L+ IP+  T+V L G  +K+  A+A  LCQ+ ++V +L  
Sbjct  396  KHPQLKVKLVDGSSLAVAVLLNSIPKGTTQVLLRGHLTKVAFAVAFALCQKGIQVTILRE  455

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K+ K      +  LV    Y +   CK W VG  +T +EQ  A  G  F  F  
Sbjct  456  --DEYEKLDKSLGTKSEGKLVTSKSYSS---CKVWFVGDDLTEEEQRKANKGTLFIPFSQ  510

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM+ P  ++ + +CE  + R V+      G +H+LEGW  HE G
Sbjct  511  LPPKKLRKDCFYHTTPAMQTPTALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECG  570

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
               +  ID VWEA LKHG +P+
Sbjct  571  -YTMSNIDKVWEACLKHGFQPL  591



>ref|XP_006445500.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 ref|XP_006464360.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR58740.1| hypothetical protein CICLE_v10019279mg [Citrus clementina]
 gb|KDO85379.1| hypothetical protein CISIN_1g006722mg [Citrus sinensis]
Length=633

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 120/207 (58%), Gaps = 12/207 (6%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK++VV G++L  AV+++ IP+  T+V L GA +K+  AIA  LCQ+ ++V+ L  
Sbjct  425  KHPQLKMKVVDGSSLAVAVVINSIPKGTTQVVLRGALTKVAYAIAFALCQKGIQVVTLRE  484

Query  750  STERFQKIQKE--APADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQF  577
              +  +K++K   A ++C  LL+  +  Q     K W+VGK +T +EQ+ A  G  F  F
Sbjct  485  --DEHEKLRKSFGAKSECNNLLLSRSYSQ-----KIWLVGKGLTEEEQSKAKKGTIFIPF  537

Query  576  --VVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
                P     R+DC Y    AM +P   + + +CE  + R V+ A   GG VH+LEGW+ 
Sbjct  538  SQFPPNDKKIRKDCMYHLTPAMAVPAAFENVDSCENWLPRRVMSAWRIGGIVHALEGWNE  597

Query  402  HEVGAIDVHRIDVVWEAALKHGLKPVT  322
            HE G   +  I  VWEAAL+HG  P+T
Sbjct  598  HECG-YAISNIHNVWEAALRHGFHPLT  623



>gb|EEC73617.1| hypothetical protein OsI_08114 [Oryza sativa Indica Group]
Length=619

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 113/203 (56%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P L VR+V G+ L  AV+L  IP D  +VFL   TSK+ RAIA+ LC R V+V+M  +
Sbjct  423  KYPKLGVRIVDGSGLATAVVLKSIPSDAKKVFLRTGTSKIARAIAIALCDRGVQVIM--N  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E +  ++ + P +    L    K  +    + WIV   I   EQ  AP G  F     
Sbjct  481  EKEVYHMLKSQIPENRASYL----KLSSDNVPQLWIVHN-IDDNEQKMAPKGTIFIPISQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DCTY    AM++P +++ + +CE  + R V+ A H  G +H+LEGW+ HE G
Sbjct  536  FPLKKLRKDCTYMSTPAMRIPEEMKNIHSCENWLPRRVMSAWHIAGILHALEGWNMHECG  595

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
              ++  I+  W AA++HG  P+T
Sbjct  596  D-EMMDIEKSWSAAIRHGFLPLT  617



>ref|NP_001047459.1| Os02g0621300 [Oryza sativa Japonica Group]
 dbj|BAD21539.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAD21579.1| putative CER1 protein [Oryza sativa Japonica Group]
 dbj|BAF09373.1| Os02g0621300 [Oryza sativa Japonica Group]
Length=619

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 113/203 (56%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P L VR++ G+ L  AV+L  IP D  +VFL   TSK+ RAIA+ LC R V+V+M  +
Sbjct  423  KYPKLGVRIIDGSGLATAVVLKSIPSDAKKVFLRTGTSKIARAIAIALCDRGVQVIM--N  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E +  ++ + P +    L    K  +    + WIV   I   EQ  AP G  F     
Sbjct  481  EKEVYHMLKSQIPENRASYL----KLSSDNVPQLWIVHN-IDDNEQKMAPKGTIFIPISQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DCTY    AM++P +++ + +CE  + R V+ A H  G +H+LEGW+ HE G
Sbjct  536  FPLKKLRKDCTYMSTPAMRIPEEMKNIHSCENWLPRRVMSAWHIAGILHALEGWNMHECG  595

