BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8312

Length=1096
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092961.1|  PREDICTED: probable 26S proteasome non-ATPas...    492   1e-168   Sesamum indicum [beniseed]
emb|CDP19574.1|  unnamed protein product                                489   1e-167   Coffea canephora [robusta coffee]
gb|KDO68111.1|  hypothetical protein CISIN_1g011352mg                   487   5e-167   Citrus sinensis [apfelsine]
ref|XP_008460112.1|  PREDICTED: probable 26S proteasome non-ATPas...    488   5e-167   Cucumis melo [Oriental melon]
ref|XP_006422568.1|  hypothetical protein CICLE_v10028313mg             488   5e-167   Citrus clementina [clementine]
emb|CDO98056.1|  unnamed protein product                                486   4e-166   Coffea canephora [robusta coffee]
ref|XP_009773689.1|  PREDICTED: probable 26S proteasome non-ATPas...    485   9e-166   Nicotiana sylvestris
ref|XP_009628272.1|  PREDICTED: probable 26S proteasome non-ATPas...    485   1e-165   Nicotiana tomentosiformis
sp|P93768.1|PSMD3_TOBAC  RecName: Full=Probable 26S proteasome no...    484   1e-165   Nicotiana tabacum [American tobacco]
ref|XP_004231054.1|  PREDICTED: probable 26S proteasome non-ATPas...    484   2e-165   
ref|XP_011088624.1|  PREDICTED: probable 26S proteasome non-ATPas...    484   2e-165   Sesamum indicum [beniseed]
ref|XP_002279715.1|  PREDICTED: probable 26S proteasome non-ATPas...    483   5e-165   Vitis vinifera
ref|XP_002521275.1|  26S proteasome regulatory subunit S3, putative     483   8e-165   Ricinus communis
ref|XP_009623855.1|  PREDICTED: probable 26S proteasome non-ATPas...    483   9e-165   Nicotiana tomentosiformis
ref|XP_010107643.1|  putative 26S proteasome non-ATPase regulator...    479   1e-163   Morus notabilis
ref|XP_004500920.1|  PREDICTED: probable 26S proteasome non-ATPas...    479   2e-163   Cicer arietinum [garbanzo]
ref|XP_012081815.1|  PREDICTED: probable 26S proteasome non-ATPas...    479   3e-163   Jatropha curcas
ref|XP_008447941.1|  PREDICTED: probable 26S proteasome non-ATPas...    478   4e-163   Cucumis melo [Oriental melon]
ref|XP_007136115.1|  hypothetical protein PHAVU_009G019100g             478   5e-163   Phaseolus vulgaris [French bean]
ref|XP_010266036.1|  PREDICTED: probable 26S proteasome non-ATPas...    478   5e-163   Nelumbo nucifera [Indian lotus]
ref|XP_003527532.1|  PREDICTED: probable 26S proteasome non-ATPas...    478   5e-163   Glycine max [soybeans]
ref|XP_009799469.1|  PREDICTED: probable 26S proteasome non-ATPas...    478   7e-163   Nicotiana sylvestris
ref|XP_003523322.1|  PREDICTED: probable 26S proteasome non-ATPas...    477   9e-163   Glycine max [soybeans]
gb|EYU37968.1|  hypothetical protein MIMGU_mgv1a005284mg                477   1e-162   Erythranthe guttata [common monkey flower]
ref|XP_003603813.1|  26S proteasome non-ATPase regulatory subunit       477   1e-162   Medicago truncatula
gb|KEH36262.1|  26S proteasome non-ATPase regulatory subunit 3          474   2e-162   Medicago truncatula
tpg|DAA48734.1|  TPA: hypothetical protein ZEAMMB73_878535              469   2e-162   
gb|KHN09062.1|  Putative 26S proteasome non-ATPase regulatory sub...    476   2e-162   Glycine soja [wild soybean]
gb|EYU22574.1|  hypothetical protein MIMGU_mgv1a005362mg                476   3e-162   Erythranthe guttata [common monkey flower]
gb|KEH36263.1|  26S proteasome non-ATPase regulatory subunit 3          474   3e-162   Medicago truncatula
gb|KHN45952.1|  Putative 26S proteasome non-ATPase regulatory sub...    475   5e-162   Glycine soja [wild soybean]
ref|XP_007200984.1|  hypothetical protein PRUPE_ppa004807mg             475   7e-162   Prunus persica
ref|XP_010933362.1|  PREDICTED: probable 26S proteasome non-ATPas...    474   1e-161   Elaeis guineensis
dbj|BAG94867.1|  unnamed protein product                                471   1e-161   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010266868.1|  PREDICTED: probable 26S proteasome non-ATPas...    474   1e-161   Nelumbo nucifera [Indian lotus]
ref|XP_006416422.1|  hypothetical protein EUTSA_v10007479mg             474   1e-161   Eutrema salsugineum [saltwater cress]
gb|KJB15844.1|  hypothetical protein B456_002G199200                    472   2e-161   Gossypium raimondii
ref|XP_007041788.1|  PAM domain (PCI/PINT associated module) prot...    474   2e-161   
ref|XP_003545019.1|  PREDICTED: probable 26S proteasome non-ATPas...    474   2e-161   Glycine max [soybeans]
ref|XP_007017882.1|  PAM domain (PCI/PINT associated module) prot...    473   3e-161   
ref|XP_010229049.1|  PREDICTED: probable 26S proteasome non-ATPas...    473   4e-161   
emb|CDX87648.1|  BnaA07g32250D                                          473   4e-161   
gb|KJB15843.1|  hypothetical protein B456_002G199200                    473   6e-161   Gossypium raimondii
ref|NP_001063817.1|  Os09g0541900                                       473   6e-161   
ref|XP_004144854.1|  PREDICTED: probable 26S proteasome non-ATPas...    472   6e-161   Cucumis sativus [cucumbers]
gb|EAZ09931.1|  hypothetical protein OsI_32229                          472   7e-161   Oryza sativa Indica Group [Indian rice]
ref|XP_009106250.1|  PREDICTED: 26S proteasome non-ATPase regulat...    473   7e-161   Brassica rapa
ref|XP_004974153.1|  PREDICTED: probable 26S proteasome non-ATPas...    472   9e-161   Setaria italica
ref|XP_008236045.1|  PREDICTED: probable 26S proteasome non-ATPas...    472   1e-160   Prunus mume [ume]
ref|XP_010920092.1|  PREDICTED: probable 26S proteasome non-ATPas...    472   1e-160   Elaeis guineensis
ref|XP_004957510.1|  PREDICTED: probable 26S proteasome non-ATPas...    471   2e-160   Setaria italica
ref|XP_004145004.1|  PREDICTED: probable 26S proteasome non-ATPas...    471   2e-160   Cucumis sativus [cucumbers]
sp|Q06364.2|PSMD3_DAUCA  RecName: Full=Probable 26S proteasome no...    471   2e-160   Daucus carota [carrots]
ref|XP_002444618.1|  hypothetical protein SORBIDRAFT_07g024800          471   2e-160   Sorghum bicolor [broomcorn]
gb|KHG18147.1|  putative 26S proteasome non-ATPase regulatory sub...    471   2e-160   Gossypium arboreum [tree cotton]
emb|CDX73215.1|  BnaC06g36630D                                          471   3e-160   
gb|KFK42036.1|  hypothetical protein AALP_AA2G203500                    471   4e-160   Arabis alpina [alpine rockcress]
ref|NP_173447.1|  probable 26S proteasome non-ATPase regulatory s...    471   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660915.1|  PREDICTED: probable 26S proteasome non-ATPas...    467   4e-160   
gb|AAM53298.1|  putative proteasome regulatory subunit S3               470   4e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459703.1|  PREDICTED: 26S proteasome non-ATPase regulat...    470   5e-160   Camelina sativa [gold-of-pleasure]
ref|XP_010063310.1|  PREDICTED: probable 26S proteasome non-ATPas...    470   5e-160   Eucalyptus grandis [rose gum]
gb|ACG34075.1|  26S proteasome non-ATPase regulatory subunit 3          470   6e-160   Zea mays [maize]
gb|ACF84535.1|  unknown                                                 470   6e-160   Zea mays [maize]
ref|XP_008382101.1|  PREDICTED: probable 26S proteasome non-ATPas...    470   8e-160   Malus domestica [apple tree]
ref|XP_009355646.1|  PREDICTED: probable 26S proteasome non-ATPas...    469   1e-159   Pyrus x bretschneideri [bai li]
dbj|BAG87837.1|  unnamed protein product                                466   1e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002889051.1|  hypothetical protein ARALYDRAFT_476749             468   2e-159   
gb|EEE69116.1|  hypothetical protein OsJ_28197                          467   4e-159   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB78499.1|  26S proteasome regulatory particle non-ATPase su...    465   4e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660365.1|  PREDICTED: probable 26S proteasome non-ATPas...    468   4e-159   Oryza brachyantha
gb|ACN28097.1|  unknown                                                 468   5e-159   Zea mays [maize]
ref|XP_004290733.1|  PREDICTED: probable 26S proteasome non-ATPas...    468   5e-159   Fragaria vesca subsp. vesca
ref|NP_001149170.1|  26S proteasome non-ATPase regulatory subunit 3     468   5e-159   Zea mays [maize]
gb|AAF79894.1|AC022472_3  Contains similarity to 26s proteasome r...    469   5e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935159.1|  PREDICTED: probable 26S proteasome non-ATPas...    468   6e-159   Elaeis guineensis
ref|XP_010498455.1|  PREDICTED: 26S proteasome non-ATPase regulat...    468   6e-159   Camelina sativa [gold-of-pleasure]
ref|XP_010536429.1|  PREDICTED: 26S proteasome non-ATPase regulat...    468   6e-159   Tarenaya hassleriana [spider flower]
ref|XP_006307354.1|  hypothetical protein CARUB_v10008972mg             467   8e-159   Capsella rubella
ref|XP_010477252.1|  PREDICTED: 26S proteasome non-ATPase regulat...    467   8e-159   Camelina sativa [gold-of-pleasure]
ref|NP_001149380.1|  LOC100283005                                       467   1e-158   Zea mays [maize]
ref|NP_001062444.1|  Os08g0550100                                       467   1e-158   
ref|NP_177726.1|  probable 26S proteasome non-ATPase regulatory s...    467   1e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811676.1|  PREDICTED: probable 26S proteasome non-ATPas...    466   2e-158   Phoenix dactylifera
ref|XP_011045871.1|  PREDICTED: probable 26S proteasome non-ATPas...    466   2e-158   Populus euphratica
ref|XP_009401896.1|  PREDICTED: probable 26S proteasome non-ATPas...    466   2e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006390248.1|  hypothetical protein EUTSA_v10018459mg             465   6e-158   Eutrema salsugineum [saltwater cress]
ref|XP_003578544.1|  PREDICTED: probable 26S proteasome non-ATPas...    465   1e-157   Brachypodium distachyon [annual false brome]
ref|XP_008377724.1|  PREDICTED: LOW QUALITY PROTEIN: probable 26S...    464   1e-157   
ref|XP_002893093.1|  EMB2719                                            463   3e-157   Arabidopsis lyrata subsp. lyrata
gb|KJB47689.1|  hypothetical protein B456_008G037000                    462   6e-157   Gossypium raimondii
ref|XP_002312950.2|  26S proteasome regulatory subunit S3 family ...    462   7e-157   
ref|XP_010416506.1|  PREDICTED: 26S proteasome non-ATPase regulat...    462   9e-157   Camelina sativa [gold-of-pleasure]
ref|XP_002306189.1|  26S proteasome regulatory subunit S3 family ...    462   1e-156   Populus trichocarpa [western balsam poplar]
ref|XP_002510590.1|  26S proteasome regulatory subunit S3, putative     461   2e-156   Ricinus communis
ref|XP_008809439.1|  PREDICTED: probable 26S proteasome non-ATPas...    461   2e-156   Phoenix dactylifera
ref|XP_010666922.1|  PREDICTED: probable 26S proteasome non-ATPas...    460   5e-156   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006302193.1|  hypothetical protein CARUB_v10020202mg             460   6e-156   Capsella rubella
ref|XP_008806135.1|  PREDICTED: probable 26S proteasome non-ATPas...    459   1e-155   Phoenix dactylifera
ref|XP_011046661.1|  PREDICTED: probable 26S proteasome non-ATPas...    459   1e-155   Populus euphratica
ref|XP_009413027.1|  PREDICTED: probable 26S proteasome non-ATPas...    459   1e-155   
ref|XP_007160631.1|  hypothetical protein PHAVU_001G003600g             459   1e-155   Phaseolus vulgaris [French bean]
ref|XP_010428646.1|  PREDICTED: 26S proteasome non-ATPase regulat...    458   2e-155   Camelina sativa [gold-of-pleasure]
gb|EPS67790.1|  hypothetical protein M569_06981                         458   3e-155   Genlisea aurea
gb|EMT22108.1|  Putative 26S proteasome non-ATPase regulatory sub...    458   3e-155   
ref|XP_009382040.1|  PREDICTED: probable 26S proteasome non-ATPas...    457   6e-155   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK07086.1|  predicted protein                                      457   8e-155   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010471748.1|  PREDICTED: 26S proteasome non-ATPase regulat...    456   1e-154   
dbj|BAJ90869.1|  predicted protein                                      456   3e-154   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49644.1|  putative 26S proteasome non-ATPase regulatory sub...    456   6e-154   Triticum urartu
ref|XP_007222347.1|  hypothetical protein PRUPE_ppa004821mg             455   7e-154   Prunus persica
ref|XP_008221217.1|  PREDICTED: probable 26S proteasome non-ATPas...    454   9e-154   Prunus mume [ume]
ref|XP_008221216.1|  PREDICTED: probable 26S proteasome non-ATPas...    454   1e-153   Prunus mume [ume]
ref|XP_006855514.1|  PREDICTED: probable 26S proteasome non-ATPas...    453   2e-153   Amborella trichopoda
dbj|BAK06811.1|  predicted protein                                      448   9e-153   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003550437.1|  PREDICTED: probable 26S proteasome non-ATPas...    451   1e-152   Glycine max [soybeans]
ref|XP_006601362.1|  PREDICTED: probable 26S proteasome non-ATPas...    451   2e-152   
ref|XP_002285893.1|  PREDICTED: probable 26S proteasome non-ATPas...    451   3e-152   Vitis vinifera
gb|AAF26768.2|AC007396_17  T4O12.21                                     452   3e-152   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16257.1|  unknown                                                 450   6e-152   Picea sitchensis
dbj|BAK01467.1|  predicted protein                                      449   7e-152   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003589555.1|  26S proteasome non-ATPase regulatory subunit       447   4e-151   Medicago truncatula
gb|EMT33081.1|  Putative 26S proteasome non-ATPase regulatory sub...    447   7e-151   
ref|XP_004499304.1|  PREDICTED: probable 26S proteasome non-ATPas...    445   3e-150   Cicer arietinum [garbanzo]
gb|EMS46362.1|  putative 26S proteasome non-ATPase regulatory sub...    447   1e-148   Triticum urartu
gb|EEC83998.1|  hypothetical protein OsI_30168                          434   4e-148   Oryza sativa Indica Group [Indian rice]
ref|XP_007017885.1|  PAM domain (PCI/PINT associated module) prot...    437   5e-147   
ref|XP_010446200.1|  PREDICTED: 26S proteasome non-ATPase regulat...    436   9e-147   Camelina sativa [gold-of-pleasure]
ref|XP_010446093.1|  PREDICTED: 26S proteasome non-ATPase regulat...    433   9e-147   
gb|KHG11096.1|  putative 26S proteasome non-ATPase regulatory sub...    424   1e-142   Gossypium arboreum [tree cotton]
ref|XP_001753136.1|  predicted protein                                  420   2e-140   
ref|XP_001764054.1|  predicted protein                                  419   6e-140   
ref|XP_001757567.1|  predicted protein                                  416   1e-138   
ref|XP_002970446.1|  hypothetical protein SELMODRAFT_231540             405   8e-135   
ref|XP_009628274.1|  PREDICTED: probable 26S proteasome non-ATPas...    397   2e-131   Nicotiana tomentosiformis
ref|XP_009628273.1|  PREDICTED: probable 26S proteasome non-ATPas...    397   2e-131   Nicotiana tomentosiformis
ref|XP_004231453.1|  PREDICTED: probable 26S proteasome non-ATPas...    390   1e-128   Solanum lycopersicum
ref|XP_009773690.1|  PREDICTED: probable 26S proteasome non-ATPas...    389   5e-128   Nicotiana sylvestris
ref|XP_009773691.1|  PREDICTED: probable 26S proteasome non-ATPas...    389   5e-128   Nicotiana sylvestris
dbj|BAA02696.1|  21D7 antigen                                           382   2e-125   Daucus carota [carrots]
ref|XP_002300686.1|  26S proteasome regulatory subunit S3 family ...    372   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_011034976.1|  PREDICTED: probable 26S proteasome non-ATPas...    368   6e-120   Populus euphratica
ref|XP_011034975.1|  PREDICTED: probable 26S proteasome non-ATPas...    368   7e-120   Populus euphratica
ref|XP_011034972.1|  PREDICTED: probable 26S proteasome non-ATPas...    368   1e-119   Populus euphratica
ref|XP_006386166.1|  hypothetical protein POPTR_0002s01940g             321   1e-101   
gb|AFK34954.1|  unknown                                                 308   1e-100   Lotus japonicus
emb|CBI37854.3|  unnamed protein product                                305   3e-96    Vitis vinifera
ref|XP_002945863.1|  26S proteasome regulatory complex                  305   2e-95    Volvox carteri f. nagariensis
ref|XP_001696175.1|  26S proteasome regulatory subunit                  304   5e-95    Chlamydomonas reinhardtii
ref|XP_011034977.1|  PREDICTED: probable 26S proteasome non-ATPas...    300   1e-94    Populus euphratica
gb|AAL09760.1|  At1g20200/T20H2_4                                       295   5e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005649181.1|  26S proteasome regulatory subunit                  282   1e-86    Coccomyxa subellipsoidea C-169
ref|XP_001415380.1|  predicted protein                                  279   4e-86    Ostreococcus lucimarinus CCE9901
ref|XP_002500951.1|  predicted protein                                  278   6e-86    Micromonas commoda
emb|CEF96488.1|  26S proteasome regulatory subunit, C-terminal          280   9e-86    Ostreococcus tauri
ref|XP_005181586.1|  PREDICTED: probable 26S proteasome non-ATPas...    275   8e-84    Musca domestica
ref|XP_005850128.1|  hypothetical protein CHLNCDRAFT_20545              274   1e-83    Chlorella variabilis
gb|EFX72606.1|  hypothetical protein DAPPUDRAFT_227411                  273   5e-83    Daphnia pulex
ref|XP_002424930.1|  26S proteasome regulatory subunit S3, putative     273   7e-83    Pediculus humanus corporis [human body lice]
ref|XP_003705277.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   2e-82    Megachile rotundata
ref|XP_005107539.1|  PREDICTED: 26S proteasome non-ATPase regulat...    271   2e-82    Aplysia californica
ref|XP_011564474.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   3e-82    Plutella xylostella [cabbage moth]
ref|XP_011548125.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   3e-82    Plutella xylostella [cabbage moth]
ref|XP_002595252.1|  hypothetical protein BRAFLDRAFT_268075             271   3e-82    Branchiostoma floridae
sp|Q9U5Z8.1|PSMD3_ANOST  RecName: Full=Probable 26S proteasome no...    271   3e-82    Anopheles stephensi
ref|XP_001605959.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   4e-82    Nasonia vitripennis
ref|XP_002051535.1|  GJ11636                                            270   4e-82    Drosophila virilis
ref|XP_004996585.1|  proteasome 26S non-ATPase subunit 3                270   5e-82    Salpingoeca rosetta
gb|ETN60770.1|  26S proteasome regulatory subunit S3                    270   7e-82    Anopheles darlingi [American malaria mosquito]
ref|XP_004931019.1|  PREDICTED: probable 26S proteasome non-ATPas...    270   7e-82    Bombyx mori [silk moth]
gb|KFB39121.1|  AGAP009082-PA-like protein                              270   1e-81    Anopheles sinensis
ref|XP_001987942.1|  GH10894                                            269   1e-81    Drosophila grimshawi
ref|XP_002067151.1|  GK24169                                            269   1e-81    Drosophila willistoni
ref|XP_002002367.1|  GI13097                                            269   1e-81    Drosophila mojavensis
gb|AJK90582.1|  26S proteasome non-ATPase regulatory subunit 3          268   2e-81    Laodelphax striatella
ref|XP_784007.1|  PREDICTED: 26S proteasome non-ATPase regulatory...    268   2e-81    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011494959.1|  PREDICTED: probable 26S proteasome non-ATPas...    268   3e-81    Ceratosolen solmsi marchali
dbj|BAM18273.1|  regulatory particle non-ATPase 3, Dox-A2               268   3e-81    Papilio xuthus [Chinese swallowtail]
ref|XP_004707502.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   3e-81    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009075840.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    262   3e-81    Acanthisitta chloris
ref|XP_008688097.1|  PREDICTED: 26S proteasome non-ATPase regulat...    266   4e-81    Ursus maritimus [white bear]
gb|KFH67510.1|  26S proteasome regulatory subunit N3                    268   6e-81    Mortierella verticillata NRRL 6337
ref|XP_006814940.1|  PREDICTED: 26S proteasome non-ATPase regulat...    267   7e-81    Saccoglossus kowalevskii
ref|XP_623947.1|  PREDICTED: probable 26S proteasome non-ATPase r...    267   8e-81    
ref|XP_003689802.1|  PREDICTED: probable 26S proteasome non-ATPas...    267   9e-81    Apis florea [dwarf honeybee]
ref|XP_011143024.1|  PREDICTED: probable 26S proteasome non-ATPas...    267   9e-81    Harpegnathos saltator
ref|XP_006608624.1|  PREDICTED: probable 26S proteasome non-ATPas...    267   9e-81    Apis dorsata [rock honeybee]
ref|XP_009826168.1|  hypothetical protein H257_03673                    266   2e-80    Aphanomyces astaci
emb|CDH49942.1|  proteasome regulatory particle subunit                 266   2e-80    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_011647981.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   2e-80    Pogonomyrmex barbatus
gb|ELU15663.1|  hypothetical protein CAPTEDRAFT_153237                  267   2e-80    Capitella teleta
ref|XP_011883079.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   2e-80    Vollenhovia emeryi
emb|CDS04865.1|  hypothetical protein LRAMOSA07395                      266   2e-80    Lichtheimia ramosa
ref|XP_011695146.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   2e-80    Wasmannia auropunctata
ref|XP_012061456.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   2e-80    Atta cephalotes
ref|XP_005107538.1|  PREDICTED: 26S proteasome non-ATPase regulat...    267   2e-80    
ref|XP_003488721.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   2e-80    Bombus impatiens
ref|XP_003395331.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   2e-80    
ref|XP_011723582.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   2e-80    Macaca nemestrina [pigtail macaque]
gb|EHJ74217.1|  putative 26S proteasome regulatory subunit S3           266   2e-80    
gb|KDO29869.1|  hypothetical protein SPRG_04936                         265   3e-80    Saprolegnia parasitica CBS 223.65
ref|XP_008870910.1|  hypothetical protein H310_07313                    265   3e-80    Aphanomyces invadans
ref|NP_956866.1|  26S proteasome non-ATPase regulatory subunit 3        266   3e-80    Danio rerio [leopard danio]
ref|XP_011197796.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   3e-80    Bactrocera dorsalis [papaya fruit fly]
ref|XP_001662261.1|  AAEL012122-PA                                      265   3e-80    Aedes aegypti
ref|XP_011056581.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   3e-80    Acromyrmex echinatior
ref|XP_008603832.1|  hypothetical protein SDRG_00145                    265   3e-80    Saprolegnia diclina VS20
ref|XP_011673623.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   3e-80    Strongylocentrotus purpuratus [purple urchin]
ref|XP_009333239.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   4e-80    Pygoscelis adeliae
ref|XP_010722887.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   4e-80    Meleagris gallopavo [common turkey]
gb|AAL90075.1|  AT15146p                                                265   4e-80    Drosophila melanogaster
ref|NP_477300.1|  regulatory particle non-ATPase 3, isoform A           265   4e-80    Drosophila melanogaster
ref|XP_002039065.1|  GM17319                                            265   4e-80    Drosophila sechellia
ref|XP_002079876.1|  GD24178                                            265   5e-80    Drosophila simulans
ref|XP_319831.2|  AGAP009082-PA                                         265   5e-80    Anopheles gambiae str. PEST
ref|XP_002090656.1|  GE13227                                            265   5e-80    Drosophila yakuba
ref|XP_001846487.1|  26S proteasome non-ATPase regulatory subunit 3     265   5e-80    Culex quinquefasciatus
ref|XP_001974302.1|  GG21155                                            265   6e-80    Drosophila erecta
ref|XP_011257200.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   6e-80    Camponotus floridanus
ref|XP_011309304.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   6e-80    Fopius arisanus
ref|XP_011235692.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   6e-80    
ref|XP_009988054.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   8e-80    Tauraco erythrolophus
ref|XP_001961923.1|  GF14695                                            264   9e-80    Drosophila ananassae
dbj|BAE01724.1|  unnamed protein product                                263   9e-80    Macaca fascicularis [crab eating macaque]
ref|XP_011175669.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   9e-80    Solenopsis invicta [imported red fire ant]
ref|XP_003222495.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   9e-80    Anolis carolinensis [Carolina anole]
ref|XP_009477980.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-79    Pelecanus crispus
gb|AAC18058.1|  diphenol oxidase-A2                                     264   1e-79    Anopheles gambiae
ref|XP_009874430.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-79    Apaloderma vittatum
ref|XP_007062032.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   1e-79    
ref|XP_008484303.1|  PREDICTED: probable 26S proteasome non-ATPas...    259   2e-79    Diaphorina citri
ref|XP_008414675.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   2e-79    Poecilia reticulata
ref|XP_011190713.1|  PREDICTED: probable 26S proteasome non-ATPas...    263   2e-79    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_010308532.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   2e-79    Balearica regulorum gibbericeps
ref|XP_004608798.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   2e-79    Sorex araneus [Eurasian shrew]
gb|KDR10975.1|  hypothetical protein L798_15053                         263   2e-79    Zootermopsis nevadensis
ref|XP_010295693.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-79    Phaethon lepturus
gb|EMC77897.1|  26S proteasome non-ATPase regulatory subunit 3          262   2e-79    
ref|XP_009578233.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-79    Fulmarus glacialis
ref|XP_006638287.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   2e-79    Lepisosteus oculatus
ref|XP_005999586.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   2e-79    Latimeria chalumnae
ref|XP_008293025.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   2e-79    Stegastes partitus
ref|XP_010206163.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-79    Colius striatus
ref|XP_009883974.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   3e-79    Charadrius vociferus
ref|XP_005232750.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   3e-79    
gb|AFM88771.1|  26S proteasome non-ATPase regulatory subunit 3-li...    264   3e-79    Callorhinchus milii [Australian ghost shark]
ref|XP_009463186.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   3e-79    Nipponia nippon
ref|XP_005368329.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   3e-79    Microtus ochrogaster [prairie voles]
ref|XP_009569021.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   3e-79    Cuculus canorus
ref|XP_006214329.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   3e-79    Vicugna pacos
ref|XP_007940247.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   3e-79    Orycteropus afer afer
ref|XP_010007099.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   3e-79    Chaetura pelagica
ref|XP_007420739.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   3e-79    
ref|XP_001357240.1|  GA10344                                            263   3e-79    Drosophila pseudoobscura pseudoobscura
ref|XP_002733522.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   3e-79    Saccoglossus kowalevskii
ref|XP_003442595.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   4e-79    Oreochromis niloticus
ref|XP_008328616.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   4e-79    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005753080.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   4e-79    Pundamilia nyererei
ref|XP_004591217.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   4e-79    Ochotona princeps [southern American pika]
ref|XP_006176397.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   4e-79    Camelus ferus
ref|XP_004450126.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   4e-79    Dasypus novemcinctus
ref|XP_010840930.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   4e-79    Bison bison bison
gb|AAP80660.1|AF479041_1  regulatory particle mon-ATPase subunit 3      251   4e-79    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008988616.1|  PREDICTED: 26S proteasome non-ATPase regulat...    264   4e-79    
ref|XP_002940423.2|  PREDICTED: 26S proteasome non-ATPase regulat...    263   4e-79    Xenopus tropicalis [western clawed frog]
ref|XP_009029400.1|  hypothetical protein HELRODRAFT_186129             263   4e-79    Helobdella robusta
dbj|BAG51399.1|  unnamed protein product                                263   5e-79    Homo sapiens [man]
ref|XP_005321856.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   5e-79    Ictidomys tridecemlineatus
ref|XP_005394396.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   5e-79    Chinchilla lanigera
ref|XP_009672109.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   5e-79    Struthio camelus australis
ref|XP_004608797.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   5e-79    Sorex araneus [Eurasian shrew]
ref|XP_006832632.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   5e-79    Chrysochloris asiatica
ref|XP_002019057.1|  GL26159                                            262   6e-79    Drosophila persimilis
ref|XP_006832631.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   6e-79    Chrysochloris asiatica
ref|XP_006889464.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   6e-79    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006889463.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   6e-79    Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAB71019.1|  unnamed protein product                                263   7e-79    Homo sapiens [man]
ref|XP_008827637.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   7e-79    Nannospalax galili
ref|XP_001626069.1|  predicted protein                                  262   7e-79    Nematostella vectensis
ref|XP_007562147.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   7e-79    
ref|XP_005076004.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   8e-79    
ref|XP_007940246.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   8e-79    
ref|XP_011592387.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   8e-79    
ref|XP_010583859.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   8e-79    
ref|XP_011331025.1|  PREDICTED: probable 26S proteasome non-ATPas...    262   8e-79    
ref|XP_006889462.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   8e-79    
ref|XP_005964828.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    263   8e-79    
ref|XP_004434606.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   9e-79    
dbj|BAG60639.1|  unnamed protein product                                262   9e-79    
ref|XP_005513827.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   9e-79    
ref|XP_011997232.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   9e-79    
dbj|BAA23651.1|  proteasome subunit p58                                 263   9e-79    
ref|XP_004378111.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   9e-79    
ref|XP_003996842.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   9e-79    
ref|NP_001008282.1|  26S proteasome non-ATPase regulatory subunit 3     263   9e-79    
ref|NP_033465.1|  26S proteasome non-ATPase regulatory subunit 3        263   9e-79    
gb|AAA37241.1|  Tum-P91A antigen                                        263   9e-79    
ref|XP_548138.2|  PREDICTED: 26S proteasome non-ATPase regulatory...    263   9e-79    
ref|XP_003942883.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   9e-79    
ref|XP_004633773.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_006832630.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
gb|AIC54982.1|  PSMD3                                                   263   1e-78    
ref|XP_006155982.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_010958760.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_007177639.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_003414749.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_007618536.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_004311972.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_004282791.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_008580238.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
gb|AAP36540.1|  Homo sapiens proteasome (prosome, macropain) 26S ...    263   1e-78    
ref|XP_008063363.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|NP_001233571.1|  26S proteasome non-ATPase regulatory subunit 3     263   1e-78    
ref|XP_011901863.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_007112590.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_010990106.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_004012903.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_004655517.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_008063362.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
emb|CAG33053.1|  PSMD3                                                  263   1e-78    
ref|XP_001918105.2|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    263   1e-78    
ref|NP_001085955.1|  proteasome (prosome, macropain) 26S subunit,...    261   1e-78    
ref|XP_003913001.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_004395090.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|NP_001039365.1|  26S proteasome non-ATPase regulatory subunit 3     262   1e-78    
ref|NP_002800.2|  26S proteasome non-ATPase regulatory subunit 3        262   1e-78    
ref|XP_005898084.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_007940245.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_004378110.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
emb|CDQ70571.1|  unnamed protein product                                262   1e-78    
ref|XP_004434605.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_008269649.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    262   1e-78    
gb|ELR54788.1|  26S proteasome non-ATPase regulatory subunit 3          262   1e-78    
ref|XP_008517128.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_004521419.1|  PREDICTED: probable 26S proteasome non-ATPas...    261   1e-78    
ref|XP_007531081.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_006924749.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_007085857.1|  PREDICTED: 26S proteasome non-ATPase regulat...    263   1e-78    
ref|XP_011785253.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|NP_001247785.1|  26S proteasome non-ATPase regulatory subunit 3     262   1e-78    
ref|XP_005861943.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_004764682.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_006117479.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   1e-78    
ref|XP_006022648.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_008152049.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
ref|XP_003786457.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   1e-78    
dbj|BAG62596.1|  unnamed protein product                                262   1e-78    
ref|XP_003131544.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-78    
ref|XP_006100873.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-78    
gb|ACN10780.1|  26S proteasome non-ATPase regulatory subunit 3          261   2e-78    
ref|XP_006832629.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-78    
ref|XP_004684293.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   2e-78    
ref|XP_010411046.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   2e-78    
ref|XP_009271354.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   2e-78    
ref|XP_005531480.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   2e-78    
gb|AFM87810.1|  26S proteasome non-ATPase regulatory subunit 3-li...    261   2e-78    
ref|NP_001133516.1|  26S proteasome non-ATPase regulatory subunit 3     261   2e-78    
gb|ADX97120.1|  26S proteasome non-ATPase regulatory subunit 3          258   3e-78    
ref|XP_009094795.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    261   3e-78    
ref|XP_005294194.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   3e-78    
ref|XP_005059837.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   3e-78    
ref|XP_008553436.1|  PREDICTED: probable 26S proteasome non-ATPas...    260   3e-78    
ref|XP_011723581.1|  PREDICTED: 26S proteasome non-ATPase regulat...    257   3e-78    
ref|XP_008503984.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   3e-78    
ref|XP_007230838.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   3e-78    
dbj|BAG57021.1|  unnamed protein product                                261   3e-78    
ref|XP_002827666.3|  PREDICTED: 26S proteasome non-ATPase regulat...    261   3e-78    
ref|XP_005694359.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   3e-78    
ref|NP_001026533.1|  26S proteasome non-ATPase regulatory subunit 3     261   4e-78    
dbj|GAN08202.1|  26S proteasome non-ATPase regulatory subunit 3         260   4e-78    
gb|KDE02541.1|  hypothetical protein MVLG_06904                         262   4e-78    
ref|XP_003768348.1|  PREDICTED: 26S proteasome non-ATPase regulat...    259   4e-78    
gb|EXX77249.1|  proteasome regulatory particle lid subunit RPN3         258   4e-78    
ref|XP_003744755.1|  PREDICTED: 26S proteasome non-ATPase regulat...    260   4e-78    
gb|EPB85306.1|  hypothetical protein HMPREF1544_07920                   260   5e-78    
ref|XP_009862513.1|  PREDICTED: 26S proteasome non-ATPase regulat...    258   5e-78    
ref|XP_003466977.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   5e-78    
dbj|BAC04310.1|  unnamed protein product                                260   5e-78    
gb|AIC54981.1|  PSMD3                                                   261   5e-78    
ref|XP_005710687.1|  unnamed protein product                            260   6e-78    
gb|AAH12302.1|  Proteasome (prosome, macropain) 26S subunit, non-...    261   6e-78    
ref|XP_005439436.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   6e-78    
ref|XP_004859530.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   6e-78    
gb|EIE84168.1|  hypothetical protein RO3G_08878                         259   8e-78    
ref|XP_006749652.1|  PREDICTED: 26S proteasome non-ATPase regulat...    262   8e-78    
emb|CAF95635.1|  unnamed protein product                                260   8e-78    
gb|AFM88157.1|  26S proteasome non-ATPase regulatory subunit 3-li...    260   9e-78    
emb|CDQ74838.1|  unnamed protein product                                260   1e-77    
ref|XP_009533918.1|  hypothetical protein PHYSODRAFT_371796             256   1e-77    
ref|XP_004340207.1|  proteasome (prosome, macropain) 26S subunit,...    259   1e-77    
gb|EXX77250.1|  proteasome regulatory particle lid subunit RPN3         258   1e-77    
ref|XP_008900914.1|  hypothetical protein PPTG_08551                    259   2e-77    
ref|XP_005029524.1|  PREDICTED: 26S proteasome non-ATPase regulat...    255   2e-77    
gb|ETI53309.1|  hypothetical protein F443_03708                         259   2e-77    
ref|XP_007908064.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   2e-77    
gb|EPZ36769.1|  PCI/PINT associated module domain-containing protein    252   2e-77    
gb|ETK93153.1|  hypothetical protein L915_03600                         259   2e-77    
ref|XP_001366018.1|  PREDICTED: 26S proteasome non-ATPase regulat...    259   2e-77    
dbj|BAC36709.1|  unnamed protein product                                259   2e-77    
ref|XP_009034199.1|  hypothetical protein AURANDRAFT_70080              258   2e-77    
ref|XP_006774390.1|  PREDICTED: 26S proteasome non-ATPase regulat...    259   2e-77    
dbj|BAE26453.1|  unnamed protein product                                259   2e-77    
gb|EOA94377.1|  26S proteasome non-ATPase regulatory subunit 3          255   2e-77    
ref|XP_010865170.1|  PREDICTED: 26S proteasome non-ATPase regulat...    258   2e-77    
ref|XP_009062478.1|  hypothetical protein LOTGIDRAFT_207043             258   2e-77    
ref|XP_002130296.3|  PREDICTED: 26S proteasome non-ATPase regulat...    258   3e-77    
ref|XP_003278356.1|  PREDICTED: 26S proteasome non-ATPase regulat...    257   5e-77    
dbj|BAN21246.1|  26S proteasome regulatory subunit S3                   256   6e-77    
ref|XP_004646320.1|  PREDICTED: 26S proteasome non-ATPase regulat...    258   7e-77    
ref|XP_009533913.1|  hypothetical protein PHYSODRAFT_361753             257   1e-76    
ref|XP_006805354.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    256   2e-76    
ref|XP_003074100.1|  putative nuclear antigen 21D7 (ISS)                254   2e-76    
emb|CEP09572.1|  hypothetical protein                                   256   2e-76    
ref|XP_009640850.1|  PREDICTED: 26S proteasome non-ATPase regulat...    254   2e-76    
emb|CBJ48748.1|  conserved unknown protein                              255   2e-76    
ref|XP_003388163.1|  PREDICTED: probable 26S proteasome non-ATPas...    255   3e-76    
ref|XP_006677247.1|  hypothetical protein BATDEDRAFT_23283              254   4e-76    
ref|NP_001133204.1|  proteasome (prosome, macropain) 26S subunit,...    255   5e-76    
ref|XP_001943276.1|  PREDICTED: probable 26S proteasome non-ATPas...    254   6e-76    
ref|XP_010185775.1|  PREDICTED: 26S proteasome non-ATPase regulat...    253   7e-76    
ref|XP_012041447.1|  PREDICTED: 26S proteasome non-ATPase regulat...    256   8e-76    
ref|XP_005430458.1|  PREDICTED: 26S proteasome non-ATPase regulat...    258   8e-76    
ref|XP_006247334.1|  PREDICTED: 26S proteasome non-ATPase regulat...    256   8e-76    
gb|EPY87216.1|  26S proteasome non-ATPase regulatory subunit 3          262   8e-76    
ref|XP_971686.1|  PREDICTED: probable 26S proteasome non-ATPase r...    254   1e-75    
ref|XP_003056308.1|  predicted protein                                  254   1e-75    
gb|KFM62491.1|  26S proteasome non-ATPase regulatory subunit 3          252   3e-75    
ref|XP_008955033.1|  PREDICTED: 26S proteasome non-ATPase regulat...    255   4e-75    
gb|AAC79872.1|  putative 21D7 protein                                   242   4e-75    
gb|EMP33839.1|  26S proteasome non-ATPase regulatory subunit 3          260   5e-75    
ref|XP_003391976.1|  PREDICTED: probable 26S proteasome non-ATPas...    244   7e-75    
ref|XP_006270859.1|  PREDICTED: uncharacterized protein LOC102565064    261   7e-75    
ref|XP_002896901.1|  26S proteasome non-ATPase regulatory subunit 3     252   8e-75    
ref|XP_011419303.1|  PREDICTED: 26S proteasome non-ATPase regulat...    250   1e-74    
emb|CEG71096.1|  hypothetical protein RMATCC62417_06881                 250   2e-74    
ref|XP_004859527.1|  PREDICTED: 26S proteasome non-ATPase regulat...    253   2e-74    
ref|XP_005818618.1|  26S proteasome regulatory complex, subunit RPN3    251   2e-74    
gb|ERL86992.1|  hypothetical protein D910_04395                         250   2e-74    
ref|XP_007404787.1|  hypothetical protein MELLADRAFT_41669              251   2e-74    
ref|XP_009501498.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    248   3e-74    
ref|XP_002164530.2|  PREDICTED: 26S proteasome non-ATPase regulat...    249   3e-74    
gb|ENN77223.1|  hypothetical protein YQE_06053                          250   5e-74    
ref|XP_005707636.1|  26S proteasome regulatory subunit N3               249   5e-74    
gb|AAP80723.1|  ribosome protein S3                                     244   5e-74    
ref|XP_003333601.1|  hypothetical protein PGTG_15023                    250   6e-74    
emb|CBY42134.1|  unnamed protein product                                248   2e-73    
emb|CCA21665.1|  26S proteasome nonATPase regulatory subunit 3 putat    248   3e-73    
ref|XP_004347354.2|  proteasome 26S subunit                             249   3e-73    
gb|EWM24327.1|  26s proteasome non-atpase regulatory subunit 3          248   4e-73    
ref|XP_004354913.1|  26S proteasome regulatory subunit S3               247   5e-73    
emb|CCI47625.1|  unnamed protein product                                247   7e-73    
ref|XP_008641506.1|  PREDICTED: 26S proteasome non-ATPase regulat...    248   1e-72    
ref|XP_010010626.1|  PREDICTED: 26S proteasome non-ATPase regulat...    241   1e-72    
dbj|BAG61884.1|  unnamed protein product                                241   2e-72    
gb|EFB23382.1|  hypothetical protein PANDA_019565                       243   2e-72    
dbj|BAE32050.1|  unnamed protein product                                246   3e-72    
emb|CDY54330.1|  BnaCnng26760D                                          241   3e-72    
ref|XP_004556593.1|  PREDICTED: 26S proteasome non-ATPase regulat...    244   4e-72    
ref|XP_005139508.1|  PREDICTED: 26S proteasome non-ATPase regulat...    241   8e-72    
dbj|BAE63324.1|  unnamed protein product                                245   1e-71    
emb|CCD58783.1|  26S proteasome regulatory subunit S3, putative         240   1e-71    
ref|XP_009808068.1|  PREDICTED: 26S proteasome non-ATPase regulat...    241   1e-71    
gb|EPS26680.1|  hypothetical protein PDE_01618                          246   2e-71    
ref|XP_001217445.1|  26S proteasome non-ATPase regulatory subunit 3     246   2e-71    
ref|XP_011111683.1|  hypothetical protein H072_5877                     243   2e-71    
ref|XP_002623301.1|  proteasome regulatory particle subunit             246   2e-71    
ref|XP_001544199.1|  hypothetical protein HCAG_01246                    246   3e-71    
gb|EJU02426.1|  diphenol oxidase-A2                                     242   3e-71    
gb|EEH03591.1|  26S proteasome non-ATPase regulatory subunit 3          246   3e-71    
gb|EGC47915.1|  26S proteasome non-ATPase regulatory subunit 3          246   3e-71    
gb|EER37477.1|  26S proteasome non-ATPase regulatory subunit 3          246   3e-71    
gb|AAW25532.1|  SJCHGC06456 protein                                     242   3e-71    
ref|XP_001270630.1|  proteasome regulatory particle subunit (RpnC...    245   4e-71    
ref|XP_003188828.1|  proteasome regulatory particle subunit (RpnC)      243   5e-71    
ref|XP_002384196.1|  proteasome regulatory particle subunit (RpnC...    244   5e-71    
gb|EWC45043.1|  hypothetical protein DRE_06323                          241   8e-71    
ref|XP_001263840.1|  proteasome regulatory particle subunit (RpnC...    244   1e-70    
emb|CDJ94035.1|  Proteasome component region PCI and 26S proteaso...    241   1e-70    
emb|CDM32337.1|  Probable 26S proteasome regulatory subunit rpn3        244   1e-70    
ref|XP_006692152.1|  26S proteasome regulatory subunit-like protein     243   1e-70    
ref|XP_754995.1|  proteasome regulatory particle subunit (RpnC)         244   1e-70    
ref|XP_001904761.1|  hypothetical protein                               242   1e-70    
ref|XP_007515689.1|  unnamed protein product                            240   1e-70    
gb|KJK67701.1|  Proteasome regulatory subunit C-terminal                244   2e-70    
emb|CDJ92396.1|  Proteasome component region PCI and 26S proteaso...    241   2e-70    
gb|EPE03340.1|  26s proteasome non-atpase regulatory subunit 3          242   2e-70    
ref|XP_004859528.1|  PREDICTED: 26S proteasome non-ATPase regulat...    242   2e-70    
ref|XP_001246714.1|  hypothetical protein CIMG_00485                    243   2e-70    
ref|XP_002792174.1|  26S proteasome non-ATPase regulatory subunit 3     243   2e-70    
gb|EEH34915.2|  26S proteasome non-ATPase regulatory subunit 3          244   2e-70    
ref|XP_008726963.1|  hypothetical protein G647_04397                    242   2e-70    
gb|KIW69090.1|  hypothetical protein PV04_04986                         242   2e-70    
ref|XP_003066514.1|  26S proteasome regulatory subunit, putative        243   2e-70    
ref|XP_002541010.1|  26S proteasome non-ATPase regulatory subunit 3     243   2e-70    
emb|CCD58782.1|  26S proteasome regulatory subunit S3, putative         240   2e-70    
ref|XP_001394995.2|  proteasome regulatory particle subunit (RpnC)      243   3e-70    
ref|XP_007780775.1|  hypothetical protein W97_04696                     240   3e-70    
ref|XP_001806061.1|  hypothetical protein SNOG_15927                    239   3e-70    
dbj|GAA85707.1|  26S proteasome non-ATPase regulatory subunit 3         243   3e-70    
emb|CAK97121.1|  unnamed protein product                                243   4e-70    



>ref|XP_011092961.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
 ref|XP_011092962.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   492 bits (1267),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 254/267 (95%), Positives = 262/267 (98%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP +ALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVSALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKF+STFS 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKTVAEKFASTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIVSKAIRDG
Sbjct  342   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD TNG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHTNGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>emb|CDP19574.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   489 bits (1260),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 254/267 (95%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  281   TKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRTVAEKFSSTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIV+KAIRDG
Sbjct  341   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
              AEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   CAEKRRERQQQEQELAKHIAEEDDDEF  487



>gb|KDO68111.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=453

 Score =   487 bits (1253),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 253/267 (95%), Positives = 261/267 (98%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  187   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  246

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKFSSTFS 
Sbjct  247   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSSTFSS  306

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIVSKAIRDG
Sbjct  307   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDG  366

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  367   AIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  426

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  427   SAEKRRERQQQEQELAKHIAEEDDDEF  453



>ref|XP_008460112.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=485

 Score =   488 bits (1256),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 254/267 (95%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  219   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRVQC  278

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  279   NKWAIIVRLLLGEIPERTVFMQKGMETALRPYFELTNAVRIGDLELFRTVAEKFSSTFSS  338

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDSANP+ADAESIVSKAIRDG
Sbjct  339   DRTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSANPVADAESIVSKAIRDG  398

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  399   AIDATVDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  458

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  459   SAEKRRERQQQEQELAKHIAEEDDDDF  485



>ref|XP_006422568.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 ref|XP_006486715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Citrus sinensis]
 gb|ESR35808.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 gb|KDO68110.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=488

 Score =   488 bits (1256),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 253/267 (95%), Positives = 261/267 (98%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKFSSTFS 
Sbjct  282   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSSTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIVSKAIRDG
Sbjct  342   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>emb|CDO98056.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   486 bits (1250),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 252/267 (94%), Positives = 260/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  281   TKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRTVAEKFSSTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIV+KAIRDG
Sbjct  341   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALR+PPNS+KEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRYPPNSNKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_009773689.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana sylvestris]
Length=488

 Score =   485 bits (1248),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 253/267 (95%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQF RYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFSRYLFYLGKIRTIQLEYTDAKESLLQAARKAPQAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR+VAEKFSSTFS 
Sbjct  282   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRKVAEKFSSTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  342   DGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_009628272.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=488

 Score =   485 bits (1248),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 253/267 (95%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQF RYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFSRYLFYLGKIRTIQLEYTDAKESLLQAARKAPQAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR+VAEKFSSTFS 
Sbjct  282   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRKVAEKFSSTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  342   DGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDDF  488



>sp|P93768.1|PSMD3_TOBAC RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Nicotiana tabacum]
 dbj|BAA19252.1| 21D7 [Nicotiana tabacum]
Length=488

 Score =   484 bits (1247),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 253/267 (95%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQF RYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFSRYLFYLGKIRTIQLEYTDAKESLLQAARKAPQAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR+VAEKFSSTFS 
Sbjct  282   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRKVAEKFSSTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  342   DGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_004231054.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=487

 Score =   484 bits (1246),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 251/267 (94%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAP FEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPHFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPQAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKFSSTF  
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKNVAEKFSSTFGS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  341   DRTNNLIVRLRHNVIRTGLRNISISYSRISLTDVAKKLRLDSPNPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELA+HIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAQHIAEEDDDDF  487



>ref|XP_011088624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   484 bits (1246),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 251/267 (94%), Positives = 261/267 (98%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP +ALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVSALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKF++TFS 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKAVAEKFATTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIVSKAIRDG
Sbjct  342   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEE++D+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEEEDEF  488