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
              ++  I+  W AA++HG  P+T
Sbjct  596  D-EMMDIEKSWSAAIRHGFLPLT  617



>ref|XP_002881545.1| hypothetical protein ARALYDRAFT_321478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57804.1| hypothetical protein ARALYDRAFT_321478 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V+LH IP    EV   G  +K+ RAI   LCQ  ++V++L  
Sbjct  419  KHPKLKIRIVDGSSLAAEVVLHSIPVGTNEVLFRGQITKVARAIVFSLCQNAIKVMVL--  476

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E      +    +C++ LV  T Y        W+VG  ++ KEQ  A     F  F  
Sbjct  477  RKEEHSMFAEFLDDNCKENLVLTTNYYPM----IWLVGDGLSKKEQKMAKERTLFLPFSQ  532

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +PH    + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  533  FPPTKLRKDCFYHTTPAMIIPHAAHNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECG  592

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
               +     VW+AAL++G +P+
Sbjct  593  FESIINPPRVWDAALRNGFQPL  614



>gb|EEE57393.1| hypothetical protein OsJ_07566 [Oryza sativa Japonica Group]
Length=619

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 113/203 (56%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P L VR++ G+ L  AV+L  IP D  +VFL   TSK+ RAIA+ LC R V+V+M  +
Sbjct  423  KYPKLGVRIIDGSGLATAVVLKSIPSDAKKVFLRTGTSKIARAIAIALCDRGVQVIM--N  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E +  ++ + P +    L    K  +    + WIV   I   EQ  AP G  F     
Sbjct  481  EKEVYHMLKSQIPENRASYL----KLSSDNVPQLWIVHN-IDDNEQKMAPKGTIFIPISQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DCTY    AM++P +++ + +CE  + R V+ A H  G +H+LEGW+ HE G
Sbjct  536  FPLKKLRKDCTYMSTPAMRIPEEMKNIHSCENWLPRRVMSAWHIAGILHALEGWNMHECG  595

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
              ++  I+  W AA++HG  P+T
Sbjct  596  D-EMMDIEKSWSAAIRHGFLPLT  617



>ref|XP_009625188.1| PREDICTED: protein ECERIFERUM 1-like [Nicotiana tomentosiformis]
Length=626

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 120/203 (59%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP LKV+VV G++L  AV+L++IP+  ++V L G  SK+  +IAL LCQR ++V+ML  
Sbjct  422  RHPQLKVKVVDGSSLVVAVVLNNIPKGTSQVVLRGRLSKVSCSIALVLCQRGIQVVML--  479

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E F++++          LV ++K  A+K    W+VG  ++  EQ  AP G  F  F  
Sbjct  480  DGEEFKRLKARLTPKVATNLV-LSKTNASK---IWLVGDRLSEDEQLKAPKGTLFIPFSQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P  ++ + +CE  + R V+ A    G +H+LEGW+ +E G
Sbjct  536  FPPRKARKDCIYFSTPAMTIPKQLENVDSCENWLPRRVMSASRIAGILHTLEGWNENECG  595

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
             + +  I+ VW+A+L HG +P+T
Sbjct  596  NM-MFDIERVWKASLDHGFRPLT  617



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score =   135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 115/207 (56%), Gaps = 7/207 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP++KVR+V G+ L AAV+++ +P+  T V +TG  +K+   IA  LCQR V+V  L  
Sbjct  421  NHPDMKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTL--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKN----CKTWIVGKWITPKEQNFAPPGAHFH  583
              + ++KI+   P +C+  LV +T    + N     K W+VG+  T +EQ  A  G  F 
Sbjct  479  RLDEYEKIRSCVPQECRDHLVYLTSEALSSNKGFWVKVWLVGEGTTREEQEKATKGTLFI  538

Query  582  QFVVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSH  403
             F   P+   RRDC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  
Sbjct  539  PFSQFPLKQLRRDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEM  598

Query  402  HEVG-AIDVHRIDVVWEAALKHGLKPV  325
            HE G ++ +  +D VWEA L HG +P+
Sbjct  599  HECGTSLLLSDLDQVWEACLSHGFQPL  625



>ref|XP_010520222.1| PREDICTED: protein ECERIFERUM 1-like [Tarenaya hassleriana]
Length=631

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 116/202 (57%), Gaps = 3/202 (1%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP +++RVV G++L AAV+++ +P+   +V + G+ +K+  AIA  LCQ+ ++V  L  
Sbjct  421  KHPKVRMRVVDGSSLAAAVVINSVPKGTVDVVMRGSLTKVAYAIASALCQKGIKVTTL--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + + K+    P + +  L+  T  +   + K W+VG+ I  KEQ  A  G+ F  F  
Sbjct  479  RKDEYDKLMGCIPHEWRDRLLYSTS-KTLPSHKIWLVGEGIDEKEQGKATQGSIFIPFSQ  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    A+ +P  ++ + +CE  + R  + A  A G VH+LEGW  HE G
Sbjct  538  FPPKELRKDCLYHTTPALTVPKSLENIHSCENWLPRKAISAARAAGIVHALEGWERHECG  597

Query  390  AIDVHRIDVVWEAALKHGLKPV  325
            +  +H +D +W+A+L HG +P+
Sbjct  598  SSLLHDLDAIWDASLSHGFRPL  619



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 115/203 (57%), Gaps = 4/203 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             HP++KVR+V G+ L AAV+++ +P+  T V +TG  +K+   IA  LCQR V+V  L  
Sbjct  421  NHPDMKVRLVDGSRLAAAVVINSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVSTL--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++KI+   P +C+  LV +T  +A  + K W+VG+  T +EQ  A  G  F  F  
Sbjct  479  RLDEYEKIRSCVPQECRDHLVYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQ  537

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R DC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  538  FPLKQLRSDCIYHTTPALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWETHECG  597

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
             ++ +  +D VWEA L HG +P+
Sbjct  598  TSLLLSDLDKVWEACLSHGFQPL  620



>ref|XP_004133955.1| PREDICTED: protein ECERIFERUM 1 [Cucumis sativus]
 gb|KGN56665.1| hypothetical protein Csa_3G127760 [Cucumis sativus]
Length=624

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            ++P L+VRVV G++L  AV+L+ IP+  T+V L G  +K+  A++  LCQR ++V +L  
Sbjct  421  RNPKLRVRVVDGSSLAVAVVLNSIPKSATQVLLRGKLTKVAYALSYSLCQRGIQVAVL--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E ++K+ K      +   V    Y        W+VG  +T +EQ  AP G  F  F  
Sbjct  479  HEEEYRKLNKSFNTKFESNPVLSKGYSQ----NIWLVGDGLTNEEQMKAPKGTTFIPFSQ  534

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AMK P  ++ + +CE  + R V+ A    G VH++EGW+ HE G
Sbjct  535  LPPKIVRKDCFYHCTPAMKAPRSIENVHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECG  594

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
               +  ID VW+A L+HG +PVTT
Sbjct  595  -YTMSNIDQVWKATLRHGFQPVTT  617



>gb|EMT07276.1| Protein WAX2 [Aegilops tauschii]
Length=604

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 110/203 (54%), Gaps = 9/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K+P L VR+V G+ L  AV+L  IP D   VFL G +SK+ RAIA  LC+R V+V+M   
Sbjct  409  KYPKLGVRLVDGSGLATAVVLKSIPSDTKHVFLCGGSSKVERAIATALCERGVQVIMNQK  468

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              +  +    E+        +   K+ + +  + WI G  I  K+Q  AP GA F     
Sbjct  469  EYDMLKLRVSESS-------IAYLKFSSDETPQIWI-GDIIDDKQQMGAPKGATFIPTSQ  520

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DCTY    AMK+P  +Q +  CE  + R V+ A    G VH+LEGW  HE G
Sbjct  521  FPLKRMRKDCTYLSSPAMKIPEAMQNVHTCENWLPRRVMSAWRIAGMVHALEGWDMHECG  580

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
              D+  I+ VW AA+KHG  P++
Sbjct  581  D-DMMDIEKVWSAAIKHGFTPLS  602