>ref|XP_002279715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 ref|XP_010646732.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
Length=487

 Score =   483 bits (1243),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/267 (94%), Positives = 260/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP +ALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVSALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKFS+TFS 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSTTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDSANPIADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLDSANPIADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHN+AVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQFAFNSRIAFCLNMHNDAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_002521275.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF41131.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   483 bits (1242),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 250/267 (94%), Positives = 260/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARK+P AALGFRVQC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKSPVAALGFRVQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKFS+ FS 
Sbjct  285   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSTIFSA  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIV+KAIRDG
Sbjct  345   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  405   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  465   SAEKRRERQQQEQELAKHIAEEDDDEF  491



>ref|XP_009623855.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=491

 Score =   483 bits (1242),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 250/267 (94%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAP FEAHSNQQFCRYLFY GK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  225   EKLRSKAPHFEAHSNQQFCRYLFYHGKIRTIQLEYTDAKESLLQAARKAPLAALGFRVQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVR+GDLELFR+VA+KFSSTFS 
Sbjct  285   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRVGDLELFRKVADKFSSTFSS  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  345   DGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPVADAESIVSKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHK KE
Sbjct  405   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKGKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  465   SAEKRRERQQQEQELAKHIAEEDDDDF  491



>ref|XP_010107643.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
 gb|EXC16554.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
Length=487

 Score =   479 bits (1233),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/267 (93%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFS+TF+ 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFSNTFNS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDSANP+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLIDVAKKLRLDSANPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+HNEAVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQTAFDTRIAFCLNLHNEAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_004500920.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=488

 Score =   479 bits (1232),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/267 (93%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TFS 
Sbjct  282   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFSA  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NPIADAESIVSKAIRDG
Sbjct  342   DGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPIADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_012081815.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Jatropha curcas]
 gb|KDP29682.1| hypothetical protein JCGZ_18844 [Jatropha curcas]
Length=487

 Score =   479 bits (1232),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 248/267 (93%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELF+ VAEKFS+TFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMENALRPYFELTNAVRIGDLELFKSVAEKFSTTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS+NP+ADAESIV+KAIRDG
Sbjct  341   DRTYNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSSNPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQI FNSRIAFCLNMHNEAVRAL FPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQIEFNSRIAFCLNMHNEAVRALMFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_008447941.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
 ref|XP_008447942.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=481

 Score =   478 bits (1230),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 251/267 (94%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AAL FRVQC
Sbjct  215   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALRFRVQC  274

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  275   NKWAIIVRLLLGEIPERTVFMQKGMETALRPYFELTNAVRIGDLELFRTVAEKFSSTFSS  334

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NPIADAESIVSKA RDG
Sbjct  335   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPIADAESIVSKATRDG  394

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  N  MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  395   AIDATVDHGNKWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  454

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  455   SAEKRRERQQQEQELAKHIAEEDDDDF  481



>ref|XP_007136115.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
 gb|ESW08109.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
Length=487

 Score =   478 bits (1230),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 260/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEK+LRPYFELTNAVRIGDLELFR +A+KF++TF+ 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKSLRPYFELTNAVRIGDLELFRNIADKFATTFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+S+NPIADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSSNPIADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_010266036.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   478 bits (1230),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 242/268 (90%), Positives = 256/268 (96%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KALRPYFELTNAVRIGDLELFR VAEKF+ TFS 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMQKALRPYFELTNAVRIGDLELFRTVAEKFTDTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSTNPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPNSHK+++
Sbjct  401   AIDATVDHANGCMVSKETGDIYSTNEPQFAFNSRIAFCLNMHNEAVRALRFPPNSHKKEK  460

Query  376   saekr-rerqqqeqELAKHIAEEDDDDF  296
              + ++ RERQQQEQELAKHIAEEDDD+F
Sbjct  461   ESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_003527532.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   478 bits (1229),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 260/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TF+ 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+SA+P+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSASPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_009799469.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana sylvestris]
Length=491

 Score =   478 bits (1229),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 250/267 (94%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAP FEAHSNQQFCRYLFY GK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  225   EKLRSKAPHFEAHSNQQFCRYLFYHGKIRTIQLEYTDAKESLLQAARKAPLAALGFRVQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVR+GDLELFR+VA+KFSSTFS 
Sbjct  285   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRVGDLELFRKVADKFSSTFSS  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP ADAESIVSKAIRDG
Sbjct  345   DGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPFADAESIVSKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAV ALRFPPNSHKEKE
Sbjct  405   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVCALRFPPNSHKEKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  465   SAEKRRERQQQEQELAKHIAEEDDDDF  491



>ref|XP_003523322.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   477 bits (1228),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 247/267 (93%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TF+ 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+SANP+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSANPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQSAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>gb|EYU37968.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
 gb|EYU37969.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
Length=490

 Score =   477 bits (1228),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 249/267 (93%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAK+SLLQAARKAP +ALGFRVQC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKDSLLQAARKAPISALGFRVQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKF+STFS 
Sbjct  284   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFASTFSS  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T NLIVRLRHNVIRTGLRNISI+YS+ISL DVAKKLRLDS NPIADAESIVSKAIRDG
Sbjct  344   DGTKNLIVRLRHNVIRTGLRNISISYSKISLVDVAKKLRLDSPNPIADAESIVSKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  404   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  464   SAEKRRERQQQEQELAKHIAEEDDDEF  490



>ref|XP_003603813.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES74064.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=490

 Score =   477 bits (1227),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TFS 
Sbjct  284   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFSA  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  344   DGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPVADAESIVSKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  404   AIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  464   SAEKRRERQQQEQELAKHIAEEDDDDF  490



>gb|KEH36262.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=423

 Score =   474 bits (1220),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  157   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  216

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TFS 
Sbjct  217   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFSA  276

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  277   DGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPVADAESIVSKAIRDG  336

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  337   AIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  396

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  397   SAEKRRERQQQEQELAKHIAEEDDDDF  423



>tpg|DAA48734.1| TPA: hypothetical protein ZEAMMB73_878535 [Zea mays]
Length=298

 Score =   469 bits (1207),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  32    EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRIQC  91

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  92    NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRVGDLELFRTVADKFASTFSA  151

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  152   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  211

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  212   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  271

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  272   SAEKRRERLQQEEELAKHMAEEEDDDF  298



>gb|KHN09062.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   476 bits (1225),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TF+ 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+SA+P+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSASPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQSAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>gb|EYU22574.1| hypothetical protein MIMGU_mgv1a005362mg [Erythranthe guttata]
Length=487

 Score =   476 bits (1225),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 247/267 (93%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP +ALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPISALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKF++TFS 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFATTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T NLIVRLRHNVIRTGLRNISI+YS+ISL DVAKKLRLDS NPIADAESIVSKAIRDG
Sbjct  341   DGTKNLIVRLRHNVIRTGLRNISISYSKISLVDVAKKLRLDSPNPIADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG M+SKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHGNGWMLSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQ QEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQLQEQELAKHIAEEDDDEF  487



>gb|KEH36263.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=453

 Score =   474 bits (1221),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  187   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  246

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TFS 
Sbjct  247   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFSA  306

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  307   DGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPVADAESIVSKAIRDG  366

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  367   AIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  426

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  427   SAEKRRERQQQEQELAKHIAEEDDDDF  453



>gb|KHN45952.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   475 bits (1223),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KF++TF+ 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIADKFATTFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+SA+P+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSASPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQSAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_007200984.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
 gb|EMJ02183.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
Length=490

 Score =   475 bits (1222),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 244/267 (91%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +AEKFS+ FS 
Sbjct  284   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIAEKFSNIFSS  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  344   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVAKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD TNG MVSKETGDIYSTNEPQ AF++RIAFCLN+HN+AVRALRFPPNSHKEKE
Sbjct  404   AIDATLDHTNGWMVSKETGDIYSTNEPQAAFDTRIAFCLNLHNDAVRALRFPPNSHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  464   SAEKRRERQQQEQELAKHIAEEDDDEF  490



>ref|XP_010933362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   474 bits (1221),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/267 (91%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VAEKFS TF+ 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVAEKFSGTFNS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLDSQNPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DA +D  NGCMVSKETGD+YSTNEPQIAFNSRI FCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AVDAMIDHANGCMVSKETGDVYSTNEPQIAFNSRIVFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>dbj|BAG94867.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95111.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   471 bits (1212),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 240/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFRVQC
Sbjct  126   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRVQC  185

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLELFR VAEKF+STFS 
Sbjct  186   NKWAIIVRLLLGEIPERTVFMQKGMKAALAPYFELTNAVRVGDLELFRAVAEKFASTFSA  245

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  246   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  305

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  306   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  365

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  366   SAEKRRERLQQEEELAKHMAEEDDDDF  392



>ref|XP_010266868.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
 ref|XP_010266869.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   474 bits (1220),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 258/268 (96%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KALRPYFELTNAVRIGDLELFR VAEKF++TFS 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMKKALRPYFELTNAVRIGDLELFRTVAEKFANTFST  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD+ANP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDTANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+Y+TNEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSHK+++
Sbjct  401   AIDATVDHANGWMVSKETGDVYATNEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHKKEK  460

Query  376   saekr-rerqqqeqELAKHIAEEDDDDF  296
              + ++ RERQQQEQELAKHIAEEDDDDF
Sbjct  461   ESAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_006416422.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
 gb|ESQ34775.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
Length=488

 Score =   474 bits (1220),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKFS TFS+
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFSDTFSQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL+DVA+KLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLSDVAQKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>gb|KJB15844.1| hypothetical protein B456_002G199200 [Gossypium raimondii]
Length=430

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 257/267 (96%), Gaps = 3/267 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE LLQAARKAP AALGFRVQC
Sbjct  167   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKECLLQAARKAPVAALGFRVQC  226

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFS+TFS 
Sbjct  227   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFSTTFSS  286

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRI+LADVAKKLRLDS   +ADAESIV+KAIRDG
Sbjct  287   DRTHNLIVRLRHNVIRTGLRNISISYSRIALADVAKKLRLDS---VADAESIVAKAIRDG  343

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD +NGCM+SKETGDIYST EPQ AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  344   AIDATLDHSNGCMLSKETGDIYSTTEPQTAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  403

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  404   SAEKRRERQQQEQELAKHIAEEDDDEF  430



>ref|XP_007041788.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 ref|XP_007041789.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97619.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97620.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=484

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/267 (93%), Positives = 257/267 (96%), Gaps = 3/267 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE LLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKECLLQAARKAPVAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQ+GMEKALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQEGMEKALRPYFELTNAVRIGDLELFRTVAEKFSSTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS   +ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDS---VADAESIVAKAIRDG  397

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NGCM+SKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  398   AIDATLDHANGCMLSKETGDIYSTNEPQMAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  457

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  458   SAEKRRERQQQEQELAKHIAEEDDDEF  484



>ref|XP_003545019.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
 gb|KHN39404.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/267 (91%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAPSAA GFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPSAAQGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQ+GMEKALRPYFELTNAVRIGDLELFR VAEKF +TF++
Sbjct  284   NKWAVIVRLLLGEIPERTVFMQRGMEKALRPYFELTNAVRIGDLELFRNVAEKFGTTFNR  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+SA+P+ADAESIV+KAIRDG
Sbjct  344   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLNSASPVADAESIVAKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDA+LD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+ KEKE
Sbjct  404   AIDASLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTQKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQEQELAKHIAEEDDDDF
Sbjct  464   SAEKRRERHQQEQELAKHIAEEDDDDF  490



>ref|XP_007017882.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOY15107.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=487

 Score =   473 bits (1218),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 243/267 (91%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERT+FMQKGMEKALRPYFELTNAVRIGDLELFR VAEKF+STFS 
Sbjct  281   NKWAILVRLLLGEIPERTMFMQKGMEKALRPYFELTNAVRIGDLELFRTVAEKFASTFST  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL+S  P+ADAESIV+KAIRDG
Sbjct  341   DKTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLNSKTPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAF+SRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQIAFHSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_010229049.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=490

 Score =   473 bits (1217),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTAARGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VA+KF+STFS 
Sbjct  284   NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVADKFASTFSA  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAE IVSKAIRDG
Sbjct  344   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSQNPVADAECIVSKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQ+AFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  404   AIDATIDHANGWMVSKETGDVYSTNEPQVAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  464   SAEKRRERLQQEEELAKHMAEEDDDDF  490



>emb|CDX87648.1| BnaA07g32250D [Brassica napus]
Length=482

 Score =   473 bits (1216),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  216   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  275

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++FMQKGMEKALRPYFELTNAVRIGDLELFR V EKFS TFS+
Sbjct  276   NKWAILVRLLLGEIPERSIFMQKGMEKALRPYFELTNAVRIGDLELFRNVQEKFSKTFSE  335

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  336   DRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLNSANPVADAESIVAKAIRDG  395

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H+EKE
Sbjct  396   AIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNMHNEAVRALRFPPNTHREKE  455

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  456   SEEKRREMKQQEEELAKYMAEEDDDDF  482



>gb|KJB15843.1| hypothetical protein B456_002G199200 [Gossypium raimondii]
Length=484

 Score =   473 bits (1216),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 246/267 (92%), Positives = 257/267 (96%), Gaps = 3/267 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE LLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKECLLQAARKAPVAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFS+TFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFSTTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRI+LADVAKKLRLDS   +ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRIALADVAKKLRLDS---VADAESIVAKAIRDG  397

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD +NGCM+SKETGDIYST EPQ AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  398   AIDATLDHSNGCMLSKETGDIYSTTEPQTAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  457

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  458   SAEKRRERQQQEQELAKHIAEEDDDEF  484



>ref|NP_001063817.1| Os09g0541900 [Oryza sativa Japonica Group]
 dbj|BAB82474.1| 21D7 [Oryza sativa Japonica Group]
 dbj|BAC79193.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Oryza 
sativa Japonica Group]
 dbj|BAD46593.1| putative nuclear antigen 21D7 [Oryza sativa Japonica Group]
 dbj|BAF25731.1| Os09g0541900 [Oryza sativa Japonica Group]
 gb|EAZ45527.1| hypothetical protein OsJ_30188 [Oryza sativa Japonica Group]
Length=487

 Score =   473 bits (1216),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 240/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLELFR VAEKF+STFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMKAALAPYFELTNAVRVGDLELFRAVAEKFASTFSA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  341   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  401   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  461   SAEKRRERLQQEEELAKHMAEEDDDDF  487



>ref|XP_004144854.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis sativus]
 gb|KGN43263.1| hypothetical protein Csa_7G014490 [Cucumis sativus]
Length=481

 Score =   472 bits (1215),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 249/267 (93%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AAL FRVQC
Sbjct  215   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALRFRVQC  274

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  275   NKWAIIVRLLLGEIPERTVFMQKGMETALRPYFELTNAVRIGDLELFRTVAEKFSSTFSS  334

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS N IADAESIVSKA RDG
Sbjct  335   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSENLIADAESIVSKATRDG  394

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  N  MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  395   AIDATVDHGNRWMVSKETGDIYSTNEPQFAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  454

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAE RRERQQQEQELAKHIAEEDDDDF
Sbjct  455   SAETRRERQQQEQELAKHIAEEDDDDF  481



>gb|EAZ09931.1| hypothetical protein OsI_32229 [Oryza sativa Indica Group]
Length=487

 Score =   472 bits (1215),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 240/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLELFR VAEKF+STFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMKAALAPYFELTNAVRVGDLELFRAVAEKFASTFSA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  341   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  401   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  461   SAEKRRERLQQEEELAKHMAEEDDDDF  487



>ref|XP_009106250.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Brassica rapa]
Length=491

 Score =   473 bits (1216),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++FMQKGMEKALRPYFELTNAVRIGDLELFR V EKFS TFS+
Sbjct  285   NKWAILVRLLLGEIPERSIFMQKGMEKALRPYFELTNAVRIGDLELFRNVQEKFSKTFSE  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  345   DRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLNSANPVADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H+EKE
Sbjct  405   AIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNMHNEAVRALRFPPNTHREKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  465   SEEKRREMKQQEEELAKYMAEEDDDDF  491



>ref|XP_004974153.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=491

 Score =   472 bits (1215),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP++A GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTSARGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  285   NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRVGDLELFRAVADKFASTFSA  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  345   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  405   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  465   SAEKRRERLQQEEELAKHMAEEDDDDF  491



>ref|XP_008236045.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Prunus mume]
Length=490

 Score =   472 bits (1214),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/267 (91%), Positives = 258/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +AEKF++ F+ 
Sbjct  284   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRNIAEKFANIFNS  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  344   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVAKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD TNG MVSKETGDIYSTNEPQ AF++RIAFCLN+HN+AVRALRFPPNSHKEKE
Sbjct  404   AIDATLDHTNGWMVSKETGDIYSTNEPQAAFDTRIAFCLNLHNDAVRALRFPPNSHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  464   SAEKRRERQQQEQELAKHIAEEDDDEF  490



>ref|XP_010920092.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   472 bits (1214),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/267 (91%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAP+FEAHSNQQFCRYLFYLG++RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  222   EKLRSKAPQFEAHSNQQFCRYLFYLGRIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VAEKFS TF+ 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVAEKFSGTFNS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  342   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLDSQNPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D +NG MVSKETGDIYSTNEPQIAFNSRI FCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATIDHSNGWMVSKETGDIYSTNEPQIAFNSRIVFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEK RERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKMRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_004957510.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=489

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  223   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTAQGFRIQC  282

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVR+GDLELFR VA+KFSSTFS 
Sbjct  283   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRVGDLELFRSVADKFSSTFSA  342

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  343   DRTCNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  402

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  403   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  462

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  463   SAEKRRERLQQEEELAKHMAEEDDDDF  489



>ref|XP_004145004.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis sativus]
 gb|KGN46247.1| hypothetical protein Csa_6G077440 [Cucumis sativus]
Length=485

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 248/267 (93%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFE HSNQQFCRYLFYLGK+RTIQLEYTDAK SLLQAA KAP AALGFRVQC
Sbjct  219   EKLRSKAPRFEGHSNQQFCRYLFYLGKIRTIQLEYTDAKGSLLQAAGKAPIAALGFRVQC  278

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQK MEKALRPYFELTNAVRIGDLELF+ VAE+FSSTFS 
Sbjct  279   NKWAIIVRLLLGEIPERTVFMQKHMEKALRPYFELTNAVRIGDLELFKIVAERFSSTFSS  338

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDSANPIADAESIVSKAIRDG
Sbjct  339   DRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLDSANPIADAESIVSKAIRDG  398

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLN HNEAVRALRFPPNSHKEKE
Sbjct  399   AIDATVDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNTHNEAVRALRFPPNSHKEKE  458

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  459   SAEKRRERQQQEQELAKHIAEEDDDDF  485



>sp|Q06364.2|PSMD3_DAUCA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Daucus carota]
Length=489

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/267 (91%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKES LQAARKAP AALGFRVQC
Sbjct  223   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESXLQAARKAPVAALGFRVQC  282

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYF LTNAVRIGDLELFR VA+KF+STF+ 
Sbjct  283   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFXLTNAVRIGDLELFRXVADKFASTFTA  342

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRLDS NP+ADAESIVSKAIRDG
Sbjct  343   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVARKLRLDSPNPVADAESIVSKAIRDG  402

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFP NSHK+KE
Sbjct  403   AIDATIDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRALRFPANSHKDKE  462

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  463   SAEKRRERQQQEQELAKHIAEEDDDEF  489



>ref|XP_002444618.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
 gb|EES14113.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
Length=496

 Score =   471 bits (1213),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  230   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRIQC  289

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  290   NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRVGDLELFRAVADKFASTFSA  349

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NPIADAESIV+KAIRDG
Sbjct  350   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPIADAESIVAKAIRDG  409

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  410   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  469

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  470   SAEKRRERLQQEEELAKHMAEEDDDDF  496



>gb|KHG18147.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=484

 Score =   471 bits (1212),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 245/267 (92%), Positives = 256/267 (96%), Gaps = 3/267 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE LLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKECLLQAARKAPVAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFS+TFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFSTTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRI+LADV KKLRLDS   +ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRIALADVGKKLRLDS---VADAESIVAKAIRDG  397

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD +NGCM+SKETGDIYST EPQ AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  398   AIDATLDHSNGCMLSKETGDIYSTTEPQTAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  457

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  458   SAEKRRERQQQEQELAKHIAEEDDDEF  484



>emb|CDX73215.1| BnaC06g36630D [Brassica napus]
Length=491

 Score =   471 bits (1212),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRVQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++FMQKGMEKALRPYFELTNAVRIGDLELFR V EKF+ TFS+
Sbjct  285   NKWAILVRLLLGEIPERSIFMQKGMEKALRPYFELTNAVRIGDLELFRNVQEKFAKTFSE  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  345   DRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLNSANPVADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H+EKE
Sbjct  405   AIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNMHNEAVRALRFPPNTHREKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  465   SEEKRREMKQQEEELAKYMAEEDDDDF  491



>gb|KFK42036.1| hypothetical protein AALP_AA2G203500 [Arabis alpina]
Length=488

 Score =   471 bits (1211),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 234/267 (88%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEKAL+PYF+LTNAVRIGDLELFR V E+F+ TFS+
Sbjct  282   NKWAIIVRLLLGEIPERSIFTQKGMEKALKPYFDLTNAVRIGDLELFRNVQERFAKTFSE  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLNSANPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  462   SDEKRREKKQQEEELAKYMAEEDDDDF  488



>ref|NP_173447.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
 sp|Q9LNU4.3|PSD3A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog A; AltName: Full=26S proteasome regulatory subunit RPN3a; 
Short=AtRPN3a; AltName: Full=26S proteasome regulatory 
subunit S3 homolog A; AltName: Full=Protein EMBRYO DEFECTIVE 
2719; AltName: Full=Protein HAPLESS 15 [Arabidopsis thaliana]
 gb|AAP86658.1| 26S proteasome subunit RPN3a [Arabidopsis thaliana]
 gb|AEE29950.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
Length=488

 Score =   471 bits (1211),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_006660915.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=392

 Score =   467 bits (1201),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  126   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRIQC  185

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLELFR VAEKF STFS 
Sbjct  186   NKWAIIVRLLLGEIPERTVFMQKGMKAALAPYFELTNAVRVGDLELFRAVAEKFVSTFSA  245

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  246   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDG  305

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG M SKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  306   AIDATIDHANGWMASKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  365

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  366   SAEKRRERLQQEEELAKHMAEEDDDDF  392



>gb|AAM53298.1| putative proteasome regulatory subunit S3 [Arabidopsis thaliana]
Length=488

 Score =   470 bits (1210),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010459703.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   470 bits (1210),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISIAYSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISIAYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCM+SKETGDIYSTNEPQ AFNSRIAFCLNMHNEA+RALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGCMISKETGDIYSTNEPQTAFNSRIAFCLNMHNEAIRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010063310.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Eucalyptus grandis]
 gb|KCW70517.1| hypothetical protein EUGRSUZ_F03722 [Eucalyptus grandis]
Length=487

 Score =   470 bits (1210),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 241/267 (90%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE+L QAARKAP +A GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKEALQQAARKAPISARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKW+V+VRLLLGEIPERT+FMQKGMEKALRPYFELTNAVRIGDLELFR VAEKF++TF+ 
Sbjct  281   NKWSVLVRLLLGEIPERTIFMQKGMEKALRPYFELTNAVRIGDLELFRTVAEKFATTFNT  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIVSKAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLEDVAKKLRLDSPNPVADAESIVSKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  N CMVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATLDHANRCMVSKETGDIYSTNEPQMAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEEDDDF  487



>gb|ACG34075.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   470 bits (1210),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  226   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRIQC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  286   NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRVGDLELFRTVADKFASTFSA  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  346   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  405

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  406   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  465

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  466   SAEKRRERLQQEEELAKHMAEEEDDDF  492



>gb|ACF84535.1| unknown [Zea mays]
 gb|ACN28040.1| unknown [Zea mays]
 tpg|DAA48733.1| TPA: 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   470 bits (1210),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  226   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRIQC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  286   NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRVGDLELFRTVADKFASTFSA  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  346   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  405

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  406   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  465

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  466   SAEKRRERLQQEEELAKHMAEEEDDDF  492



>ref|XP_008382101.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Malus domestica]
Length=487

 Score =   470 bits (1209),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 241/267 (90%), Positives = 257/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ +AEKFS+ F+ 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKNIAEKFSNVFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+HN+AVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQAAFDTRIAFCLNLHNDAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_009355646.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Pyrus x bretschneideri]
Length=487

 Score =   469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 241/267 (90%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ +AEKFS  F+ 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKNIAEKFSDVFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+HN+AVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQAAFDTRIAFCLNLHNDAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDEF  487



>dbj|BAG87837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   466 bits (1198),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  126   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITARGFRIQC  185

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF STFS 
Sbjct  186   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFVSTFSA  245

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  246   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDG  305

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  306   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  365

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  366   SAEKRRERLQQEEELAKHMAEEDDDDF  392