>ref|XP_007041184.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOX97015.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=1331

 Score =   136 bits (343),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 79/200 (40%), Positives = 114/200 (57%), Gaps = 12/200 (6%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP L++++V G++LTAAV+++ IP++ T+V LTG  SK+G AIAL LCQ+ V+V  +  
Sbjct  397  RHPQLRIKLVDGSSLTAAVVVNSIPKETTQVLLTGRISKVGYAIALALCQKGVQVAAMNE  456

Query  750  STERFQKIQKEAPADCQ--KLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQF  577
              + +QK+Q      CQ  K LV    Y      K W+VG+ +T KEQ  A  G+ F  F
Sbjct  457  --DEYQKLQHSG---CQFGKNLVLAENYDQ----KIWLVGEGLTDKEQLRATKGSVFIPF  507

Query  576  VVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHE  397
               P     +DC Y    A+  P  +  + +CE  + R V+ A    G VH LEGW+ HE
Sbjct  508  TQFPPKKLLKDCYYHTTPALVAPKSLDNIHSCENWLARRVMSAWRVAGIVHGLEGWNVHE  567

Query  396  VGAIDVHRIDVVWEAALKHG  337
             G   +  +D VWEA L+HG
Sbjct  568  CGQT-MFSMDKVWEATLRHG  586


 Score =   135 bits (340),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 79/205 (39%), Positives = 114/205 (56%), Gaps = 12/205 (6%)
 Frame = -2

Query  930   KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
             + P L++++V G++L AAV+++ IP++ T+V LTG  SK+G AIAL LCQ+ V+V  +  
Sbjct  1134  RQPQLRIKLVDGSSLAAAVVVNSIPKETTQVLLTGRISKVGYAIALALCQKGVQVAAMNE  1193

Query  750   STERFQKIQKEAPADCQ--KLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQF  577
               + +QK+Q    +DCQ  K LV    Y      K W+VG+ +T KEQ  A  G     F
Sbjct  1194  --DEYQKLQD---SDCQFGKNLVLAENYDQ----KIWLVGEGLTDKEQLKATKGTVLIPF  1244

Query  576   VVPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHE  397
                P     +DC Y    AM  P  +  + +CE  + R V+ A    G VH LEGW+ HE
Sbjct  1245  TQFPPKKLLKDCYYHTTPAMVAPKSLDNIHSCENWLARRVISAWRVAGIVHGLEGWNVHE  1304

Query  396   VGAIDVHRIDVVWEAALKHGLKPVT  322
              G   +  +D VWEA L HG  P++
Sbjct  1305  CGQT-MFSMDKVWEATLHHGFCPLS  1328



>gb|ACA14353.1| TCER1 [Triticum aestivum]
Length=619

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 110/203 (54%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            K P L VR+V G+ L   V+L  IP D  +VFL   TSK+ RAIA+ LC R ++V+M  +
Sbjct  423  KCPKLGVRIVDGSGLATGVVLKSIPSDAKQVFLHTGTSKVARAIAMALCGRGIQVIM--N  480

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + +  ++ + P D    L    K  +    K W+V K I  KEQ  AP G  F     
Sbjct  481  RKKEYDVLKSQMPEDGASYL----KCSSNDITKIWLVEK-IDDKEQRMAPRGTVFIPISQ  535

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DCTY    AMK+P  +Q + +CE  + R V+ A H  G +H LEGWS HE G
Sbjct  536  FPLKKVRKDCTYLSTPAMKIPDTMQNIHSCENWLPRRVMSAWHIAGILHVLEGWSVHECG  595

Query  390  AIDVHRIDVVWEAALKHGLKPVT  322
              D+   +  W AA++HG  P+T
Sbjct  596  D-DMMDPEKAWSAAIRHGFVPLT  617



>gb|EMT05456.1| Protein WAX2 [Aegilops tauschii]
Length=575

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP+L+VRVVHGNTLTAAVIL++IP  V EVFLTGATSKLGRAIALYLC++R+RVLMLT 
Sbjct  412  RHPDLRVRVVHGNTLTAAVILNEIPGSVKEVFLTGATSKLGRAIALYLCRKRIRVLMLTL  471