>ref|XP_002889051.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65310.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   468 bits (1205),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 234/267 (88%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELF  V EKF+ TF+K
Sbjct  281   NKWAIIVRLLLGEIPERSIFTQKGMEKPLRPYFELTNAVRIGDLELFGNVQEKFAETFAK  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLNSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  461   SDEKRREKKQQEEELAKYMAEEDDDDF  487



>gb|EEE69116.1| hypothetical protein OsJ_28197 [Oryza sativa Japonica Group]
Length=467

 Score =   467 bits (1202),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  201   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITARGFRIQC  260

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF STFS 
Sbjct  261   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFVSTFSA  320

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  321   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDG  380

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  381   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  440

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  441   SAEKRRERLQQEEELAKHMAEEDDDDF  467



>dbj|BAB78499.1| 26S proteasome regulatory particle non-ATPase subunit3 [Oryza 
sativa Japonica Group]
Length=419

 Score =   465 bits (1197),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  153   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITARGFRIQC  212

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF STFS 
Sbjct  213   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFVSTFSA  272

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  273   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDG  332

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  333   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  392

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  393   SAEKRRERLQQEEELAKHMAEEDDDDF  419



>ref|XP_006660365.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=486

 Score =   468 bits (1204),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP +A GFR+QC
Sbjct  220   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPISARGFRIQC  279

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF+STFS 
Sbjct  280   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFASTFSA  339

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  340   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  399

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  400   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  459

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEED+DDF
Sbjct  460   SAEKRRERLQQEEELAKHMAEEDEDDF  486



>gb|ACN28097.1| unknown [Zea mays]
 gb|AFW65684.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   468 bits (1204),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITACGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  285   NKWAIIVRLLLGEIPERTVFMQKGMKKALIPYFELTNAVRVGDLELFRAVADKFASTFSA  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NPIADAESIV+KAIRDG
Sbjct  345   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPIADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  405   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AE+DDDDF
Sbjct  465   SAEKRRERLQQEEELAKHMAEDDDDDF  491



>ref|XP_004290733.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Fragaria vesca subsp. vesca]
Length=488

 Score =   468 bits (1203),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 241/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR +A+KFS+ FS 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRTIADKFSTVFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS  P+ DAESIV+KAIRDG
Sbjct  342   DGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPTPVDDAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+HN+AVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHANGYMVSKETGDIYSTNEPQAAFDTRIAFCLNLHNDAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|NP_001149170.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
 gb|ACG34451.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   468 bits (1203),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITACGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  285   NKWAIIVRLLLGEIPERTVFMQKGMKKALIPYFELTNAVRVGDLELFRAVADKFASTFSA  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NPIADAESIV+KAIRDG
Sbjct  345   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPIADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  405   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AE+DDDDF
Sbjct  465   SAEKRRERLQQEEELAKHMAEDDDDDF  491



>gb|AAF79894.1|AC022472_3 Contains similarity to 26s proteasome regulatory subunit S3 from 
Nicotiana tabacum gi|3914467 and contains a PCI PF|01399 
domain. ESTs gb|AV527569, gb|T75824, gb|T88578, gb|F15139, 
gb|AV520993, gb|AV440056, gb|AI099602, gb|F15138 come from this 
gene [Arabidopsis thaliana]
Length=519

 Score =   469 bits (1206),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  253   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  312

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  313   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  372

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  373   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  432

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  433   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  492

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  493   SDEKRRERKQQEEELAKHMAEEDDDDF  519



>ref|XP_010935159.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=493

 Score =   468 bits (1204),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 240/267 (90%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  227   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVGARGFRIQC  286

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VAEKF+ TFS 
Sbjct  287   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVAEKFAGTFSS  346

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  347   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLDSDNPVADAESIVAKAIRDG  406

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG M+SKETGD+YSTNEPQIAFNSRIAFCLNMHNEAVRAL+FPPNSH+EKE
Sbjct  407   AIDATIDHANGWMLSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVRALKFPPNSHREKE  466

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRERQQQEQELAKHIAEEDDD+F
Sbjct  467   SEEKRRERQQQEQELAKHIAEEDDDEF  493



>ref|XP_010498455.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A-like [Camelina sativa]
Length=488

 Score =   468 bits (1203),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDA +D  NGCM+SKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDAIIDHKNGCMISKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010536429.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Tarenaya hassleriana]
Length=487

 Score =   468 bits (1203),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 235/267 (88%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAV+VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V E+F+ TF+K
Sbjct  281   NKWAVLVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQERFTETFAK  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+SANP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLEDVAKKLRLNSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  N  MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATIDHKNNWMVSKETGDIYSTNEPQMAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AE+DDDDF
Sbjct  461   SDEKRRERKQQEEELAKHMAEDDDDDF  487



>ref|XP_006307354.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
 gb|EOA40252.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
Length=488

 Score =   467 bits (1202),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TFS+
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFSQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010477252.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   467 bits (1202),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFRVQC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRVQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISIAYSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISIAYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG M+SKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  402   AIDATIDHKNGWMISKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|NP_001149380.1| LOC100283005 [Zea mays]
 gb|ACG35233.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   467 bits (1202),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYT AKESLLQAARKAP+ A GFR+QC
Sbjct  226   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTGAKESLLQAARKAPTTARGFRIQC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVR+GDLELFR VA+KF+STFS 
Sbjct  286   NKWAIIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRVGDLELFRTVADKFASTFSA  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  346   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDG  405

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  406   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  465

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  466   SAEKRRERLQQEEELAKHMAEEEDDDF  492



>ref|NP_001062444.1| Os08g0550100 [Oryza sativa Japonica Group]
 dbj|BAD08959.1| putative 21D7 [Oryza sativa Japonica Group]
 dbj|BAF24358.1| Os08g0550100 [Oryza sativa Japonica Group]
Length=486

 Score =   467 bits (1201),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  220   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITARGFRIQC  279

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF STFS 
Sbjct  280   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFVSTFSA  339

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  340   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDG  399

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  400   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  459

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  460   SAEKRRERLQQEEELAKHMAEEDDDDF  486



>ref|NP_177726.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
 sp|Q9LQR8.2|PSD3B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog B; AltName: Full=26S proteasome regulatory subunit RPN3b; 
Short=AtRPN3b; AltName: Full=26S proteasome regulatory 
subunit S3 homolog B [Arabidopsis thaliana]
 gb|AAL09749.1| At1g75990/T4O12_21 [Arabidopsis thaliana]
 gb|AAU90061.1| At1g75990 [Arabidopsis thaliana]
 gb|AEE35783.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
Length=487

 Score =   467 bits (1201),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/267 (87%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELF ++ EKF+ TF++
Sbjct  281   NKWAIIVRLLLGEIPERSIFTQKGMEKTLRPYFELTNAVRIGDLELFGKIQEKFAKTFAE  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLNSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H+EKE
Sbjct  401   AIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHREKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  461   SEEKRREMKQQEEELAKYMAEEDDDDF  487



>ref|XP_008811676.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=495

 Score =   466 bits (1200),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+ A GFR+QC
Sbjct  229   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAGAWGFRIQC  288

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPE+TVFMQKGM+KAL PYFELTNAVRIGDLELFR VAEKF+ TFS 
Sbjct  289   NKWAVIVRLLLGEIPEKTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVAEKFAGTFSS  348

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRTNNLIVRLRHNVIRTGLRNISI+YSR+SL+D+A+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  349   DRTNNLIVRLRHNVIRTGLRNISISYSRVSLSDIARKLRLDSDNPVADAESIVAKAIRDG  408

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHN+AVRALRFPPNSHKEKE
Sbjct  409   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNDAVRALRFPPNSHKEKE  468

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHI E+DDD+F
Sbjct  469   SAEKRRERQQQEQELAKHIEEDDDDEF  495



>ref|XP_011045871.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=486

 Score =   466 bits (1199),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 252/267 (94%), Positives = 261/267 (98%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AAL FRVQC
Sbjct  220   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAALAFRVQC  279

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELF+ VAEKFSSTFS 
Sbjct  280   NKWAVIVRLLLGEIPERTVFMQKGMENALRPYFELTNAVRIGDLELFKSVAEKFSSTFST  339

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIV+KAIRDG
Sbjct  340   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVAKAIRDG  399

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLDR NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  400   AIDATLDRANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  459

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  460   SAEKRRERQQQEQELAKHIAEEDDDEF  486



>ref|XP_009401896.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   466 bits (1199),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GF++QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVVARGFQIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELF+ VA+KFS TFS 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFKIVADKFSGTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISIAYSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISIAYSRISLADVARKLRLDSPNPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D +NG +VSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNS+KEKE
Sbjct  401   AIDATIDHSNGWVVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSNKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S E RRERQQQEQELAKHIAEEDDDDF
Sbjct  461   SEETRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_006390248.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
 dbj|BAJ34390.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27534.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
Length=488

 Score =   465 bits (1196),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYL+YLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLYYLGKIRTIQLEYTDAKESLLQAARKAPVAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELFR V E+F+ TFS+
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKPLRPYFELTNAVRIGDLELFRNVQERFAKTFSE  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  N CMVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+H+EKE
Sbjct  402   AIDATIDHKNSCMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHREKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  462   SDEKRREKKQQEEELAKYMAEEDDDDF  488



>ref|XP_003578544.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=497

 Score =   465 bits (1196),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 235/267 (88%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  231   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTAARGFRIQC  290

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLELFR VAEKF+STFS 
Sbjct  291   NKWAIIVRLLLGEIPERTVFMQKGMKAALTPYFELTNAVRVGDLELFRAVAEKFASTFSA  350

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL D+AKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  351   DRTSNLIVRLRHNVIRTGLRNISISYSRISLVDIAKKLRLDSENPVADAESIVAKAIRDG  410

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DA +D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  411   AVDAIIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  470

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  471   SAEKRRERLQQEEELAKHMAEEDDDDF  497



>ref|XP_008377724.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase 
regulatory subunit 3 [Malus domestica]
Length=487

 Score =   464 bits (1194),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDL LF+ +AEKFS+ F+ 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLXLFKNIAEKFSNVFNA  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS NP+ADAESIV+KAIRD 
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVAKAIRDX  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+HN+AVRALRFPPNSHKEKE
Sbjct  401   AIDATLDHANGWMVSKETGDIYSTNEPQAAFDTRIAFCLNLHNDAVRALRFPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  461   SAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_002893093.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69352.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
Length=488

 Score =   463 bits (1191),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 234/267 (88%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TFS+
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFSQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+S NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKE GDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKE E
Sbjct  402   AIDATIDHKNGWMVSKEIGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKETE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRER+QQE+ELAKH+AEE+DDDF
Sbjct  462   SDEKRRERKQQEEELAKHMAEEEDDDF  488



>gb|KJB47689.1| hypothetical protein B456_008G037000 [Gossypium raimondii]
Length=484

 Score =   462 bits (1189),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 242/267 (91%), Positives = 252/267 (94%), Gaps = 3/267 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE LLQAARKAP AALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKECLLQAARKAPIAALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFSSTFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFSSTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLDS   +ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDS---VADAESIVAKAIRDG  397

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  + CM+SKETGDIYS  EPQ  FNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  398   AIDATLDHASRCMLSKETGDIYSMTEPQTVFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  457

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER+QQEQELAKHIAEEDDD+F
Sbjct  458   SAEKRRERRQQEQELAKHIAEEDDDEF  484



>ref|XP_002312950.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86905.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=485

 Score =   462 bits (1189),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 245/270 (91%), Positives = 256/270 (95%), Gaps = 7/270 (3%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKE---SLLQAARKAPSAALGFR  926
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKE   +LL +     +AAL FR
Sbjct  220   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKEFCTTLLPSV----AAALAFR  275

Query  925   VQCNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSST  746
             VQCNKWAVIVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELF+ VAEKFSST
Sbjct  276   VQCNKWAVIVRLLLGEIPERTVFMQKGMESALRPYFELTNAVRIGDLELFKSVAEKFSST  335

Query  745   FSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAI  566
             FSKDRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+ADAESIV+KAI
Sbjct  336   FSKDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVADAESIVAKAI  395

Query  565   RDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHk  386
             RDGAIDATLDR NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPNSHK
Sbjct  396   RDGAIDATLDRANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNSHK  455

Query  385   ekesaekrrerqqqeqELAKHIAEEDDDDF  296
             EKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  456   EKESAEKRRERQQQEQELAKHIAEEDDDEF  485



>ref|XP_010416506.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Camelina sativa]
Length=487

 Score =   462 bits (1188),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 232/267 (87%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIASLGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELF  V EKF+ TF+ 
Sbjct  281   NKWAIIVRLLLGEIPERSIFTQKGMEKPLRPYFELTNAVRIGDLELFGNVQEKFAKTFAN  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLNSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  461   SDEKRREKKQQEEELAKYMAEEDDDDF  487



>ref|XP_002306189.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86700.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=488

 Score =   462 bits (1188),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 249/267 (93%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AALGFRV C
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAALGFRVLC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELF+ +AEKFSSTF+ 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMENALRPYFELTNAVRIGDLELFKSIAEKFSSTFNA  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+A+AESIV+KAIRDG
Sbjct  342   DRTLNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVAEAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_002510590.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF52777.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   461 bits (1187),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLG +RTIQLEYT+AKESLLQA+RKAP AA GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGNIRTIQLEYTNAKESLLQASRKAPVAARGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERT FMQKGME+ALRPYFELTNAV IGDLELFR VAEKF+ TF+ 
Sbjct  285   NKWAILVRLLLGEIPERTTFMQKGMERALRPYFELTNAVWIGDLELFRTVAEKFAETFNT  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YS ISLADVAKKLRLDSA+P+ADAESIV+KAIRDG
Sbjct  345   DRTHNLIVRLRHNVIRTGLRNISISYSCISLADVAKKLRLDSASPVADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  405   AIDATLDHVNGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  465   SAEKRRERQQQEQELAKHIAEEEDDDF  491



>ref|XP_008809439.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=488

 Score =   461 bits (1186),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 238/267 (89%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQF RYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFSRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQ+GM+KAL PYFELTNAV+IGDLELFR VA+KFS TF+ 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQEGMKKALTPYFELTNAVQIGDLELFRTVADKFSGTFNS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLDSQNPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DA +D  NG MVSKETGD+YSTNEPQIAFNSRI FCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AVDAIIDHANGWMVSKETGDVYSTNEPQIAFNSRIVFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_010666922.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   460 bits (1183),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAP F AHSNQQ CR+LFY+GK++TIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPSFGAHSNQQHCRHLFYIGKIQTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERT+FMQKGMEKALRPYFELTNAVRIGDLELFR V EKFSSTF K
Sbjct  281   NKWAVIVRLLLGEIPERTMFMQKGMEKALRPYFELTNAVRIGDLELFRGVTEKFSSTFDK  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDS NP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSPNPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG M+SKETGDIYST EPQ AF+SRIAFCLNMHNEAVRALR+PPNSHKEKE
Sbjct  401   AIDATLDHANGWMLSKETGDIYSTTEPQSAFDSRIAFCLNMHNEAVRALRYPPNSHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEEDDDF  487



>ref|XP_006302193.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
 gb|EOA35091.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
Length=487

 Score =   460 bits (1183),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 232/267 (87%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIASLGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELF  V EKF+ TF+ 
Sbjct  281   NKWAIIVRLLLGEIPERSIFTQKGMEKLLRPYFELTNAVRIGDLELFGNVQEKFAKTFAI  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+SANP+ADAESIV+KAIRDG
Sbjct  341   DRTQNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLNSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  461   SDEKRREKKQQEEELAKYMAEEDDDDF  487



>ref|XP_008806135.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=497

 Score =   459 bits (1182),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFY+GK+RTIQLEYTDAKESLLQAARKAP  A GFR+QC
Sbjct  232   EKLRSKAPRFEAHSNQQFCRYLFYVGKIRTIQLEYTDAKESLLQAARKAPVGARGFRIQC  291

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VAEKF+ TFS 
Sbjct  292   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVAEKFAGTFSS  351

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRN+SI+YS ISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  352   DRTRNLIVRLRHNVIRTGLRNVSISYSSISLADVARKLRLDSDNPVADAESIVAKAIRDG  411

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG M+SKETGD+YSTNEPQIAFNSRIAFCLNMHNEAVRAL+FPPNSH+EKE
Sbjct  412   AIDATIDHANGWMLSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVRALKFPPNSHREKE  471

Query  376   saekrrerqqqeqELAKHIAEEDDD  302
             SAEKRRERQQQ+QELAKHIAEEDD+
Sbjct  472   SAEKRRERQQQQQELAKHIAEEDDE  496



>ref|XP_011046661.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=488

 Score =   459 bits (1181),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/267 (93%), Positives = 259/267 (97%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAK+SLLQAARKAP+AALGFRV C
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKDSLLQAARKAPAAALGFRVLC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGME ALRPYFELTNAVRIGDLELF+ VAEKFSSTF+ 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMENALRPYFELTNAVRIGDLELFKSVAEKFSSTFNA  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLDSANP+A+AESIV+KAIRDG
Sbjct  342   DRTLNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLDSANPVAEAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  402   AIDATVDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_009413027.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413028.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413029.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   459 bits (1181),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYL YLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLLYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VA+K+S TFS 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRTVADKYSGTFSS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  342   DRTRNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLDSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNS+KEKE
Sbjct  402   AIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSNKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDD  302
             S EKRRERQQQEQELAKHIAEEDDD
Sbjct  462   SEEKRRERQQQEQELAKHIAEEDDD  486



>ref|XP_007160631.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
 gb|ESW32625.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
Length=490

 Score =   459 bits (1181),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/267 (87%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLG++RTIQLEYTDAKESLLQAARKAPSAA GFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGRIRTIQLEYTDAKESLLQAARKAPSAARGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGE+PER VFMQ+GMEKALRPYFELTNAVRIGDL+LF+ VAEKF +TF++
Sbjct  284   NKWAVIVRLLLGEVPERNVFMQRGMEKALRPYFELTNAVRIGDLDLFKNVAEKFGTTFNR  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T+NLIVRLRHNVIRTGLRNISI+YSRIS+ADVAKKLRL+SANP+ADAESIV+KAIRDG
Sbjct  344   DGTHNLIVRLRHNVIRTGLRNISISYSRISVADVAKKLRLNSANPVADAESIVAKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DA+LD  +G M SKETGDIYSTNEPQ+AFNSRI+FCLNMHNEAV ALRFPPN+HKEKE
Sbjct  404   AVDASLDHADGWMGSKETGDIYSTNEPQVAFNSRISFCLNMHNEAVLALRFPPNTHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQEQELAKHI EEDDDDF
Sbjct  464   SAEKRRERHQQEQELAKHIEEEDDDDF  490



>ref|XP_010428646.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   458 bits (1179),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 231/267 (87%), Positives = 251/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIASLGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELF  V EKF+ TF+ 
Sbjct  281   NKWAIIVRLLLGEIPERSIFTQKGMEKPLRPYFELTNAVRIGDLELFGNVQEKFAKTFAN  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA KLRL+SANP+ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVALKLRLNSANPVADAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDD 
Sbjct  461   SDEKRREKKQQEEELAKYMAEEDDDDL  487



>gb|EPS67790.1| hypothetical protein M569_06981, partial [Genlisea aurea]
Length=487

 Score =   458 bits (1179),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 237/264 (90%), Positives = 248/264 (94%), Gaps = 0/264 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQ+ RKAP +ALGFRVQC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQSVRKAPVSALGFRVQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KWAVIVRLLLGEIPERTVFMQKGMEK LRPYFELTNAVRIGDLELF+ VAEKFSS+F  
Sbjct  284   TKWAVIVRLLLGEIPERTVFMQKGMEKPLRPYFELTNAVRIGDLELFKAVAEKFSSSFGS  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T NLIVRLRHNVIRTGLRNISI+YSRISLAD+A+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  344   DGTKNLIVRLRHNVIRTGLRNISISYSRISLADIARKLRLDSGNPVADAESIVAKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD   G M SKETGDIYSTNEPQ AFNSRI+FCLNMHNEAVRALRFPPNSHKEKE
Sbjct  404   AIDATLDHGKGWMTSKETGDIYSTNEPQTAFNSRISFCLNMHNEAVRALRFPPNSHKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDD  305
             SAEKRRERQQQEQELAKHIAEEDD
Sbjct  464   SAEKRRERQQQEQELAKHIAEEDD  487



>gb|EMT22108.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score =   458 bits (1179),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 232/267 (87%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  230   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTAARGFRIQC  289

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLE+FR VAEKF STFS 
Sbjct  290   NKWAILVRLLLGEIPERTVFMQKGMKAALTPYFELTNAVRVGDLEVFRAVAEKFGSTFSA  349

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+   +ADAESIV+KAIRDG
Sbjct  350   DRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTKTAVADAESIVAKAIRDG  409

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  410   AIDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  469

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  470   SAEKRRERLQQEEELAKHMAEEEDDDF  496



>ref|XP_009382040.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009382041.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   457 bits (1176),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 239/267 (90%), Positives = 254/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGM+KAL PYFELTNAVRIGDLELFR VA+KFS TF+ 
Sbjct  282   NKWAVIVRLLLGEIPERTVFMQKGMKKALTPYFELTNAVRIGDLELFRIVADKFSGTFNS  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLDS NP+ADAESIV+KAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLDSENPVADAESIVAKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DA +D  NG MVSKETG++YSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNS+KEKE
Sbjct  402   AVDAIIDHANGWMVSKETGNVYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSNKEKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRERQQQEQELAKHIAEEDD DF
Sbjct  462   SEEKRRERQQQEQELAKHIAEEDDGDF  488



>dbj|BAK07086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   457 bits (1176),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 231/267 (87%), Positives = 253/267 (95%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  230   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTAARGFRIQC  289

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLE+FR VA+KF STFS 
Sbjct  290   NKWAILVRLLLGEIPERTVFMQKGMKAALTPYFELTNAVRVGDLEVFRVVADKFGSTFSA  349

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+   +ADAESIV+KAIRDG
Sbjct  350   DRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTKTAVADAESIVAKAIRDG  409

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  410   AVDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  469

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  470   SAEKRRERLQQEEELAKHMAEEDDDDF  496



>ref|XP_010471748.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   456 bits (1174),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 250/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIASLGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTNAVRIGDLELF  V EKF+ TF+ 
Sbjct  281   NKWAIIVRLLLGEIPERSIFTQKGMEKPLRPYFELTNAVRIGDLELFGNVQEKFAKTFAN  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRL HNVIRTGLRNISI+YSRISL DVA KLRL+SANP+ DAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLHHNVIRTGLRNISISYSRISLQDVALKLRLNSANPVTDAESIVAKAIRDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  401   AIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  461   SDEKRREKKQQEEELAKYMAEEDDDDF  487



>dbj|BAJ90869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   456 bits (1172),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  230   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTAARGFRIQC  289

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERTVFMQKGM+  L PYFELTNAVR+GDLE+FR VA+KF STFS 
Sbjct  290   NKWAILVRLLLGEIPERTVFMQKGMKAVLTPYFELTNAVRVGDLEVFRVVADKFGSTFSA  349

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+   +ADAESIV+KAIRDG
Sbjct  350   DRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTKTAVADAESIVAKAIRDG  409

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             A+DAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  410   AVDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  469

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  470   SAEKRRERLQQEEELAKHMAEEDDDDF  496



>gb|EMS49644.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=517

 Score =   456 bits (1172),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 232/267 (87%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  251   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTAARGFRIQC  310

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERTVFMQKGM+ AL PYFELTNAVR+GDLE+FR VAEKF S FS 
Sbjct  311   NKWAILVRLLLGEIPERTVFMQKGMKAALTPYFELTNAVRVGDLEVFRAVAEKFGSIFSA  370

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+   +ADAESIV+KAIRDG
Sbjct  371   DRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTKTAVADAESIVAKAIRDG  430

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+ALRFPPNSHKEKE
Sbjct  431   AIDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKALRFPPNSHKEKE  490

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  491   SAEKRRERLQQEEELAKHMAEEDDDDF  517



>ref|XP_007222347.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
 gb|EMJ23546.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
Length=490

 Score =   455 bits (1170),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 251/267 (94%), Gaps = 1/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPFAAQGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAV+VRLLLGEIPER +FMQ+GMEKALRPYFELTNAVRIGDL LFR VAEKF++TFSK
Sbjct  285   NKWAVLVRLLLGEIPERIIFMQRGMEKALRPYFELTNAVRIGDLALFRNVAEKFAATFSK  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL S NPIADAESIV+KAIRDG
Sbjct  345   DQTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLISTNPIADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI+A+LD +NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN H +++
Sbjct  405   AIEASLDHSNGWMVSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRALRFPPNPH-KEK  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
              + +RRERQQQEQELA HI E+DDDDF
Sbjct  464   ESAERRERQQQEQELANHITEDDDDDF  490



>ref|XP_008221217.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Prunus mume]
Length=490