Query  750  STERFQKIQKEAPADCQKLLVQVTK  676
            S+ERF KIQ+EAPA+ Q+ LVQVT 
Sbjct  472  SSERFLKIQREAPAEFQQYLVQVTN  496



>ref|XP_006410962.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
 gb|ESQ52415.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
Length=628

 Score =   134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 107/203 (53%), Gaps = 7/203 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V++H +P    EV   G  +K+ RAI   LCQ  ++VL+L  
Sbjct  418  KHPKLKIRIVDGSSLAAEVVVHSVPVGTREVLFRGQITKVARAIVSSLCQNGIKVLVLRE  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
               R   + +    DC++ LV    Y        W+VG  ++ +EQ  A  G  F  F  
Sbjct  478  EEHRM--LAELLGGDCKENLVLTRNYSPT----IWLVGDGLSKEEQKMAGKGTRFLPFSQ  531

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P   Q + +CE  + R V+ A   GG VH+LEGW  HE G
Sbjct  532  FPPTKLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECG  591

Query  390  AID-VHRIDVVWEAALKHGLKPV  325
              + +     VWEAAL++G KP+
Sbjct  592  LHNSILNPPKVWEAALRNGFKPL  614



>ref|XP_010496698.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=386

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 112/203 (55%), Gaps = 4/203 (2%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LKVRVV G+ L+AAV+++ + +    V +TG  +K+   IA  LCQR V+V  L  
Sbjct  182  KHPELKVRVVDGSRLSAAVVINSVSKATKNVVMTGHLTKVAYTIASALCQRGVQVSTL--  239

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              + ++K++   P +C+  LV  T    + N K W+VG+  T +EQ  A  G  F  F  
Sbjct  240  RLDEYEKLRSCIPQECRDYLVYQTSEVLSSN-KVWLVGEGTTSEEQEKATKGTLFIPFSQ  298

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P+   R+DC Y    A+ +P  +  + +CE  + R  + A    G +H+LEGW  HE G
Sbjct  299  FPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHECG  358

Query  390  -AIDVHRIDVVWEAALKHGLKPV  325
             ++    +D VWEA L HG +P+
Sbjct  359  TSLLPSDLDQVWEACLSHGFQPL  381



>ref|XP_009141689.1| PREDICTED: protein CER1-like 2 isoform X2 [Brassica rapa]
Length=625

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 108/204 (53%), Gaps = 9/204 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V++H IP    EV   G  +K+ RAI   LC   ++V++L  
Sbjct  418  KHPKLKIRIVDGSSLAAQVVVHSIPVGTREVLFRGQITKVARAIVTSLCLNGIKVMVLRE  477

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y        W+VG  I+ +EQ  A  G  F  F  
Sbjct  478  --EEHCMLARFLSGHCKENLVLTTNYSPM----IWLVGDGISKEEQKMAAKGTRFLPFSQ  531

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P   Q + +CE  + R ++ A   GG VH+LEGW  HE G
Sbjct  532  FPPTQLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRMMSAWRVGGIVHALEGWEEHECG  591

Query  390  AIDVHRIDV--VWEAALKHGLKPV  325
             +DV  +    VWEAAL+HG +P+
Sbjct  592  -LDVPMVSPHGVWEAALRHGFQPL  614



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 111/202 (55%), Gaps = 8/202 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLK+R+V G++L   V+L+ IP++  ++ L G  SK   AI+  LC+R V+V M+  
Sbjct  421  KHPNLKIRIVDGSSLVVGVVLNSIPKETKQLLLRGNVSKTAIAISKALCRRGVQVAMV--  478

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWIT-PKEQNFAPPGAHFHQFV  574
                F K++ + P +  + LV  T Y    N K W+V   ++  +EQ  AP G HF  F 
Sbjct  479  DKVDFDKLKLQLPTELWRNLVLSTSY----NYKVWLVEDRVSREEEQKQAPEGTHFIPFS  534

Query  573  VPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
              P+   R DC Y    A+ +P  ++ + +CE  + R V+ A    G VH+LEGW  HE 
Sbjct  535  QFPLKRIRNDCVYYTTPALLIPKALENVHSCENWLPRRVMSAWRVAGIVHALEGWEEHEC  594