 Score =   454 bits (1169),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 251/267 (94%), Gaps = 1/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPFAAQGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAV+VRLLLGEIPER +FMQ+GMEKALRPYFELTNAVRIGDL LFR VAEKF++TFSK
Sbjct  285   NKWAVLVRLLLGEIPERIIFMQRGMEKALRPYFELTNAVRIGDLALFRNVAEKFAATFSK  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL S NPIADAESIV+KAIRDG
Sbjct  345   DQTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLISTNPIADAESIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI+A+LD +NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN H +++
Sbjct  405   AIEASLDHSNGWMVSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRALRFPPNPH-KEK  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
              + +RRERQQQEQELA HI E+DDDDF
Sbjct  464   ESAERRERQQQEQELANHITEDDDDDF  490



>ref|XP_008221216.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Prunus mume]
Length=491

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 230/267 (86%), Positives = 251/267 (94%), Gaps = 1/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  226   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPFAAQGFRIQC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAV+VRLLLGEIPER +FMQ+GMEKALRPYFELTNAVRIGDL LFR VAEKF++TFSK
Sbjct  286   NKWAVLVRLLLGEIPERIIFMQRGMEKALRPYFELTNAVRIGDLALFRNVAEKFAATFSK  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL S NPIADAESIV+KAIRDG
Sbjct  346   DQTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLISTNPIADAESIVAKAIRDG  405

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI+A+LD +NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPN H +++
Sbjct  406   AIEASLDHSNGWMVSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRALRFPPNPH-KEK  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
              + +RRERQQQEQELA HI E+DDDDF
Sbjct  465   ESAERRERQQQEQELANHITEDDDDDF  491



>ref|XP_006855514.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Amborella trichopoda]
 gb|ERN16981.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
Length=484

 Score =   453 bits (1166),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/267 (89%), Positives = 253/267 (95%), Gaps = 3/267 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYL+YLG++RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLYYLGRIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA IVRLLLGEIPERTVFMQ GM+KALRPYFELTNAVRIGDLELFR VA+K+S+TFSK
Sbjct  281   NKWAAIVRLLLGEIPERTVFMQNGMKKALRPYFELTNAVRIGDLELFRSVADKYSATFSK  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA KLRLDS   +ADAESIV+KAIRDG
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVASKLRLDS---VADAESIVAKAIRDG  397

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D   G ++SKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFPPNSHKEKE
Sbjct  398   AIDATIDHAKGWVLSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRALRFPPNSHKEKE  457

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  458   SAEKRRERQQQEQELAKHIAEEDDDEF  484



>dbj|BAK06811.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   448 bits (1153),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  126   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAARGFRIQC  185

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF+STFS 
Sbjct  186   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFASTFSA  245

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+ NP+ADAE IV+KAIRDG
Sbjct  246   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTGNPVADAECIVAKAIRDG  305

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  306   AIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  365

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  366   SAEKRRERLQQEEELAKHMAEEDDDDF  392



>ref|XP_003550437.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X1 [Glycine max]
 gb|KHN12619.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   451 bits (1161),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/267 (87%), Positives = 251/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAK+ LLQAARKAPSAA GF++QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKDLLLQAARKAPSAAQGFQIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPER +FM +GMEK+LRPYFELTNAVRIGDLELFR   EKF +TFS+
Sbjct  284   NKWAVIVRLLLGEIPERIIFMHRGMEKSLRPYFELTNAVRIGDLELFRNATEKFGTTFSR  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+SA+P+AD+ESIV+KAIRDG
Sbjct  344   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSASPVADSESIVAKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDA+LD  NG MVSK TGDIYSTNEPQ+A NSRIAFCLNM+NEAVRALRFPPN  KEKE
Sbjct  404   AIDASLDHANGWMVSKGTGDIYSTNEPQLALNSRIAFCLNMYNEAVRALRFPPNKDKEKE  463

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             +AEKRRER QQEQELAKHIAEEDDDDF
Sbjct  464   NAEKRRERHQQEQELAKHIAEEDDDDF  490



>ref|XP_006601362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X2 [Glycine max]
Length=497

 Score =   451 bits (1161),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/267 (87%), Positives = 251/267 (94%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAK+ LLQAARKAPSAA GF++QC
Sbjct  231   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKDLLLQAARKAPSAAQGFQIQC  290

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPER +FM +GMEK+LRPYFELTNAVRIGDLELFR   EKF +TFS+
Sbjct  291   NKWAVIVRLLLGEIPERIIFMHRGMEKSLRPYFELTNAVRIGDLELFRNATEKFGTTFSR  350

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+SA+P+AD+ESIV+KAIRDG
Sbjct  351   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLNSASPVADSESIVAKAIRDG  410

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDA+LD  NG MVSK TGDIYSTNEPQ+A NSRIAFCLNM+NEAVRALRFPPN  KEKE
Sbjct  411   AIDASLDHANGWMVSKGTGDIYSTNEPQLALNSRIAFCLNMYNEAVRALRFPPNKDKEKE  470

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             +AEKRRER QQEQELAKHIAEEDDDDF
Sbjct  471   NAEKRRERHQQEQELAKHIAEEDDDDF  497



>ref|XP_002285893.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 emb|CBI18933.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   451 bits (1159),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 241/267 (90%), Positives = 255/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKF+ TFS 
Sbjct  281   NKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFAGTFST  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DR +NLIVRLRHNVIRTGLRNISI+YSRISLAD+A KLRLDSANP+ADAESIV+KAI DG
Sbjct  341   DRIHNLIVRLRHNVIRTGLRNISISYSRISLADIASKLRLDSANPVADAESIVAKAIHDG  400

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD +NG MVSKETGDIYST EPQIAFNSRI FCLNMHNEAVRALR+PPN+ KEKE
Sbjct  401   AIDATLDHSNGWMVSKETGDIYSTIEPQIAFNSRITFCLNMHNEAVRALRYPPNTQKEKE  460

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  461   SAEKRRERQQQEQELAKHIAEEEDDDF  487



>gb|AAF26768.2|AC007396_17 T4O12.21 [Arabidopsis thaliana]
Length=532

 Score =   452 bits (1163),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 231/294 (79%), Positives = 255/294 (87%), Gaps = 27/294 (9%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  239   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQC  298

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTN-----------------------  806
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELTN                       
Sbjct  299   NKWAIIVRLLLGEIPERSIFTQKGMEKTLRPYFELTNVSSIFFTFLTYALIKVFLLILLF  358

Query  805   ----AVRIGDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLAD  638
                 AVRIGDLELF ++ EKF+ TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL D
Sbjct  359   KFCKAVRIGDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLRNISISYSRISLQD  418

Query  637   VAKKLRLDSANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNS  458
             VA+KLRL+SANP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNS
Sbjct  419   VAQKLRLNSANPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNS  478

Query  457   RIAFCLNMHNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  296
             RIAFCLNMHNEAVRALRFPPN+H+EKES EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  479   RIAFCLNMHNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF  532



>gb|ABR16257.1| unknown [Picea sitchensis]
Length=492

 Score =   450 bits (1157),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 253/268 (94%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYL+YLG++RTIQLEYTDAKESLLQAARKAP++A GFR+QC
Sbjct  225   EKLRSKAPRFEAHSNQQFCRYLYYLGRIRTIQLEYTDAKESLLQAARKAPASARGFRIQC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA IVRLLLGEIPERT FMQ GM+KAL PYFELTNAVRIGDL+LFR VA+K+S TFS 
Sbjct  285   NKWAAIVRLLLGEIPERTTFMQNGMKKALSPYFELTNAVRIGDLDLFRSVADKYSKTFSA  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA KLRL+SA P+ADA+SIV+KAIRDG
Sbjct  345   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAAKLRLNSATPVADAQSIVAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek-  380
             AIDAT+D  NG M+SKETGD+YSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HK++ 
Sbjct  405   AIDATIDHANGWMLSKETGDVYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNAHKKER  464

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
             ESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  465   ESAEKRRERQQQEQELAKHIAEEDDDEF  492



>dbj|BAK01467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   449 bits (1156),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  223   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAARGFRIQC  282

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF+STFS 
Sbjct  283   NKWAIIVRLLLGEIPERTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFASTFSA  342

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+ NP+ADAE IV+KAIRDG
Sbjct  343   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTGNPVADAECIVAKAIRDG  402

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  403   AIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  462

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  463   SAEKRRERLQQEEELAKHMAEEDDDDF  489



>ref|XP_003589555.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES59806.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=483

 Score =   447 bits (1151),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 231/259 (89%), Positives = 247/259 (95%), Gaps = 0/259 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  216   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAAQGFRIQC  275

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERT+F+QKGMEKALRPYFELTNAVRIGDLELFR VAEK+++TF+ 
Sbjct  276   NKWAIIVRLLLGEIPERTIFVQKGMEKALRPYFELTNAVRIGDLELFRNVAEKYATTFNT  335

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL SA+PIADAESI+SKAIRDG
Sbjct  336   DGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLSSADPIADAESIISKAIRDG  395

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKE GDIYSTNEPQ+AFNSRIAFCLNMHNEAV+ALRFP N+HKEKE
Sbjct  396   AIDATLDHANGWMVSKEIGDIYSTNEPQLAFNSRIAFCLNMHNEAVQALRFPKNTHKEKE  455

Query  376   saekrrerqqqeqELAKHI  320
              AEKRRERQQQEQELAKHI
Sbjct  456   IAEKRRERQQQEQELAKHI  474



>gb|EMT33081.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score =   447 bits (1150),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  230   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAARGFRIQC  289

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF+STFS 
Sbjct  290   NKWAIIVRLLLGEIPERTVFMQKGMKEALAPYFELTNAVRIGDLELFRAVADKFASTFSA  349

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+ NP+ADAE IV+KAIRDG
Sbjct  350   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTENPVADAECIVAKAIRDG  409

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  410   AIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  469

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  470   SAEKRRERLQQEEELAKHMAEEDDDDF  496



>ref|XP_004499304.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=491

 Score =   445 bits (1145),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 231/259 (89%), Positives = 247/259 (95%), Gaps = 0/259 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  224   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAAQGFRIQC  283

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERT+F+QKGMEKALRPYFELTNAVRIGDLELFR VA+K+++TF+ 
Sbjct  284   NKWAIIVRLLLGEIPERTIFVQKGMEKALRPYFELTNAVRIGDLELFRNVADKYATTFNT  343

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL SANPIADAE I+SKAIRDG
Sbjct  344   DGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLSSANPIADAECIISKAIRDG  403

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD TN  MVSKETGDIYSTNEPQ+AFNSRIAFCLNMHNEAV+ALRFP N+HKEKE
Sbjct  404   AIDATLDHTNKWMVSKETGDIYSTNEPQLAFNSRIAFCLNMHNEAVQALRFPKNTHKEKE  463

Query  376   saekrrerqqqeqELAKHI  320
              AEKRRERQQQEQELAKHI
Sbjct  464   IAEKRRERQQQEQELAKHI  482



>gb|EMS46362.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=651

 Score =   447 bits (1149),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 256/267 (96%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP+AA GFR+QC
Sbjct  385   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPAAARGFRIQC  444

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPERTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF+STFS 
Sbjct  445   NKWAIIVRLLLGEIPERTVFMQKGMKEALAPYFELTNAVRIGDLELFRAVADKFASTFSA  504

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+ NP+ADAE IV+KAIRDG
Sbjct  505   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTENPVADAECIVAKAIRDG  564

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+A+RFPPNSHKEKE
Sbjct  565   AIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKE  624

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  625   SAEKRRERLQQEEELAKHMAEEDDDDF  651



>gb|EEC83998.1| hypothetical protein OsI_30168 [Oryza sativa Indica Group]
Length=339

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/251 (88%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1048  QFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQCNKWAVIVRLLLGEIPE  869
             +FCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP  A GFR+QCNKWA+IVRLLLGEIPE
Sbjct  89    KFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITARGFRIQCNKWAIIVRLLLGEIPE  148

Query  868   RTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIR  689
             RTVFMQKGM++AL PYFELTNAVRIGDLELFR VA+KF+STFS DRT NLIVRLRHNVIR
Sbjct  149   RTVFMQKGMKEALTPYFELTNAVRIGDLELFRAVADKFASTFSADRTRNLIVRLRHNVIR  208

Query  688   TGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDGAIDATLDRTNGCMVSK  509
             TGLRNISI+YSRISLAD+AKKLRLDS NP+ADAESIV+KAIRDGAIDAT+D  NG MVSK
Sbjct  209   TGLRNISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDGAIDATIDHANGWMVSK  268

Query  508   ETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkekesaekrrerqqqeqELA  329
             ETGD+YSTNEPQIAFNSRIAFCLNMHNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELA
Sbjct  269   ETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELA  328

Query  328   KHIAEEDDDDF  296
             KH+AEEDDDDF
Sbjct  329   KHMAEEDDDDF  339



>ref|XP_007017885.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
 gb|EOY15110.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
Length=474

 Score =   437 bits (1123),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 229/267 (86%), Positives = 245/267 (92%), Gaps = 13/267 (5%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AA GFR+QC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVAARGFRIQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPERT+FMQKGMEKALRPYFELTN              +KF+STFS 
Sbjct  281   NKWAILVRLLLGEIPERTMFMQKGMEKALRPYFELTNV-------------KKFASTFST  327

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL+S  P+ADAESIV+KAIRDG
Sbjct  328   DKTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLNSKTPVADAESIVAKAIRDG  387

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDATLD  NG MVSKETGDIYSTNEPQIAF+SRIAFCLNMHNEAVRALRFPPN+HKEKE
Sbjct  388   AIDATLDHANGWMVSKETGDIYSTNEPQIAFHSRIAFCLNMHNEAVRALRFPPNTHKEKE  447

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  448   SAEKRRERQQQEQELAKHIAEEDDDDF  474



>ref|XP_010446200.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=475

 Score =   436 bits (1121),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 221/265 (83%), Positives = 246/265 (93%), Gaps = 3/265 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK++TIQLEYTDAKESLLQAARKAP A+LGFR+QC
Sbjct  213   EKLRSKAPRFEAHSNQQFCRYLFYLGKIQTIQLEYTDAKESLLQAARKAPIASLGFRIQC  272

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QKGMEK LRPYFELT+AVRIGDLELF  V EKFS TF+K
Sbjct  273   NKWAIIVRLLLGEIPERSIFTQKGMEKPLRPYFELTSAVRIGDLELFGNVQEKFSKTFAK  332

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRT LRNIS++YS ISL DVA+KLRLDS   +ADAESIV+KAIRDG
Sbjct  333   DRTHNLIVRLRHNVIRTALRNISVSYSSISLQDVAQKLRLDS---VADAESIVAKAIRDG  389

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI+AT+D  NG MVSKETGDIYST EPQ AFNSRIAFCLNMHNEAVRALR+PPN+HKEKE
Sbjct  390   AIEATIDHKNGLMVSKETGDIYSTKEPQTAFNSRIAFCLNMHNEAVRALRYPPNTHKEKE  449

Query  376   saekrrerqqqeqELAKHIAEEDDD  302
             + EKRRE++QQE+ELAK++AEEDDD
Sbjct  450   NEEKRREKKQQEEELAKYMAEEDDD  474



>ref|XP_010446093.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=392

 Score =   433 bits (1113),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 222/265 (84%), Positives = 246/265 (93%), Gaps = 3/265 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK++TIQLEYTDAKESLLQAARKAP A+LGFRVQC
Sbjct  130   EKLRSKAPRFEAHSNQQFCRYLFYLGKIQTIQLEYTDAKESLLQAARKAPIASLGFRVQC  189

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IVRLLLGEIPER++F QK MEK LRPYFELT+AVRIGDLELF  V EKFS TF+K
Sbjct  190   NKWAIIVRLLLGEIPERSIFTQKEMEKPLRPYFELTSAVRIGDLELFGNVQEKFSKTFAK  249

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRT LRNIS++Y RISL DVA+KLRLDS   +ADAESIV+KAIRDG
Sbjct  250   DRTHNLIVRLRHNVIRTALRNISVSYWRISLQDVAQKLRLDS---VADAESIVAKAIRDG  306

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI+AT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALR+PPN+HKEKE
Sbjct  307   AIEATIDHKNGLMVSKETGDIYSTNEPQTAFNSRIAFCLNMHNEAVRALRYPPNTHKEKE  366

Query  376   saekrrerqqqeqELAKHIAEEDDD  302
             + EKRRE++QQE+ELAK++AEEDDD
Sbjct  367   NEEKRREKKQQEEELAKYMAEEDDD  391



>gb|KHG11096.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=447

 Score =   424 bits (1090),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/251 (90%), Positives = 234/251 (93%), Gaps = 3/251 (1%)
 Frame = -1

Query  1048  QFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQCNKWAVIVRLLLGEIPE  869
             QFCRYLFYLGK+RTIQLEYTDAKE LLQAARKAP AAL FRVQCNKWA+IVRLLLGEIPE
Sbjct  200   QFCRYLFYLGKIRTIQLEYTDAKECLLQAARKAPIAALDFRVQCNKWAIIVRLLLGEIPE  259

Query  868   RTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIR  689
             RTVFMQKGMEKALRPYFELTNAVRIGDLELFR VAEKFSSTFS DRT+NLIVRLRHNVIR
Sbjct  260   RTVFMQKGMEKALRPYFELTNAVRIGDLELFRSVAEKFSSTFSSDRTHNLIVRLRHNVIR  319

Query  688   TGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDGAIDATLDRTNGCMVSK  509
             TGLRNISI+YSRISL DVAKKLRLDS   +ADAESIV+KAIRDGAIDA LD  + CM+SK
Sbjct  320   TGLRNISISYSRISLVDVAKKLRLDS---VADAESIVAKAIRDGAIDAILDHASRCMLSK  376

Query  508   ETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkekesaekrrerqqqeqELA  329
             ETGDIYS  EPQ  FNSRIAFCLNMHNEAVRALRFPPNSHKEKESAEKRRERQQQEQELA
Sbjct  377   ETGDIYSMTEPQTVFNSRIAFCLNMHNEAVRALRFPPNSHKEKESAEKRRERQQQEQELA  436

Query  328   KHIAEEDDDDF  296
             KHIAEEDDD+F
Sbjct  437   KHIAEEDDDEF  447



>ref|XP_001753136.1| predicted protein [Physcomitrella patens]
 gb|EDQ82177.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSK  R ++HSNQQ CRYLFYLGK+RTIQLEYTDAKE LLQA RKAP++A GFR+QC
Sbjct  219   EKLRSKTQRSDSHSNQQLCRYLFYLGKIRTIQLEYTDAKECLLQAGRKAPASARGFRIQC  278

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KWAVIVRLLLGEIPERT FMQ GM KALRPYFELTNAVRIGDLELFR VAEK SS F+ 
Sbjct  279   TKWAVIVRLLLGEIPERTTFMQPGMRKALRPYFELTNAVRIGDLELFRHVAEKSSSVFTA  338

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+ +NLIVRLRHNVIRTGLRNISIAYSRISL DVAKKL LDSA P+ DAESIV+KAIRDG
Sbjct  339   DKCHNLIVRLRHNVIRTGLRNISIAYSRISLTDVAKKLHLDSATPVDDAESIVTKAIRDG  398

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek-  380
              IDA++D +NG M SKETGD+YST EPQ AF+SRIAFCLN+HNEAV+ALRFPP++HK++ 
Sbjct  399   GIDASVDHSNGWMQSKETGDVYSTQEPQQAFHSRIAFCLNIHNEAVQALRFPPDAHKKEL  458

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
             ESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  459   ESAEKRRERQQQEQELAKHIAEEDDDEF  486



>ref|XP_001764054.1| predicted protein [Physcomitrella patens]
 gb|EDQ71193.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   419 bits (1077),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 239/268 (89%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSK  R E+HSNQQ CRYL+YLGK+RTIQLEYTDAKE LLQAARKAP++A GFR+QC
Sbjct  219   EKLRSKTQRSESHSNQQLCRYLYYLGKIRTIQLEYTDAKECLLQAARKAPASARGFRIQC  278

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KWAVIVRLLLGEIPERT FMQ GM KALRPYFELTNAVRIGDLELFR VA+K SS F+ 
Sbjct  279   TKWAVIVRLLLGEIPERTTFMQPGMRKALRPYFELTNAVRIGDLELFRSVADKHSSVFTS  338

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+++NLIVRLRHNVIRTGLRNISIAYSRISLADVA KL LDS  P+ DAESIV+KAIRDG
Sbjct  339   DKSHNLIVRLRHNVIRTGLRNISIAYSRISLADVATKLHLDSPTPVEDAESIVTKAIRDG  398

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek-  380
              IDA++D   G M SKETGDIYST EPQ AF+SRIAFCLN HNEAV+ALRFPP++HK++ 
Sbjct  399   GIDASVDHAKGWMQSKETGDIYSTQEPQHAFHSRIAFCLNTHNEAVKALRFPPDAHKKEL  458

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
             ESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  459   ESAEKRRERQQQEQELAKHIAEEDDDDF  486



>ref|XP_001757567.1| predicted protein [Physcomitrella patens]
 gb|EDQ77624.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   416 bits (1068),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/268 (80%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSK  R ++HSNQQ CRYL+YLGK+RTIQLEYTDAKE LLQAARKAP++A GF++QC
Sbjct  219   EKLRSKTQRSDSHSNQQLCRYLYYLGKIRTIQLEYTDAKECLLQAARKAPTSARGFKIQC  278

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KWAVIVRLLLGEI ERT FMQ GM KALRPYF+LTNAVRIGDLELFRQVAEK+SS F+ 
Sbjct  279   TKWAVIVRLLLGEILERTTFMQPGMRKALRPYFDLTNAVRIGDLELFRQVAEKYSSVFTA  338

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+ +NLIVRLRHNVIRTGLRNISIAYSRISLADVA KL LDSA P+ DAESIV+KAIRDG
Sbjct  339   DKCHNLIVRLRHNVIRTGLRNISIAYSRISLADVATKLHLDSATPVDDAESIVTKAIRDG  398

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek-  380
              IDA++D +NG M SKET DIYST EPQ AF+SRIAFCLN HNEAV+ALRFPP++HK++ 
Sbjct  399   GIDASVDHSNGWMQSKETSDIYSTQEPQQAFHSRIAFCLNTHNEAVKALRFPPDAHKKQL  458

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
             ES+EKRRERQQQEQELAKHIAEEDDD+F
Sbjct  459   ESSEKRRERQQQEQELAKHIAEEDDDEF  486



>ref|XP_002970446.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
 ref|XP_002978519.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ20505.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ28576.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
Length=482

 Score =   405 bits (1042),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 209/268 (78%), Positives = 241/268 (90%), Gaps = 1/268 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSK+ R E+H+NQQ CRYLFYLGK+RTIQLEYTDAK+SL+QAARKAP+ A  FR+QC
Sbjct  215   EKLRSKSQRAESHANQQLCRYLFYLGKIRTIQLEYTDAKDSLMQAARKAPTIAHDFRIQC  274

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERT FMQ+GM+ ALRPYFELTNAVRIGDLELF+ VA+ FS  FS+
Sbjct  275   NKWAVIVRLLLGEIPERTTFMQRGMKAALRPYFELTNAVRIGDLELFKSVADNFSPIFSR  334

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA KL L S + ++DAES+V+KAIRDG
Sbjct  335   DKTHNLIVRLRHNVIRTGLRNISISYSRISLADVAAKLHLSSDSAVSDAESMVAKAIRDG  394

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek-  380
              IDA +D   G M S+ETGDIYST EPQ+AF+SRIAFCLN +N+AV+ALRFPPN+HK++ 
Sbjct  395   GIDAVIDHARGFMQSRETGDIYSTQEPQLAFHSRIAFCLNTYNDAVKALRFPPNAHKKEL  454

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
             ESAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  455   ESAEKRRERQQQEQELAKHIAEEEDDDF  482



>ref|XP_009628274.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana tomentosiformis]
Length=485

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/234 (79%), Positives = 208/234 (89%), Gaps = 0/234 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EK RSKA   EA SNQQFCRYL Y GK++TIQLEYTDAK+SL+QA +K+P  A+GF++QC
Sbjct  243   EKFRSKAHCVEALSNQQFCRYLLYQGKIKTIQLEYTDAKDSLVQAVQKSPVTAVGFQIQC  302

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IV+LLLGEIPERTVF QK MEKALRPYFELTNA+RIGDLELFR   EKFSS F++
Sbjct  303   NKWAIIVQLLLGEIPERTVFTQKRMEKALRPYFELTNAIRIGDLELFRTADEKFSSIFNQ  362

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIR GLRNIS +YSRISLAD+AKKL LDS NP+ DAE+IV+KAIRDG
Sbjct  363   DRTSNLIVRLRHNVIRAGLRNISASYSRISLADIAKKLNLDSENPVDDAENIVAKAIRDG  422

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPN  395
             AIDATLD  NG +VSK TGD+YSTNEPQIAFNSRIAFCLNMHNEAVRALRFP N
Sbjct  423   AIDATLDHANGWLVSKATGDVYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPQN  476