Query  393  GAIDVHRIDVVWEAALKHGLKP  328
            G   V  +D VW A L+HG  P
Sbjct  595  GD-TVLDVDKVWNATLRHGFLP  615



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 110/203 (54%), Gaps = 8/203 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHPNLKVR+V G+ L   V+L+ IP+   +V L G T+K   AI+  LCQR ++V M+  
Sbjct  515  KHPNLKVRIVDGSGLAVGVVLNSIPQGTKQVLLRGRTTKTAIAISRVLCQRGIQVAMI--  572

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKW-ITPKEQNFAPPGAHFHQFV  574
               +F +++   P +    L   T Y    N K W+VG+  +  +EQ   P G HF  F 
Sbjct  573  DKNQFDRLKLRLPTELWSNLFLSTNY----NYKVWLVGEGALKDEEQRQLPEGTHFIPFS  628

Query  573  VPPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEV  394
              P    R DC Y    A+++P  ++ + +CE  + R V+ A    G VH+LEGW  HE 
Sbjct  629  QFPPKRVRSDCIYYTTPALRIPKALENVHSCENWLPRRVMSAWRVAGIVHALEGWDEHEC  688

Query  393  GAIDVHRIDVVWEAALKHGLKPV  325
            G   V  +D VW A+L+HG  PV
Sbjct  689  GDT-VLDVDKVWTASLRHGFLPV  710



>emb|CDY55894.1| BnaA04g29150D [Brassica napus]
Length=616

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 108/204 (53%), Gaps = 9/204 (4%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            KHP LK+R+V G++L A V++H IP    EV   G  +K+ RAI   LC   ++V++L  
Sbjct  409  KHPKLKIRIVDGSSLAAQVVVHSIPVGTREVLFRGQITKVARAIVTSLCLNGIKVMVLRE  468

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E    + +     C++ LV  T Y        W+VG  I+ +EQ  A  G  F  F  
Sbjct  469  --EEHCMLARFLSGHCKENLVLTTNYSPM----IWLVGDGISKEEQKMAAKGTRFLPFSQ  522

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM +P   Q + +CE  + R ++ A   GG VH+LEGW  HE G
Sbjct  523  FPPTQLRKDCFYHTTPAMIIPDSAQNIDSCENWLGRRMMSAWRVGGIVHALEGWEEHECG  582

Query  390  AIDVHRIDV--VWEAALKHGLKPV  325
             +DV  +    VWEAAL+HG +P+
Sbjct  583  -LDVPMVSPHGVWEAALRHGFQPL  605



>ref|XP_009787252.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Nicotiana sylvestris]
Length=590

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 113/204 (55%), Gaps = 7/204 (3%)
 Frame = -2

Query  930  KHPNLKVRVVHGNTLTAAVILHDIPEDVTEVFLTGATSKLGRAIALYLCQRRVRVLMLTH  751
            +HP LKV+VV G++L  AV+L+ IP+  T+V L G  SK+  AIAL LCQ  V+V+ L  
Sbjct  386  RHPELKVKVVDGSSLAVAVVLNSIPKGTTQVVLGGHLSKVANAIALALCQGGVKVVTLRE  445

Query  750  STERFQKIQKEAPADCQKLLVQVTKYQAAKNCKTWIVGKWITPKEQNFAPPGAHFHQFVV  571
              E ++K++     +    LV    Y +    K W+VG  ++  EQ  AP G  F  F  
Sbjct  446  --EEYKKLKSSLTPEVAANLVPSKTYAS----KIWLVGDGLSEDEQLKAPKGTLFIPFSQ  499

Query  570  PPILPFRRDCTYGDLAAMKLPHDVQGLGNCEYTMERGVVHACHAGGAVHSLEGWSHHEVG  391
             P    R+DC Y    AM  P   + + +CE  + R V+ A    G +H+LEGW+ HE G
Sbjct  500  FPPRKARKDCLYFHTPAMITPKHFENVDSCENWLPRRVMSAWRVAGILHALEGWNEHECG  559

Query  390  AIDVHRIDVVWEAALKHGLKPVTT  319
             + +  I+ VW+A+L HG  P+TT
Sbjct  560  NM-MFDIEKVWKASLDHGFSPLTT  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2200264392382