>ref|XP_009628273.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/234 (79%), Positives = 208/234 (89%), Gaps = 0/234 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EK RSKA   EA SNQQFCRYL Y GK++TIQLEYTDAK+SL+QA +K+P  A+GF++QC
Sbjct  244   EKFRSKAHCVEALSNQQFCRYLLYQGKIKTIQLEYTDAKDSLVQAVQKSPVTAVGFQIQC  303

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IV+LLLGEIPERTVF QK MEKALRPYFELTNA+RIGDLELFR   EKFSS F++
Sbjct  304   NKWAIIVQLLLGEIPERTVFTQKRMEKALRPYFELTNAIRIGDLELFRTADEKFSSIFNQ  363

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIR GLRNIS +YSRISLAD+AKKL LDS NP+ DAE+IV+KAIRDG
Sbjct  364   DRTSNLIVRLRHNVIRAGLRNISASYSRISLADIAKKLNLDSENPVDDAENIVAKAIRDG  423

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPN  395
             AIDATLD  NG +VSK TGD+YSTNEPQIAFNSRIAFCLNMHNEAVRALRFP N
Sbjct  424   AIDATLDHANGWLVSKATGDVYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPQN  477



>ref|XP_004231453.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=484

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EK+RSKA RFEA SNQQFCRYLFY GK++TIQLEYTDAK+ LLQAA+K P+ A+GF++QC
Sbjct  245   EKIRSKAHRFEALSNQQFCRYLFYQGKIKTIQLEYTDAKDCLLQAAQKGPTTAVGFKIQC  304

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIV LLLGEIPERT+F QK MEKALRPYF LTNA R+GDLELFR VAEKFSSTFS+
Sbjct  305   NKWAVIVHLLLGEIPERTIFTQKRMEKALRPYFVLTNAFRVGDLELFRTVAEKFSSTFSQ  364

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+NLI R+RHNVIRTG++N+S++Y+RISLAD+AKKL LD  NPI DAE+IV+KAIRDG
Sbjct  365   DKTSNLINRVRHNVIRTGIKNVSVSYTRISLADIAKKLNLDLENPIGDAENIVAKAIRDG  424

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFP  401
             AIDATLD  NG +VSK T D+YSTNEPQIAF+SRI FCL+MHNEA+RALRFP
Sbjct  425   AIDATLDHANGWLVSKATEDVYSTNEPQIAFDSRINFCLSMHNEALRALRFP  476



>ref|XP_009773690.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana sylvestris]
Length=488

 Score =   389 bits (998),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 207/234 (88%), Gaps = 0/234 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EK RSKA   +A SNQQ CRYL Y GK++TIQL+YTDAK+SLLQA +K+P  A+GF++QC
Sbjct  246   EKFRSKAHCVDALSNQQLCRYLLYQGKIKTIQLDYTDAKDSLLQAVQKSPVTAVGFQIQC  305

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IV+LLLGEIPERTVF QK MEK+LRPYFELTNAVR+GDLEL R VA KFSSTFS+
Sbjct  306   NKWAIIVQLLLGEIPERTVFTQKRMEKSLRPYFELTNAVRVGDLELLRTVAVKFSSTFSQ  365

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNIS AYSRISLAD+AKKL LDS +P+ DAE++V+KAIRDG
Sbjct  366   DRTSNLIVRLRHNVIRTGLRNISTAYSRISLADIAKKLNLDSEHPVDDAENLVAKAIRDG  425

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPN  395
             AIDAT+D  N  +VSK TGD+YSTNEPQIAFNSRIAFCLNMHNEAV ALRFP N
Sbjct  426   AIDATIDHANRWLVSKATGDVYSTNEPQIAFNSRIAFCLNMHNEAVHALRFPQN  479



>ref|XP_009773691.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Nicotiana sylvestris]
Length=487

 Score =   389 bits (998),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 207/234 (88%), Gaps = 0/234 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EK RSKA   +A SNQQ CRYL Y GK++TIQL+YTDAK+SLLQA +K+P  A+GF++QC
Sbjct  245   EKFRSKAHCVDALSNQQLCRYLLYQGKIKTIQLDYTDAKDSLLQAVQKSPVTAVGFQIQC  304

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA+IV+LLLGEIPERTVF QK MEK+LRPYFELTNAVR+GDLEL R VA KFSSTFS+
Sbjct  305   NKWAIIVQLLLGEIPERTVFTQKRMEKSLRPYFELTNAVRVGDLELLRTVAVKFSSTFSQ  364

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNIS AYSRISLAD+AKKL LDS +P+ DAE++V+KAIRDG
Sbjct  365   DRTSNLIVRLRHNVIRTGLRNISTAYSRISLADIAKKLNLDSEHPVDDAENLVAKAIRDG  424

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPN  395
             AIDAT+D  N  +VSK TGD+YSTNEPQIAFNSRIAFCLNMHNEAV ALRFP N
Sbjct  425   AIDATIDHANRWLVSKATGDVYSTNEPQIAFNSRIAFCLNMHNEAVHALRFPQN  478



>dbj|BAA02696.1| 21D7 antigen [Daucus carota]
Length=488

 Score =   382 bits (981),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/267 (78%), Positives = 226/267 (85%), Gaps = 1/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKES  +    +P  +  F    
Sbjct  223   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESCSKLP-VSPCCSSWFPSPM  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              +      LLLGEIPERTVFMQKGMEKALRPYF+L     +G       VA+KF+STF+ 
Sbjct  282   QQVGGDSTLLLGEIPERTVFMQKGMEKALRPYFDLQMLYELGIWSSLELVADKFASTFTA  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRLDS NP+ADAESIVSKAIRDG
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVARKLRLDSPNPVADAESIVSKAIRDG  401

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRALRFP NSHK+KE
Sbjct  402   AIDATIDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRALRFPANSHKDKE  461

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             SAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  462   SAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_002300686.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE79959.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=492

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/267 (70%), Positives = 221/267 (83%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKA RF++H+ QQ CRYLFYLGK+RTIQL+Y DA+ESLL AARKAP AA GFR+ C
Sbjct  226   EKLRSKALRFQSHTIQQVCRYLFYLGKIRTIQLKYKDARESLLHAARKAPVAAHGFRILC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +KWAV+V LLLGEIPERT+F Q GME+ALRPYF LTNAVRIGDLELFR VAE  +  F  
Sbjct  286   SKWAVLVHLLLGEIPERTIFKQSGMERALRPYFMLTNAVRIGDLELFRNVAEDLAGFFGS  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LDSANP+AD ESI +KAIRDG
Sbjct  346   DKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLDSANPVADVESITAKAIRDG  405

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI A LD  NG +VSK+TGDIYST +P   F+SRIAFCLN+H +AV+ALRFPP + +EK+
Sbjct  406   AIHAILDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCLNLHTDAVKALRFPPKTQEEKD  465

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S +  RE Q  ++E+A+   +ED+  F
Sbjct  466   SDDYWRESQVLDEEIAREFMDEDETYF  492



>ref|XP_011034976.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Populus euphratica]
Length=491

 Score =   368 bits (944),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 185/267 (69%), Positives = 220/267 (82%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKA RF++H+ QQ CRYLFYLGK++TIQL+Y DA+ESLL AARKAP AA GFR+ C
Sbjct  225   EKLRSKARRFQSHTIQQVCRYLFYLGKIQTIQLKYKDARESLLHAARKAPVAAHGFRILC  284

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +KWAV+V LLLGEIPERT F Q GME+ALRPYF LTNAVRIGDLELFR VAE F+  F  
Sbjct  285   SKWAVLVHLLLGEIPERTTFKQSGMERALRPYFMLTNAVRIGDLELFRNVAEDFAGFFGS  344

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LDSANP+AD ESI +KAIRDG
Sbjct  345   DKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLDSANPVADVESITAKAIRDG  404

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI A LD  NG +VSK+TGDIYST +P   F+SRIAFC N+ N+AV+ALRFPP + +E++
Sbjct  405   AIHAVLDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCRNLQNDAVKALRFPPKTQEERD  464

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S E  RE Q  ++E+A+   +ED+  F
Sbjct  465   SDEYWRESQVLDEEIAREYMDEDETYF  491



>ref|XP_011034975.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Populus euphratica]
Length=492

 Score =   368 bits (944),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 185/267 (69%), Positives = 220/267 (82%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKA RF++H+ QQ CRYLFYLGK++TIQL+Y DA+ESLL AARKAP AA GFR+ C
Sbjct  226   EKLRSKARRFQSHTIQQVCRYLFYLGKIQTIQLKYKDARESLLHAARKAPVAAHGFRILC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +KWAV+V LLLGEIPERT F Q GME+ALRPYF LTNAVRIGDLELFR VAE F+  F  
Sbjct  286   SKWAVLVHLLLGEIPERTTFKQSGMERALRPYFMLTNAVRIGDLELFRNVAEDFAGFFGS  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LDSANP+AD ESI +KAIRDG
Sbjct  346   DKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLDSANPVADVESITAKAIRDG  405

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI A LD  NG +VSK+TGDIYST +P   F+SRIAFC N+ N+AV+ALRFPP + +E++
Sbjct  406   AIHAVLDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCRNLQNDAVKALRFPPKTQEERD  465

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S E  RE Q  ++E+A+   +ED+  F
Sbjct  466   SDEYWRESQVLDEEIAREYMDEDETYF  492



>ref|XP_011034972.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
 ref|XP_011034973.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
Length=517

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/267 (69%), Positives = 220/267 (82%), Gaps = 0/267 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKA RF++H+ QQ CRYLFYLGK++TIQL+Y DA+ESLL AARKAP AA GFR+ C
Sbjct  251   EKLRSKARRFQSHTIQQVCRYLFYLGKIQTIQLKYKDARESLLHAARKAPVAAHGFRILC  310

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +KWAV+V LLLGEIPERT F Q GME+ALRPYF LTNAVRIGDLELFR VAE F+  F  
Sbjct  311   SKWAVLVHLLLGEIPERTTFKQSGMERALRPYFMLTNAVRIGDLELFRNVAEDFAGFFGS  370

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LDSANP+AD ESI +KAIRDG
Sbjct  371   DKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLDSANPVADVESITAKAIRDG  430

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
             AI A LD  NG +VSK+TGDIYST +P   F+SRIAFC N+ N+AV+ALRFPP + +E++
Sbjct  431   AIHAVLDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCRNLQNDAVKALRFPPKTQEERD  490

Query  376   saekrrerqqqeqELAKHIAEEDDDDF  296
             S E  RE Q  ++E+A+   +ED+  F
Sbjct  491   SDEYWRESQVLDEEIAREYMDEDETYF  517



>ref|XP_006386166.1| hypothetical protein POPTR_0002s01940g [Populus trichocarpa]
 gb|ERP63963.1| hypothetical protein POPTR_0002s01940g [Populus trichocarpa]
Length=481

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 194/235 (83%), Gaps = 0/235 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAP+F + S+QQ  RYLFY GK++TI+L YTDAKES LQA  + P AA GFR+QC
Sbjct  216   EKLRSKAPKFLSRSSQQTRRYLFYTGKIQTIRLAYTDAKESFLQAVWRGPVAARGFRIQC  275

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KW V+VRLLLGEIPERTVFMQ GME+ LRPYFELTNAVRIGDLELF  VAE+F+ TF  
Sbjct  276   TKWTVLVRLLLGEIPERTVFMQSGMERTLRPYFELTNAVRIGDLELFGNVAEEFAGTFIS  335

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T NLIVRL+H+VIRTGLR+ISI+YS ISLA+VA KL++ S N +AD E++V+KAIRDG
Sbjct  336   DGTKNLIVRLQHSVIRTGLRSISISYSSISLAEVADKLKMHSRNLLADVENVVAKAIRDG  395

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNS  392
             AI+A +D  NG ++SKET DIY+T EPQ+AF+SRI+F LN++NE VRAL  P  +
Sbjct  396   AINAKIDHANGWLISKETRDIYATAEPQVAFSSRISFYLNLYNETVRALLLPSGN  450



>gb|AFK34954.1| unknown [Lotus japonicus]
Length=187

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -1

Query  856  MQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLR  677
            MQKGME ALRPYFELTNAVRIGDLELFR +A+KF++TF+ D T+NLIVRLRHNVIRTGLR
Sbjct  1    MQKGMENALRPYFELTNAVRIGDLELFRNIADKFATTFNADGTHNLIVRLRHNVIRTGLR  60

Query  676  NISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGD  497
            NISI+YSRISLADVA+KLRL+SA+P+ADAESIVSKAIRDGAIDATLD  NG MVSKETGD
Sbjct  61   NISISYSRISLADVARKLRLNSASPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGD  120

Query  496  IYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIA  317
            IYSTNEPQ+AFNSRIAFCLNMHNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIA
Sbjct  121  IYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIA  180

Query  316  EEDDDDF  296
            EEDDDDF
Sbjct  181  EEDDDDF  187



>emb|CBI37854.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP +ALGFRVQC
Sbjct  221   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPVSALGFRVQC  280

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELF+ VAEKFS+TFS 
Sbjct  281   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFKSVAEKFSTTFSS  340

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAK  629
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+ +
Sbjct  341   DRTHNLIVRLRHNVIRTGLRNISISYSRISLADMVQ  376


 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  564  EMGLLMPHWIALMDAWYPRRLETFIPPMSLRLLSTQELPSVLTCIMRQCVPFDSHLIPT  388
            +M  L PHWI  M  WYPRR  T  PP +L L  TQELP  LTC   QCVPF   LIPT
Sbjct  373  DMVQLTPHWIMQMGGWYPRRQGTSTPPTNLNLHLTQELPFALTCTTMQCVPFGFPLIPT  431



>ref|XP_002945863.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ52858.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=490

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/269 (59%), Positives = 205/269 (76%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEA-HSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQ  920
             EK RSKA + +   S QQ+CRYL+YLG++RTIQLEYT+AK+ L QA R+APS A GFR+ 
Sbjct  225   EKFRSKAQKADQFRSGQQYCRYLYYLGRIRTIQLEYTEAKDCLQQALRRAPSIAHGFRIT  284

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +KW ++VRLLLGEIP+R  F Q GM  AL+PYFELT +V+ GD   F+QV E+FSS F 
Sbjct  285   VSKWLILVRLLLGEIPDRQEFAQPGMSAALQPYFELTQSVKAGDTLAFKQVTERFSSVFL  344

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              DRT+NLI RL  NVIR GLR +++AYSRISLA++A KL L SA    DAE IV+KAIRD
Sbjct  345   ADRTHNLITRLHQNVIRIGLRRMNLAYSRISLAEIAAKLHLVSAE---DAEYIVAKAIRD  401

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH-ke  383
             G IDA +D   G M S+E  D+YST EPQ AF++RIAFCL++HNEA++A+RF P++H ++
Sbjct  402   GGIDAVIDHEGGFMASRERVDVYSTAEPQAAFHARIAFCLDLHNEAIKAMRFEPDAHRRK  461

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ES+E R+ER   EQELAK + E+D +DF
Sbjct  462   AESSEARQERLAAEQELAKALEEDDGEDF  490



>ref|XP_001696175.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP08152.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
Length=488

 Score =   304 bits (778),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 198/268 (74%), Gaps = 4/268 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEA-HSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQ  920
             EK RSKA + +   S QQ+CRYL+YLG++RTIQLEY +AK+ L Q+ R+APS A GFR+ 
Sbjct  224   EKFRSKAQKADQWRSGQQYCRYLYYLGRIRTIQLEYAEAKDCLQQSLRRAPSIAHGFRIT  283

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +KW ++VRLLLGEIP+RT F Q GM  AL+PYFELT AV+ GD+  F+QVAE+    F 
Sbjct  284   VSKWLILVRLLLGEIPDRTEFAQPGMSAALQPYFELTQAVKAGDMRAFKQVAERCHDVFL  343

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T+NLI RL HNVIR GLR I++AYSRISLA++A KL L++A    DAE IV+KAIRD
Sbjct  344   ADATHNLITRLHHNVIRIGLRRINLAYSRISLAEIAAKLHLNNAE---DAEYIVAKAIRD  400

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G IDA +D   G M S+E  D+YST EPQ AF++RIAFCL++HNEA++A+RF P++H+ K
Sbjct  401   GGIDAVIDHDGGFMASRERPDVYSTAEPQAAFHARIAFCLDLHNEAIKAMRFEPDAHRRK  460

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
             +   + R+ +   ++      EED+DDF
Sbjct  461   QETSEARQERLAAEQELAKALEEDEDDF  488



>ref|XP_011034977.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=385

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/235 (64%), Positives = 187/235 (80%), Gaps = 0/235 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKA +F + S+QQ  RYLFY GK++TI+L YTDAKES  QA  + P AA GF +QC
Sbjct  120   EKLRSKAAKFLSRSSQQTRRYLFYTGKIQTIRLAYTDAKESFRQAVWRGPVAARGFLIQC  179

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KW V+VRLLLGEIPERT FMQ GME+ LRPYFELTNAVRIGDLELF  VAE+F+ TF  
Sbjct  180   TKWTVLVRLLLGEIPERTAFMQSGMERILRPYFELTNAVRIGDLELFGNVAEEFAGTFIS  239

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T NLIVRL+H+V R+GLR+ SI+YS ISLA+VA KL++ S N +AD E++V+KAIRDG
Sbjct  240   DGTKNLIVRLQHSVNRSGLRSTSISYSSISLAEVADKLKMHSRNLLADVENVVAKAIRDG  299

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNS  392
             AI+A +D  NG ++SKET DIY+T EPQ+ F+SRI+F LN++NE +RAL  P  +
Sbjct  300   AINAKIDHANGWLISKETRDIYATAEPQVVFSSRISFYLNLYNETLRALPLPSGN  354



>gb|AAL09760.1| At1g20200/T20H2_4 [Arabidopsis thaliana]
Length=378

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKAPRFEAHSNQQFCRYLFYLGK+RTIQLEYTDAKESLLQAARKAP AALGFR+QC
Sbjct  222   EKLRSKAPRFEAHSNQQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQC  281

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             NKWA++VRLLLGEIPER++F QKGMEKALRPYFELTNAVRIGDLELFR V EKF  TF++
Sbjct  282   NKWAILVRLLLGEIPERSIFTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQ  341

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAK  629
             DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DV K
Sbjct  342   DRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVPK  377



>ref|XP_005649181.1| 26S proteasome regulatory subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE24637.1| 26S proteasome regulatory subunit [Coccomyxa subellipsoidea C-169]
Length=498

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 180/232 (78%), Gaps = 4/232 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFE-AHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQ  920
             EKLRSKA R E + S QQ CRYL+YLG++R IQL+YT+AK+ L QA+RKAPS+A+GFRV+
Sbjct  235   EKLRSKAQRPEVSRSTQQLCRYLYYLGRIRAIQLDYTEAKDCLQQASRKAPSSAVGFRVE  294

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +KW  +VRLLLGE+PE + F   G+ K L PYF +  AVR GDL  FRQVA+  ++ F+
Sbjct  295   VSKWLSLVRLLLGEVPEHSEFTAAGLAKPLAPYFSIAQAVRAGDLVAFRQVADANAAVFA  354

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D+T NLIVRL++NVIR GLR I++AYSRISLADVA +L L S   + D E IV+KAIRD
Sbjct  355   ADKTQNLIVRLQYNVIRAGLRRINLAYSRISLADVATRLGLAS---VEDTECIVAKAIRD  411

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRF  404
             G +DA LD  NG M+SKE  DIY+T EP  AF++R+AFCL++HNEAVRA+RF
Sbjct  412   GGVDAVLDHANGWMLSKEVVDIYATAEPAAAFHARVAFCLDIHNEAVRAMRF  463



>ref|XP_001415380.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93672.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=445

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 174/233 (75%), Gaps = 3/233 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRS+    ++ S QQ CRY +YLG++R +QLEY++AKE L QA +KAP+ A GFR++ 
Sbjct  179   EKLRSRVTLPQSRSIQQQCRYAYYLGRIRAVQLEYSEAKEYLTQAYQKAPTGAKGFRLEL  238

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KW  IVR+LLGEIPER    Q  M  AL PYF+L  AVR+GDL  F++ AE   +TF++
Sbjct  239   LKWITIVRMLLGEIPERKELTQPEMRAALAPYFDLVQAVRMGDLTAFQRAAETHGTTFTE  298

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+ +NLI RLR NVIRTGL  I+ AYS+ISLADVA+KL L S   + DAES+V+KAIRDG
Sbjct  299   DKLSNLINRLRANVIRTGLTRINTAYSKISLADVAEKLGLPS---VEDAESVVAKAIRDG  355

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPP  398
              +DA +D +   M SKET D+YST EPQ AF+ RIAFCL+ HNEAV+A+R+PP
Sbjct  356   NVDAVIDHSAKVMYSKETTDVYSTQEPQSAFHVRIAFCLDTHNEAVKAMRYPP  408



>ref|XP_002500951.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62209.1| predicted protein [Micromonas sp. RCC299]
Length=418

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 189/273 (69%), Gaps = 8/273 (3%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRSKA    + SNQQ CRYL+YLG++R IQLEY+DAKE L QA RKAP  A GF ++ 
Sbjct  148   EKLRSKAQLPASRSNQQQCRYLYYLGRIRAIQLEYSDAKECLTQAHRKAPKLAKGFALEL  207

Query  916   NKWAVIVRLLLGEIPER---TVFMQKG--MEKALRPYFELTNAVRIGDLELFRQVAEKFS  752
              KW  +VRLLLGEIPE+   T  +  G   ++AL PY ELT AVR+GDLE FR V E   
Sbjct  208   TKWITVVRLLLGEIPEKKDLTTAVSGGAAAQRALLPYLELTGAVRLGDLEKFRAVQEAHE  267

Query  751   STFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSK  572
             + F  D+T NL+ RLR NVIRTGLR +S+AYS ISL DVA+KL L   +   D E +V+K
Sbjct  268   AAFRADKTTNLVTRLRRNVIRTGLRRVSLAYSAISLDDVAQKLGLGEGD--GDVEFVVAK  325

Query  571   AIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNS  392
             AIRDG IDAT+D     M S +  D+YST EPQ AF++RIAFCL+ HNEAV+A+R+P   
Sbjct  326   AIRDGGIDATIDHDARTMHSSDATDVYSTGEPQAAFHARIAFCLDTHNEAVKAMRYPDKV  385

Query  391   HkekesaekrrerqqqeqELAKHIAEEDD-DDF  296
              K K   E++  + +  +ELA HI +ED+ D+F
Sbjct  386   KKGKGDGERKSAKDRDLEELAMHIMDEDEMDEF  418



>emb|CEF96488.1| 26S proteasome regulatory subunit, C-terminal [Ostreococcus tauri]
Length=490

 Score =   280 bits (716),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 171/233 (73%), Gaps = 3/233 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             EKLRS+    ++ S QQ CRY +YLG++R +QLEY++AKE L QA +KAP++A GFR++C
Sbjct  226   EKLRSRVTLPQSRSIQQQCRYAYYLGRIRAVQLEYSEAKEYLTQAYQKAPTSAKGFRLEC  285

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              KW  IVR+LLGEIP+R    Q  M  AL PYFEL  AVR+GDL  F+   E    TF +
Sbjct  286   LKWITIVRMLLGEIPQRKELTQPEMCAALTPYFELVQAVRLGDLTAFQSATETHGKTFHE  345

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+ N+LI RLR NVIRTGL  I+ AYS+ISLADVA+KL L S   + DAES+V+KAIRDG
Sbjct  346   DKLNHLITRLRANVIRTGLTRINTAYSKISLADVAEKLGLTS---VEDAESVVAKAIRDG  402

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPP  398
              +DA +D     M SKET D+YST EPQ AF+ RIAFC++ HNEAV+A+R+PP
Sbjct  403   NVDAVIDHAAKVMYSKETTDVYSTTEPQDAFHVRIAFCMDTHNEAVKAMRYPP  455



>ref|XP_005181586.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musca domestica]
Length=489

 Score =   275 bits (702),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 204/269 (76%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR  
Sbjct  224   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKAPQTAAVGFRQT  283

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q  + K+L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  284   VQKLIIVVELLLGNIPERQVFRQAALRKSLAPYFQLTQAVRLGNLKRFGEVVENFGPKFQ  343

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AK+L LDS     DAE IV+KAIRD
Sbjct  344   QDHTYTLIIRLRHNVIKTAIRSIGLSYSRISPADIAKRLMLDSPE---DAEFIVAKAIRD  400

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH-ke  383
             G I+ATLD  N  M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ K+
Sbjct  401   GVIEATLDPANNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  460

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE++DD F
Sbjct  461   LESAEERREREQQDLELAKEMAEDEDDGF  489



>ref|XP_005850128.1| hypothetical protein CHLNCDRAFT_20545 [Chlorella variabilis]
 gb|EFN58026.1| hypothetical protein CHLNCDRAFT_20545 [Chlorella variabilis]
Length=480

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 170/232 (73%), Gaps = 4/232 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFE-AHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQ  920
             E+LR+KA R E + S QQ CRYL YLG++R +QLEY++AK+ L QA RKAP++A+GFRV 
Sbjct  218   ERLRAKAQRPETSRSMQQACRYLHYLGRIRAVQLEYSEAKDCLQQAVRKAPTSAVGFRVA  277

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               KW V+VRLLLGE+P+RT F        L PYF+LT AVR GDL  F  VA    + F 
Sbjct  278   VAKWLVLVRLLLGEVPDRTEFTAPDTAAPLAPYFDLTQAVRGGDLSAFSAVAAAHEAVFR  337

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              DRT+NL+VRLRHNVIR GLR IS+AY RISLADVA KL L S   + D ESIV+KAIRD
Sbjct  338   ADRTHNLVVRLRHNVIRAGLRRISLAYFRISLADVAAKLGLAS---VTDTESIVAKAIRD  394

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRF  404
             G I+  +D   G + +    DIY+T+EPQ AF++RIAFC+++HNEAV+A+R+
Sbjct  395   GGIEGVIDHEAGTLEAARPADIYATDEPQAAFHARIAFCMDVHNEAVKAMRY  446



>gb|EFX72606.1| hypothetical protein DAPPUDRAFT_227411 [Daphnia pulex]
Length=496

 Score =   273 bits (697),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 195/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL SK+   E+ SN ++ RYL+YLG+++ IQLEY+ A   LLQA RKAP   A+GF+  
Sbjct  230   DKLVSKSVFPESGSNNEWSRYLYYLGRIKAIQLEYSQAHTHLLQAIRKAPQHTAVGFKQT  289

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  V V LL+G+IPER +F Q  M  AL PYF++T AVR+GD+  F QV E +  TF 
Sbjct  290   VQKLLVTVELLMGDIPERHIFRQSTMRHALAPYFQMTQAVRLGDIHRFNQVLENYGKTFQ  349

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R IS++YSRISLAD+A KL LDSA    DAE IV+KAIRD
Sbjct  350   ADHTYTLIIRLRHNVIKTAIRAISLSYSRISLADIAHKLLLDSAE---DAEFIVAKAIRD  406

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A LD     M SKE+ D+YST EPQ+AF+ RI FCL +HN++V+A+RFPP ++ + 
Sbjct  407   GVIEAWLDHEGKFMQSKESIDVYSTKEPQLAFHQRITFCLQIHNQSVKAMRFPPKAYNKD  466

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AEEDDD F
Sbjct  467   LESAEERREREQQDLEYAKEMAEEDDDGF  495



>ref|XP_002424930.1| 26S proteasome regulatory subunit S3, putative [Pediculus humanus 
corporis]
 gb|EEB12192.1| 26S proteasome regulatory subunit S3, putative [Pediculus humanus 
corporis]
Length=505

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 200/267 (75%), Gaps = 5/267 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E+ SN ++ R+L+YLG ++  +LEY+ A + L+QA RKAP +AA+GFR  
Sbjct  240   DKLVSKSVFPESASNNEWARFLYYLGCIKAARLEYSAAHKHLVQAMRKAPQTAAVGFRQT  299

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
             C K AV V LLLG+IPER +F Q  + KAL PYF+LT AVR+GDL  F +V E F   F 
Sbjct  300   CQKLAVTVDLLLGDIPERQIFRQATLRKALAPYFQLTQAVRLGDLHHFSEVLENFKPQFE  359

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T+ LI RLRHNVI+T +R+I ++Y RIS AD+AKKL LDS     DAE IV+KAIRD
Sbjct  360   ADHTSTLIHRLRHNVIKTAIRSIGLSYVRISPADIAKKLGLDSPE---DAEFIVAKAIRD  416

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH-ke  383
             G I+ATLD   G M SKET DIY T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ K+
Sbjct  417   GVIEATLDPETGTMRSKETCDIYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKD  476

Query  382   kesaekrrerqqqeqELAKHIAEEDDD  302
              ESAE+RRER+QQ+ ELAK +AEEDDD
Sbjct  477   LESAEERREREQQDLELAKEMAEEDDD  503



>ref|XP_003705277.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Megachile rotundata]
 ref|XP_012145131.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Megachile rotundata]
Length=496

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 201/269 (75%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA++ L+QA RKAP S A+GFR  
Sbjct  230   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSDARKYLVQALRKAPQSTAVGFRQT  289

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  M +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  290   VQKLAVTVELLLGDIPERQTFRQAAMRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  349

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LDS+    DAE IV+KAIRD
Sbjct  350   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLDSS---VDAEFIVAKAIRD  406

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  407   GVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  466

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  467   LESAEERREREQQDLELAKEMAEEDDDGF  495



>ref|XP_005107539.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
isoform X2 [Aplysia californica]
Length=506

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 194/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL SK+   ++ SN ++ R+LFYLG+++  QLEY+DA + LLQA RKAP  +A+GF+  
Sbjct  240   DKLVSKSNFPDSASNNEWARFLFYLGRIKAAQLEYSDAHKHLLQAMRKAPQHSAVGFKQT  299

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A+ V LLLGEIP+R+VF Q  M K L PYF+LT AVR G+L+ F +    F + F 
Sbjct  300   VQKLAITVELLLGEIPDRSVFRQPPMRKTLAPYFQLTQAVRGGNLQKFNETLATFGTKFQ  359

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              + T  LIVRLRHNVI+TG+R ISI+YSRISL+D+A +L LDS     DAE IV+KAIRD
Sbjct  360   AENTYTLIVRLRHNVIKTGVRMISISYSRISLSDIAHRLALDSPE---DAEFIVAKAIRD  416

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+AT+D  +G + SKETGD+YST EP  AF+ RI+FCL++HN++V+A+RFPP S+ + 
Sbjct  417   GVIEATIDHEHGYVQSKETGDVYSTKEPMAAFHQRISFCLDIHNQSVKAMRFPPKSYNKD  476

Query  379   esaekrrerqqqeqEL-AKHIAEEDDDDF  296
               + + R  ++Q++   AK IAEED D F
Sbjct  477   LESAEERREREQQELESAKEIAEEDFDGF  505



>ref|XP_011564474.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Plutella xylostella]
Length=494

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR  
Sbjct  228   DKLVSKSVYPESASNNEWARFLYYLGRIKAARLEYSDAHKHLVQALRKAPQTAAVGFRQT  287

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A++V LLLG+IPER +F    + K+L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  288   VQKLAIVVELLLGDIPERAIFRHAPLRKSLAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  347

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             KD T  LI+RLR NVI+T +R+I ++YSRIS  D+A+KL LDSA    DAE IV+KAIRD
Sbjct  348   KDHTFTLILRLRQNVIKTAIRSIGLSYSRISPKDIARKLGLDSAE---DAEFIVAKAIRD  404

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M +KE+ DIY T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  405   GVIEATLDPERGYMSNKESSDIYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  464

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  465   LESAEERREREQQDLELAKEMAEEDDDGF  493



>ref|XP_011548125.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Plutella xylostella]
Length=494

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR  
Sbjct  228   DKLVSKSVYPESASNNEWARFLYYLGRIKAARLEYSDAHKHLVQALRKAPQTAAVGFRQT  287

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A++V LLLG+IPER +F    + K+L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  288   VQKLAIVVELLLGDIPERAIFRHAPLRKSLAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  347

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             KD T  LI+RLR NVI+T +R+I ++YSRIS  D+A+KL LDSA    DAE IV+KAIRD
Sbjct  348   KDHTFTLILRLRQNVIKTAIRSIGLSYSRISPKDIARKLGLDSAE---DAEFIVAKAIRD  404

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M +KE+ DIY T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  405   GVIEATLDPERGYMSNKESSDIYCTREPQLAFHPRISFCLDLHNQSVKAMRYPPKSYGKE  464

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  465   LESAEERREREQQDLELAKEMAEEDDDGF  493



>ref|XP_002595252.1| hypothetical protein BRAFLDRAFT_268075 [Branchiostoma floridae]
 gb|EEN51264.1| hypothetical protein BRAFLDRAFT_268075 [Branchiostoma floridae]
Length=512

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 198/266 (74%), Gaps = 5/266 (2%)
 Frame = -1

Query  1093  KLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQC  917
             KL SK+   E  +N ++ R+L+Y+G+++ IQLEY+ A   L +A RKAP SAA+GF+   
Sbjct  249   KLVSKSTFPETANNNEWARFLYYIGRIKAIQLEYSAAHGHLTEALRKAPTSAAVGFKQTV  308

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +K A+ V LLLGEIPER+ F+   M+++L PYF+LT AVR G+L  F +V EK+   F  
Sbjct  309   SKLAITVELLLGEIPERSQFISPAMKRSLAPYFQLTQAVRTGNLAKFNEVLEKYGDRFQA  368

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRDG
Sbjct  369   DNTWTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRDG  425

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
              I+AT+D   G + SKE  DIYST EPQ+AF+ RI+FCL++HN++V+A+RFPP S+ +  
Sbjct  426   VIEATIDHEKGYVQSKENTDIYSTREPQLAFHQRISFCLDIHNQSVKAMRFPPKSYSKDL  485

Query  376   saekrr-erqqqeqELAKHIAEEDDD  302
              + + + ER++Q+ ELAK IA+++DD
Sbjct  486   ESAEEQRERERQDLELAKEIADDEDD  511



>sp|Q9U5Z8.1|PSMD3_ANOST RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Diphenol 
oxidase A2 component; Short=DOX-A2 [Anopheles stephensi]
 emb|CAB61220.1| 26S proteasome regulatory subunit [Anopheles stephensi]
Length=500

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 196/269 (73%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN +  R+L+YLG+++  +LEY+ A + L+QA RKAP  AA+GFR  
Sbjct  235   DKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQT  294

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER VF Q  + ++L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  295   VQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLENFGEQFR  354

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  355   QDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSPE---DAEFIVAKAIRD  411

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G IDATLD   G M +KE+ DIYST EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  412   GVIDATLDPEKGYMRTKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  471

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDDDF
Sbjct  472   LESAEERREREQQDLELAKEMAEEDDDDF  500



>ref|XP_001605959.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nasonia vitripennis]
Length=497

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E  SN ++ R+L+YLG++++ +LEY+DA + L+QA RKAP + A+GFR  
Sbjct  231   DKLVLKSTFPETASNNEWARHLYYLGRIKSARLEYSDAHKHLVQAMRKAPQTTAVGFRQT  290

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  291   VQKLAVTVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  350

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LDS     DAE IV+KAIRD
Sbjct  351   SDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLDSG---VDAEFIVAKAIRD  407

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  408   GVIEATLDPENGYMRSKETTDIYCTREPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  467

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  468   LESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_002051535.1| GJ11636 [Drosophila virilis]
 gb|EDW63690.1| GJ11636 [Drosophila virilis]
Length=495

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  230   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  289

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L PYF+LT AVR+G+L+ F  V  +F   F 
Sbjct  290   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGPYFQLTQAVRLGNLKRFGDVVSQFGPKFQ  349

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  350   MDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPKDIAKRLMLDSAE---DAEFIVSKAIRD  406

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  407   GVIEATLDPAQNYMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  466

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  467   LESAEERREREQQDLELAKEMAEDDEDGF  495



>ref|XP_004996585.1| proteasome 26S non-ATPase subunit 3 [Salpingoeca rosetta]
 gb|EGD81381.1| proteasome 26S non-ATPase subunit 3 [Salpingoeca rosetta]
Length=487

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 177/236 (75%), Gaps = 3/236 (1%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAALGFRVQC  917
             E L SK    E   N +  R+L+YLG+++ +QLEYT+A   LLQAARKAP+ A+GF+   
Sbjct  231   ELLVSKVTFPETAPNNETARFLYYLGRIKAVQLEYTEADHCLLQAARKAPAGAIGFKQHV  290

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +K  VIV++LLGEIPER +F +  +++ L PYF+LT+AVR+G++  F +V ++  + F  
Sbjct  291   HKLHVIVKMLLGEIPERDLFREPHLKRPLEPYFKLTHAVRLGEVGTFSRVVQEHRAKFCA  350

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T  LI+RLR +VI+ G++ IS +YSRISLAD+AKKL LDSA    DAE +V+KAI+DG
Sbjct  351   DKTFKLILRLRQSVIKAGIKTISFSYSRISLADLAKKLGLDSA---LDAEYVVAKAIKDG  407

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH  389
              IDAT+D + G + SKE  D+YSTNEPQ AF+ RIAFCL +HNE+V+A+R+PPN+H
Sbjct  408   VIDATIDHSAGTVTSKEVVDVYSTNEPQEAFHRRIAFCLKLHNESVKAMRYPPNAH  463



>gb|ETN60770.1| 26S proteasome regulatory subunit S3 [Anopheles darlingi]
Length=495

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 196/269 (73%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP  AA+GFR  
Sbjct  230   DKLVNKSVFPETASNNEWARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQT  289

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER VF Q  + ++L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  290   VQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRLGNLQRFGEVLENFGEQFR  349

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  350   QDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSPE---DAEFIVAKAIRD  406

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  407   GVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  466

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  467   LESAEERREREQQDLELAKEMAEEDDDGF  495



>ref|XP_004931019.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Bombyx mori]
Length=494

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 203/269 (75%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E  SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR  
Sbjct  228   DKLVSKSVFPENASNNEWARFLYYLGRIKAARLEYSDAHKHLVQALRKAPQTAAVGFRQT  287

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A++V LLLG+IPER +F Q  + KAL PYF+LT AVR+G+L+ F +V E +   F 
Sbjct  288   VQKLAIVVELLLGDIPERVIFRQAPLRKALAPYFQLTQAVRLGNLQRFGEVLENYGPQFR  347

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLR NVI+T +R+I ++YSRIS  D+A+KL LDSA    DAE IV+KAIRD
Sbjct  348   NDHTFTLILRLRQNVIKTAIRSIGLSYSRISPKDIARKLGLDSAE---DAEFIVAKAIRD  404

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH-ke  383
             G I+ATLD   G M +KE+ DIY T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ KE
Sbjct  405   GVIEATLDPVKGYMSNKESSDIYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  464

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  465   LESAEERREREQQDLELAKEMAEEDDDGF  493



>gb|KFB39121.1| AGAP009082-PA-like protein [Anopheles sinensis]
Length=497

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 195/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN +  R+L+YLG+++  +LEY+ A + L+QA RKAP  AA+GFR  
Sbjct  232   DKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQT  291

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER VF Q  + ++L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  292   VQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLENFGEQFR  351

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+AKKL LDS     DAE IV+KAIRD
Sbjct  352   QDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIAKKLGLDSPE---DAEFIVAKAIRD  408

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  409   GVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  468

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  469   LESAEERREREQQDLELAKEMAEEDDDGF  497



>ref|XP_001987942.1| GH10894 [Drosophila grimshawi]
 gb|EDW02809.1| GH10894 [Drosophila grimshawi]
Length=494

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L PYF+LT AVR+G+L+ F  V  +F   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLTPYFQLTQAVRLGNLKRFGDVVAQFGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPKDIAKRLVLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNYMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|XP_002067151.1| GK24169 [Drosophila willistoni]
 gb|EDW78137.1| GK24169 [Drosophila willistoni]
Length=500

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  235   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  294

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L PYF+LT AVR+G+L+ F  V  +F   F 
Sbjct  295   VQKLIIVVELLLGNIPERVVFRQAGLRQSLAPYFQLTQAVRMGNLKRFGDVVSQFGPKFQ  354

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  355   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLVLDSAE---DAEFIVSKAIRD  411

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  412   GVIEATLDPAQNYMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  471

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  472   LESAEERREREQQDLELAKEMAEDDEDGF  500



>ref|XP_002002367.1| GI13097 [Drosophila mojavensis]
 gb|EDW11809.1| GI13097 [Drosophila mojavensis]
Length=495

 Score =   269 bits (687),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  230   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  289

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L PYF LT AVR+G+L+ F  V  +F   F 
Sbjct  290   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGPYFSLTQAVRLGNLKRFGDVVSQFGPKFQ  349

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  350   MDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPKDIAKRLMLDSAE---DAEFIVSKAIRD  406

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  407   GVIEATLDPEQNYMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  466

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  467   LESAEERREREQQDLELAKEMAEDDEDGF  495



>gb|AJK90582.1| 26S proteasome non-ATPase regulatory subunit 3 [Laodelphax striatella]
Length=498

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 201/269 (75%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E  SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP +AA+GFR  
Sbjct  232   DKLVSKSVFPETASNNEWARFLYYLGRIKAARLEYSAAHKHLVQAMRKAPQTAAVGFRQT  291

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  + +AL PYF+LT+AVR+GDL+ F +V E F   F 
Sbjct  292   AQKLAVTVELLLGDIPERQTFRQAALRRALAPYFQLTHAVRLGDLQRFGEVLENFGPQFR  351

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRI+ A++AKKL LDS     DAE IV+KAIRD
Sbjct  352   SDHTFTLILRLRHNVIKTAIRSIGLSYSRITPANIAKKLGLDSPE---DAEFIVAKAIRD  408

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD   G + SKE+ DIY T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ + 
Sbjct  409   GVIEATLDPEKGYVQSKESTDIYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKD  468

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  469   LESAEERREREQQDLELAKEMAEEDDDGF  497



>ref|XP_784007.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X1 [Strongylocentrotus purpuratus]
 ref|XP_011673622.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X2 [Strongylocentrotus purpuratus]
Length=501

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 201/269 (75%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN ++ R+L+YLG+++ IQLEY++A ++L+QA RKAP   A+GF+  
Sbjct  236   DKLVAKSTFPEQASNHEWARFLYYLGRIKAIQLEYSEAHKNLIQALRKAPQYTAVGFKQT  295

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K A++V+LLLGEIP+R++F Q   +K L PYF+LT AVR G+L LF Q+ + F++ F 
Sbjct  296   VHKLAIVVQLLLGEIPDRSIFRQSAYKKTLVPYFQLTQAVRSGNLGLFNQMLKDFAAKFQ  355

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              + T  LI+RL HNVI+TG+R IS++YS+ISL+DVAKKL+LDS     DAE IV+KAIRD
Sbjct  356   SEFTYTLIIRLHHNVIKTGVRMISLSYSKISLSDVAKKLQLDSPE---DAEFIVAKAIRD  412

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+A++D   G + SKET D+Y+T EP  AF+ RI+FCL++HN++V+A+RFPP S+ + 
Sbjct  413   GVIEASIDHEKGYVQSKETVDVYTTREPMTAFHQRISFCLDIHNQSVKAMRFPPKSYNKD  472

Query  379   esaekrrerqqqeq-ELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AE+D++ F
Sbjct  473   LESAEDRREREQQDFELAKEMAEDDEETF  501



>ref|XP_011494959.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Ceratosolen solmsi marchali]
Length=499

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E  SN ++ R+L+YLG++++ +LEY+ A + L+QA RKAP S A+GFR  
Sbjct  233   DKLVLKSTFPETASNNEWARFLYYLGRIKSARLEYSAAHKYLVQAMRKAPQSTAVGFRQT  292

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  293   VQKLAVTVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  352

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LDS     DAE IV+KAIRD
Sbjct  353   SDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLDSG---VDAEFIVAKAIRD  409

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  410   GVIEATLDPENGYMRSKETTDIYCTREPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  469

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD +
Sbjct  470   LESAEERREREQQDLELAKEMAEEDDDGY  498



>dbj|BAM18273.1| regulatory particle non-ATPase 3, Dox-A2 [Papilio xuthus]
Length=495

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 197/269 (73%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E  SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR  
Sbjct  229   DKLVSKSVFPENASNNEWARFLYYLGRIKAARLEYSDAHKHLVQALRKAPQTAAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A++V LLLG+IPER +F Q  + KAL PYF+LT AVR+G+L+ F +V E +   F 
Sbjct  289   VQKLAIVVELLLGDIPERAIFRQAQLRKALAPYFQLTQAVRLGNLQRFGEVLENYGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLR NVI+T +R+I ++YSRIS  D+A+KL LDSA    DAE IV+KAIRD
Sbjct  349   TDHTFTLILRLRQNVIKTAIRSIGLSYSRISPKDIARKLGLDSAE---DAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M +KE+ D+Y T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  406   GVIEATLDPEKGYMSNKESSDLYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  465

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_004707502.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Echinops 
telfairi]
Length=358

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  92    EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  151

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  152   VHKLLIVVELLLGEIPDRLQFRQHSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  211

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  212   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  268

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  269   GVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  328

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  329   LESAEERREREQQDLEFAKEMAEDDDDSF  357



>ref|XP_009075840.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory 
subunit 3, partial [Acanthisitta chloris]
Length=303

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  37    EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  96

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  97    VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  156

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  157   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  213

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  214   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  273

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  274   LESAEERREREQQDLEFAKEMAEDDDDGF  302



>ref|XP_008688097.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Ursus maritimus]
Length=429

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SKA   E  SN ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  163   EKLASKAAFPEQASNGEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  222

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  223   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  282

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  283   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  339

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  340   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  399

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  400   LESAEERREREQQDLEFAKEMAEDDDDSF  428



>gb|KFH67510.1| 26S proteasome regulatory subunit N3 [Mortierella verticillata 
NRRL 6337]
Length=517

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 172/234 (74%), Gaps = 5/234 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPSAAL--GFRV  923
             +KL SK    EA +N Q  RY++YLG+++ IQLEYT++ +SLLQA RKAP   +  GF+ 
Sbjct  248   DKLVSKTTFPEAATNNQLARYMYYLGRIKAIQLEYTESHQSLLQAVRKAPQNNITAGFQQ  307

Query  922   QCNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTF  743
             + NK  +IV+LL+GEIPER++F Q  + KAL PYF++T AVR+GDL  F++     + TF
Sbjct  308   EANKLLIIVQLLMGEIPERSLFRQPVLRKALVPYFQITQAVRVGDLNKFQETLAAHAPTF  367

Query  742   SKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIR  563
             + D+   LI+RLRHNVI+TG+R IS++YSRISL DV  KL LDS     DAE IV+K+IR
Sbjct  368   NADKNYTLILRLRHNVIKTGIRMISLSYSRISLRDVCLKLHLDSEE---DAEYIVAKSIR  424

Query  562   DGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFP  401
             DG IDAT+D   G M SKE  DIYSTNEPQ AF+ RI FCL +HN++V+A+RFP
Sbjct  425   DGVIDATIDHEKGYMRSKENVDIYSTNEPQNAFHQRIGFCLKLHNDSVKAMRFP  478



>ref|XP_006814940.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
isoform X2 [Saccoglossus kowalevskii]
Length=499

 Score =   267 bits (683),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 195/266 (73%), Gaps = 4/266 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E+ SN ++ R+L+Y+G+++ IQLEY++A + LLQA RKAP   A+GF+  
Sbjct  235   DKLVAKSTYPESASNNEWARFLYYMGRIKAIQLEYSEAHKHLLQALRKAPQHTAVGFKQT  294

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              NK A+ V LLLG+IP+R++F Q  M K L PYF+LT AVR G+L  F +V E F   F 
Sbjct  295   VNKLAITVELLLGDIPDRSLFRQPTMRKTLVPYFQLTQAVRTGNLARFNEVLENFGPKFQ  354

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              + T  LI+RLRHNVI+TG+R I+++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  355   AEDTYTLIIRLRHNVIKTGVRMINLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  411

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+A +D   G + SKE  DIYST EP  AF+ RI FCL++HN +++A+RFPP S+ + 
Sbjct  412   GVIEAIIDHEKGYVQSKENIDIYSTREPMGAFHQRITFCLDIHNNSIKAMRFPPKSYSKD  471

Query  379   esaekrrerqqqeqELAKHIAEEDDD  302
               + +RRER+QQ+ ELAK +AE+DD+
Sbjct  472   LESAERREREQQDLELAKEMAEDDDE  497



>ref|XP_623947.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Apis mellifera]
 ref|XP_006572172.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Apis mellifera]
Length=495

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP S A+GFR  
Sbjct  229   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQALRKAPQSTAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  M +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  289   VQKLAVTVELLLGDIPERQTFRQAAMRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LDS+    DAE IV+KAIRD
Sbjct  349   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLDSS---VDAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_003689802.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Apis florea]
Length=495

 Score =   267 bits (682),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP S A+GFR  
Sbjct  229   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQALRKAPQSTAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  M +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  289   VQKLAVTVELLLGDIPERQTFRQAAMRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LDS+    DAE IV+KAIRD
Sbjct  349   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLDSS---VDAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_011143024.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Harpegnathos saltator]
 gb|EFN82224.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Harpegnathos 
saltator]
Length=501

 Score =   267 bits (683),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  235   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  294

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  295   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  354

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LDS+    DAE IV+KAIRD
Sbjct  355   SDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLDSS---VDAEFIVAKAIRD  411

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  412   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  471

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  472   LESAEERREREQQDLELAKEMAEEDDDGF  500



>ref|XP_006608624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Apis dorsata]
Length=495

 Score =   267 bits (682),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP S A+GFR  
Sbjct  229   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQALRKAPQSTAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  M +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  289   VQKLAVTVELLLGDIPERQTFRQAAMRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LDS+    DAE IV+KAIRD
Sbjct  349   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLDSS---VDAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_009826168.1| hypothetical protein H257_03673 [Aphanomyces astaci]
 gb|ETV84476.1| hypothetical protein H257_03673 [Aphanomyces astaci]
Length=478

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 191/266 (72%), Gaps = 5/266 (2%)
 Frame = -1

Query  1093  KLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQC  917
             KL SK    EA SN QF RYL+Y+GK+  +QL+YTD+   L+Q+ RKAP + A+GFR   
Sbjct  214   KLVSKTTFPEAVSNNQFVRYLYYVGKIHAVQLDYTDSYTKLMQSIRKAPQNTAVGFRRTV  273

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +K A+IV+LL+GE+PER++F Q   + AL PY +LTNAVR+G+LE F  V    + TF  
Sbjct  274   HKLAIIVQLLMGEVPERSIFNQDEFQVALEPYLKLTNAVRLGNLEDFTTVLTHHAETFKT  333

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T  LI+RLRHNVI+TGLR I+ +YS+I   D+  KL LD+     +AE +V+KAI+DG
Sbjct  334   DKTYTLILRLRHNVIKTGLRKINTSYSKIRFTDICAKLALDTPQ---NAEFVVAKAIKDG  390

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
              IDA +D  NG M SKET D+Y TNEPQ AF+ RI FCL++HNEAV+A+R+PP ++K+  
Sbjct  391   VIDAVIDHKNGWMQSKETVDVYVTNEPQQAFHKRITFCLDVHNEAVKAMRYPPGAYKKDL  450

Query  376   saekr-rerqqqeqELAKHIAEEDDD  302
              + +   ER++QE+ELAK I +E DD
Sbjct  451   ESAEERLEREKQEEELAKEIEDELDD  476



>emb|CDH49942.1| proteasome regulatory particle subunit [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=495

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 7/268 (3%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP--SAALGFRV  923
             +KL SK+   E   N Q  RY +YLG+++ +QL YT A   L QA RKAP  +   GF+ 
Sbjct  226   DKLVSKSAFPENAGNNQAARYAYYLGRIKALQLAYTQAHTYLTQAIRKAPQNNVTAGFQQ  285

Query  922   QCNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTF  743
                K+ ++V+LLLGEIPER++F Q  ++KAL PY  +T AVR+GDL  F++   +F S F
Sbjct  286   TVYKFFIVVQLLLGEIPERSIFRQPILKKALVPYLYITQAVRVGDLNKFQEGLAQFDSVF  345

Query  742   SKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIR  563
              KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LDS     DAE IVSKAIR
Sbjct  346   KKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICLKLHLDSEE---DAEFIVSKAIR  402

Query  562   DGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke  383
             DG IDATLD   G M SKE  DIYSTNEPQ AFN+RI FCLN+HN+AV+A+RFP ++H  
Sbjct  403   DGVIDATLDHNGGFMKSKEIVDIYSTNEPQHAFNNRITFCLNLHNDAVKAMRFPLDAH--  460

Query  382   kesaekrrerqqqeqELAKHIAEEDDDD  299
             ++        +++E+ELA+ IAE D DD
Sbjct  461   RKELANAEAARERERELAQEIAEGDMDD  488



>ref|XP_011647981.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Pogonomyrmex barbatus]
Length=504

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  238   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  297

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  298   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  357

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LDS+    DAE IV+KAIRD
Sbjct  358   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLDSS---VDAEFIVAKAIRD  414

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  415   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  474

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  475   LESAEERREREQQDLELAKEMAEEDDDGF  503



>gb|ELU15663.1| hypothetical protein CAPTEDRAFT_153237 [Capitella teleta]
Length=515

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 173/237 (73%), Gaps = 4/237 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL SK+   E+ SN ++ RYLFYLG+++ IQLEY++A   L+QA RKAP   A+GF+  
Sbjct  249   DKLVSKSAFPESASNNEWARYLFYLGQIKAIQLEYSEAHRHLVQATRKAPQHTAVGFKQI  308

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K+A+ V LLLG+IP+R +F    M+K L+PYF+LT AVRIG L  F +V E   S F 
Sbjct  309   VQKFAITVELLLGDIPDRAIFRHHSMKKTLQPYFQLTQAVRIGSLSTFNKVLEAHGSRFQ  368

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             KD T  LI+RLRHNVI+TG+R I+++YSRISLADVA KL LDSA    DAE IV+KAIRD
Sbjct  369   KDGTYTLIIRLRHNVIKTGVRMINLSYSRISLADVASKLMLDSAE---DAEFIVAKAIRD  425

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH  389
             G I+AT++   G + SKE  DIYST EP  AF+ RI FCLN HN++++A+RFPP S+
Sbjct  426   GVIEATIEHEQGFVRSKEHCDIYSTREPLDAFHQRITFCLNTHNQSIKAMRFPPKSY  482



>ref|XP_011883079.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vollenhovia emeryi]
Length=504

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  238   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  297

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  298   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  357

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LDS+    DAE IV+KAIRD
Sbjct  358   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLDSS---VDAEFIVAKAIRD  414

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  415   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  474

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  475   LESAEERREREQQDLELAKEMAEEDDDGF  503



>emb|CDS04865.1| hypothetical protein LRAMOSA07395 [Absidia idahoensis var. thermophila]
Length=495

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 7/268 (3%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP--SAALGFRV  923
             +KL SK+   E   N Q  RY +YLG+++ +QL YT A   L QA RKAP  +   GF+ 
Sbjct  226   DKLVSKSAFPENAGNNQAARYAYYLGRIKALQLAYTQAHTYLTQAIRKAPQNNVTAGFQQ  285

Query  922   QCNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTF  743
                K+ ++V+LLLGEIPER++F Q  ++KAL PY  +T AVR+GDL  F++   +F S F
Sbjct  286   TVYKFFIVVQLLLGEIPERSIFRQPILKKALVPYLYITQAVRVGDLNKFQEGLAQFDSVF  345

Query  742   SKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIR  563
              KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LDS     DAE IVSKAIR
Sbjct  346   KKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICLKLHLDSEE---DAEFIVSKAIR  402

Query  562   DGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke  383
             DG IDATLD   G M SKE  DIYSTNEPQ AFN+RI FCLN+HN+AV+A+RFP ++H  
Sbjct  403   DGVIDATLDHNGGFMKSKEIVDIYSTNEPQHAFNNRITFCLNLHNDAVKAMRFPLDAH--  460

Query  382   kesaekrrerqqqeqELAKHIAEEDDDD  299
             ++        +++E+ELA+ IAE D DD
Sbjct  461   RKELANAEAARERERELAQEIAEGDMDD  488



>ref|XP_011695146.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Wasmannia auropunctata]
Length=506

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  240   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  299

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  300   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  359

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LDS+    DAE IV+KAIRD
Sbjct  360   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLDSS---VDAEFIVAKAIRD  416

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  417   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  476

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  477   LESAEERREREQQDLELAKEMAEEDDDGF  505



>ref|XP_012061456.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Atta cephalotes]
Length=503

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  237   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  296

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  297   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  356

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LDS+    DAE IV+KAIRD
Sbjct  357   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLDSS---VDAEFIVAKAIRD  413

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  414   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  473

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  474   LESAEERREREQQDLELAKEMAEEDDDGF  502



>ref|XP_005107538.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
isoform X1 [Aplysia californica]
Length=548

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 176/237 (74%), Gaps = 4/237 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL SK+   ++ SN ++ R+LFYLG+++  QLEY+DA + LLQA RKAP  +A+GF+  
Sbjct  240   DKLVSKSNFPDSASNNEWARFLFYLGRIKAAQLEYSDAHKHLLQAMRKAPQHSAVGFKQT  299

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A+ V LLLGEIP+R+VF Q  M K L PYF+LT AVR G+L+ F +    F + F 
Sbjct  300   VQKLAITVELLLGEIPDRSVFRQPPMRKTLAPYFQLTQAVRGGNLQKFNETLATFGTKFQ  359

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              + T  LIVRLRHNVI+TG+R ISI+YSRISL+D+A +L LDS     DAE IV+KAIRD
Sbjct  360   AENTYTLIVRLRHNVIKTGVRMISISYSRISLSDIAHRLALDSPE---DAEFIVAKAIRD  416

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH  389
             G I+AT+D  +G + SKETGD+YST EP  AF+ RI+FCL++HN++V+A+RFPP S+
Sbjct  417   GVIEATIDHEHGYVQSKETGDVYSTKEPMAAFHQRISFCLDIHNQSVKAMRFPPKSY  473



>ref|XP_003488721.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Bombus impatiens]
Length=495

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP S A+GFR  
Sbjct  229   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQALRKAPQSTAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  M +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  289   VQKLAVTVELLLGDIPERQTFRQAAMRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AKKL LDS+    DAE IV+KAIRD
Sbjct  349   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIAKKLGLDSS---VDAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_003395331.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Bombus terrestris]
Length=495

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP S A+GFR  
Sbjct  229   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQALRKAPQSTAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER  F Q  M +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  289   VQKLAVTVELLLGDIPERQTFRQAAMRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AKKL LDS+    DAE IV+KAIRD
Sbjct  349   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIAKKLGLDSS---VDAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_011723582.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X2 [Macaca nemestrina]
Length=404

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  138   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  197

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  198   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  257

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  258   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  314

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  315   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  374

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  375   LESAEERREREQQDLEFAKEMAEDDDDSF  403



>gb|EHJ74217.1| putative 26S proteasome regulatory subunit S3 [Danaus plexippus]
Length=495

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 195/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E  SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR  
Sbjct  229   DKLVSKSVFPENASNNEWARFLYYLGRIKAARLEYSDAHKHLVQALRKAPQTAAVGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K A++V LLLG+IPER +F Q  + K+L PYF+LT AVR+G+L+ F +V E +   F 
Sbjct  289   VQKLAIVVELLLGDIPERAIFRQAPLRKSLAPYFQLTQAVRLGNLQRFGEVLENYGPQFR  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLR NVI+T +R+I ++YSRIS  D+A+KL LDSA    DAE IV+KAIRD
Sbjct  349   NDHTFTLILRLRQNVIKTAIRSIGLSYSRISPKDIARKLGLDSAE---DAEFIVAKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M +KE+ DIY T EPQ+AF+ RI FCL +HN++V+A+R+PP S+ ++
Sbjct  406   GVIEATLDPEKGYMSNKESSDIYCTREPQLAFHQRIYFCLELHNQSVKAMRYPPKSYGKE  465

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  466   LESAEERREREQQDLELAKEMAEEDDDGF  494



>gb|KDO29869.1| hypothetical protein SPRG_04936 [Saprolegnia parasitica CBS 223.65]
Length=480

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 192/266 (72%), Gaps = 5/266 (2%)
 Frame = -1

Query  1093  KLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQC  917
             KL SK    EA SN QF RYL+Y+GK+  +QLEYTD+   L+Q+ RKAP + A+GFR   
Sbjct  216   KLVSKTTFPEAVSNNQFVRYLYYVGKIHAVQLEYTDSYNKLMQSIRKAPQNTAIGFRRTV  275

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              K A+IV+LL+GE+PER++F Q  ++ AL PY +LTNAVR+G+LE F  V  +F+  F  
Sbjct  276   YKLAIIVQLLMGEVPERSIFNQAELKTALTPYLQLTNAVRVGNLEDFTAVLNQFADVFKA  335

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+ LI+RLRHNVI+TGLR I+ +YS+I  +D+  KL LD+     +AE + +KAIRDG
Sbjct  336   DKTHTLILRLRHNVIKTGLRKINTSYSKILFSDICAKLALDTPQ---NAEFVCAKAIRDG  392

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
              IDA +D  +G M SKET D+Y+T EPQ AF+ RI FCL++HNEAV+A+R+PP ++K+  
Sbjct  393   VIDAVIDHKHGWMQSKETVDVYATTEPQQAFHKRITFCLDVHNEAVKAMRYPPGAYKKDL  452

Query  376   saekr-rerqqqeqELAKHIAEEDDD  302
              + +   ER++QE ELAK I EE D+
Sbjct  453   ESAEERLEREKQEDELAKEIEEELDE  478



>ref|XP_008870910.1| hypothetical protein H310_07313 [Aphanomyces invadans]
 gb|ETW00775.1| hypothetical protein H310_07313 [Aphanomyces invadans]
Length=482

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 172/236 (73%), Gaps = 4/236 (2%)
 Frame = -1

Query  1093  KLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQC  917
             KL SK    EA SN QF RYL+Y+GK+  +QL+YTD+   L+Q+ RKAP + A+GFR   
Sbjct  218   KLVSKTTFPEAVSNNQFVRYLYYVGKIHAVQLDYTDSYTKLMQSIRKAPQNTAVGFRRTV  277

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
             +K A+IV+LL+GE+PER++F Q   + AL PY +LTNAVR+G+LE F  V  + + TF  
Sbjct  278   HKLAIIVQLLMGEVPERSIFNQDEFKIALEPYLKLTNAVRLGNLEDFSSVLAQHADTFKS  337

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T  LI+RLRHNVI+TGLR I+ +YS+I   D+  KL LD+     +AE +V+KAI+DG
Sbjct  338   DKTYTLILRLRHNVIKTGLRKINTSYSKIRFTDICAKLALDTPQ---NAEFVVAKAIKDG  394

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH  389
              IDA +D  NG M SKET D+Y TNEPQ AF+ RI FCL++HNEAV+A+R+PP ++
Sbjct  395   VIDAVIDHKNGWMQSKETVDVYVTNEPQQAFHKRITFCLDVHNEAVKAMRYPPGAY  450



>ref|NP_956866.1| 26S proteasome non-ATPase regulatory subunit 3 [Danio rerio]
 gb|AAH56598.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Danio 
rerio]
 gb|AAH66451.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Danio 
rerio]
Length=503

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ +L  A RKAP   A+GF+  
Sbjct  237   EKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQT  296

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  297   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  356

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  357   TDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  413

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKET DIYST EPQ+AF+ RIAFCL++HN +V+A+RFPP ++ + 
Sbjct  414   GVIEASINHEKGFVQSKETMDIYSTREPQLAFHQRIAFCLDIHNMSVKAMRFPPKAYNKD  473

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  474   LESAEERREREQQDLEFAKEMAEDDDDSF  502



>ref|XP_011197796.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Bactrocera dorsalis]
Length=493

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 194/256 (76%), Gaps = 5/256 (2%)
 Frame = -1

Query  1057  SNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQCNKWAVIVRLLLG  881
             SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR    K  ++V LLLG
Sbjct  241   SNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKAPQNAAVGFRQTVQKLIIVVELLLG  300

Query  880   EIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSKDRTNNLIVRLRH  701
              IPER +F Q  + K+L PYF+LT AVR+G+L+ F +V E F   F +D T  LI+RLRH
Sbjct  301   NIPERQIFRQAALRKSLAPYFQLTQAVRLGNLQRFGEVVENFGPKFQQDHTYTLIIRLRH  360

Query  700   NVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDGAIDATLDRTNGC  521
             NVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRDG I+ATLD     
Sbjct  361   NVIKTAIRSIGLSYSRISPNDIAKRLMLDSAE---DAEFIVSKAIRDGVIEATLDPELNY  417

Query  520   MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-kesaekrrerqqq  344
             M SKE+ DIYST EPQ+AF+ RI FCL++HN++V+A+R+PP S+ +  ESAE+RRER+QQ
Sbjct  418   MRSKESTDIYSTREPQLAFHERITFCLDLHNQSVKAMRYPPKSYGKDLESAEERREREQQ  477

Query  343   eqELAKHIAEEDDDDF  296
             + ELAK +AE+D+D F
Sbjct  478   DLELAKEMAEDDEDGF  493



>ref|XP_001662261.1| AAEL012122-PA [Aedes aegypti]
 gb|EAT35739.1| AAEL012122-PA [Aedes aegypti]
Length=493

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 195/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN ++ R+L+YLG+++  +L+Y+ A + L+QA RKAP  AA+GFR  
Sbjct  228   DKLVNKSVFPETASNNEWARFLYYLGRIKAAKLDYSAAHKHLVQALRKAPQQAAVGFRQT  287

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER VF Q  + ++L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  288   VQKLVIVVELLLGDIPERQVFRQSALRRSLGPYFQLTQAVRMGNLQRFGEVLENFGDQFR  347

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  348   QDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIARKLGLDSHE---DAEFIVAKAIRD  404

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M SKE+ DIYST EPQ+AF+ RI FCL++HN++V+A+R+PP S+ ++
Sbjct  405   GVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRITFCLDLHNQSVKAMRYPPKSYGKE  464

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD +
Sbjct  465   LESAEERREREQQDLELAKEMAEEDDDGY  493



>ref|XP_011056581.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Acromyrmex echinatior]
 gb|EGI64232.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Acromyrmex 
echinatior]
Length=491

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 190/268 (71%), Gaps = 8/268 (3%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  230   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  289

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  290   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  349

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LDS+    DAE IV+KAIRD
Sbjct  350   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIARKLGLDSS---VDAEFIVAKAIRD  406

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+   
Sbjct  407   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSY---  463

Query  379   esaekrrerqqqeqELAKHIAEEDDDDF  296
                +     +QQ+ ELAK +AEEDDD F
Sbjct  464   -GKDLESAAEQQDLELAKEMAEEDDDGF  490



>ref|XP_008603832.1| hypothetical protein SDRG_00145 [Saprolegnia diclina VS20]
 gb|EQC42409.1| hypothetical protein SDRG_00145 [Saprolegnia diclina VS20]
Length=480

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 192/266 (72%), Gaps = 5/266 (2%)
 Frame = -1

Query  1093  KLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQC  917
             KL SK    EA SN QF RYL+Y+GK+  +QLEYTD+   L+Q+ RKAP + A+GFR   
Sbjct  216   KLVSKTTFPEAVSNNQFVRYLYYVGKIHAVQLEYTDSYNKLMQSIRKAPQNTAIGFRRTV  275

Query  916   NKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSK  737
              K A+IV+LL+GE+PER++F Q  ++ AL PY +LTNAVR+G+LE F  V  +F+  F  
Sbjct  276   YKLAIIVQLLMGEVPERSIFNQTELKTALLPYLQLTNAVRVGNLEDFTAVLNQFADVFKA  335

Query  736   DRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDG  557
             D+T+ LI+RLRHNVI+TGLR I+ +YS+I  +D+  KL LD+     +AE + +KAIRDG
Sbjct  336   DKTHTLILRLRHNVIKTGLRKINTSYSKILFSDICTKLALDTPQ---NAEFVCAKAIRDG  392

Query  556   AIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkeke  377
              IDA +D  +G M SKET D+Y+T EPQ AF+ RI FCL++HNEAV+A+R+PP ++K+  
Sbjct  393   VIDAVIDHKHGWMQSKETVDVYATTEPQQAFHKRITFCLDVHNEAVKAMRYPPGAYKKDL  452

Query  376   saekr-rerqqqeqELAKHIAEEDDD  302
              + +   ER++QE ELAK I EE D+
Sbjct  453   ESAEERLEREKQEDELAKEIEEELDE  478



>ref|XP_011673623.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X3 [Strongylocentrotus purpuratus]
Length=491

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 181/237 (76%), Gaps = 4/237 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN ++ R+L+YLG+++ IQLEY++A ++L+QA RKAP   A+GF+  
Sbjct  236   DKLVAKSTFPEQASNHEWARFLYYLGRIKAIQLEYSEAHKNLIQALRKAPQYTAVGFKQT  295

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K A++V+LLLGEIP+R++F Q   +K L PYF+LT AVR G+L LF Q+ + F++ F 
Sbjct  296   VHKLAIVVQLLLGEIPDRSIFRQSAYKKTLVPYFQLTQAVRSGNLGLFNQMLKDFAAKFQ  355

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              + T  LI+RL HNVI+TG+R IS++YS+ISL+DVAKKL+LDS     DAE IV+KAIRD
Sbjct  356   SEFTYTLIIRLHHNVIKTGVRMISLSYSKISLSDVAKKLQLDSPE---DAEFIVAKAIRD  412

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSH  389
             G I+A++D   G + SKET D+Y+T EP  AF+ RI+FCL++HN++V+A+RFPP S+
Sbjct  413   GVIEASIDHEKGYVQSKETVDVYTTREPMTAFHQRISFCLDIHNQSVKAMRFPPKSY  469



>ref|XP_009333239.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Pygoscelis 
adeliae]
Length=396

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  130   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  189

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  190   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  249

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  250   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  306

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  307   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  366

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  367   LESAEERREREQQDLEFAKEMAEDDDDGF  395



>ref|XP_010722887.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Meleagris 
gallopavo]
Length=396

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  130   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  189

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  190   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  249

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  250   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  306

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  307   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  366

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  367   LESAEERREREQQDLEFAKEMAEDDDDGF  395



>gb|AAL90075.1| AT15146p [Drosophila melanogaster]
Length=494

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|NP_477300.1| regulatory particle non-ATPase 3, isoform A [Drosophila melanogaster]
 ref|NP_001260557.1| regulatory particle non-ATPase 3, isoform B [Drosophila melanogaster]
 sp|P25161.1|PSMD3_DROME RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=Diphenol 
oxidase A2 component; Short=DOX-A2; AltName: Full=Regulatory 
particle non-ATPase 3 [Drosophila melanogaster]
 gb|AAB00732.1| diphenol oxidase A2 component [Drosophila melanogaster]
 gb|AAF53749.1| regulatory particle non-ATPase 3, isoform A [Drosophila melanogaster]
 gb|ACH92314.1| FI06020p [Drosophila melanogaster]
 gb|AGB93092.1| regulatory particle non-ATPase 3, isoform B [Drosophila melanogaster]
Length=494

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|XP_002039065.1| GM17319 [Drosophila sechellia]
 gb|EDW55711.1| GM17319 [Drosophila sechellia]
Length=494

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|XP_002079876.1| GD24178 [Drosophila simulans]
 gb|EDX05461.1| GD24178 [Drosophila simulans]
Length=494

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|XP_319831.2| AGAP009082-PA [Anopheles gambiae str. PEST]
 sp|O61470.2|PSMD3_ANOGA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Diphenol 
oxidase A2 component; Short=DOX-A2 [Anopheles gambiae]
 gb|EAA14736.2| AGAP009082-PA [Anopheles gambiae str. PEST]
Length=496

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 194/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN +  R+L+YLG+++  +LEY+ A + L+QA RKAP  AA+GFR  
Sbjct  231   DKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQT  290

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER VF Q  + ++L PYF+LT AVR+G+L+ F +V   F   F 
Sbjct  291   VQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLVNFGEQFR  350

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  351   QDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSPE---DAEFIVAKAIRD  407

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  408   GVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  467

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  468   LESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_002090656.1| GE13227 [Drosophila yakuba]
 gb|EDW90368.1| GE13227 [Drosophila yakuba]
Length=494

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|XP_001846487.1| 26S proteasome non-ATPase regulatory subunit 3 [Culex quinquefasciatus]
 gb|EDS43779.1| 26S proteasome non-ATPase regulatory subunit 3 [Culex quinquefasciatus]
Length=493

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 196/269 (73%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN ++ R+L+YLG+++  +L+Y+ A ++L+QA RKAP  AA+GFR  
Sbjct  228   DKLVNKSVFPETASNNEWARFLYYLGRIKGAKLDYSAAHKNLVQALRKAPQQAAVGFRQT  287

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER +F Q  + ++L PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  288   VQKLVIVVELLLGDIPERQIFRQAALRRSLGPYFQLTQAVRLGNLQRFGEVLENFGDQFR  347

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  348   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPKDIARKLGLDSHE---DAEFIVAKAIRD  404

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  405   GVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  464

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  465   LESAEERREREQQDLELAKEMAEEDDDGF  493



>ref|XP_001974302.1| GG21155 [Drosophila erecta]
 gb|EDV54702.1| GG21155 [Drosophila erecta]
Length=494

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>ref|XP_011257200.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Camponotus floridanus]
 gb|EFN67747.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Camponotus 
floridanus]
Length=505

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  239   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  298

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  299   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  358

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LDS+    DAE IV+KAIRD
Sbjct  359   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIARKLGLDSS---VDAEFIVAKAIRD  415

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  416   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  475

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  476   LESAEERREREQQDLELAKEMAEEDDDGF  504



>ref|XP_011309304.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Fopius arisanus]
Length=497

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 197/269 (73%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  231   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKHLVQAMRKAPQTTAVGFRQT  290

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L  F +V E F   F 
Sbjct  291   VQKLAVTVELLLGDIPERQIFRQAAVRRALAPYFQLTQAVRLGNLHRFGEVLENFGPQFR  350

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  351   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPGDIARKLGLDSG---VDAEFIVAKAIRD  407

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  408   GVIEATLDPENGYMRSKETTDIYCTREPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  467

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  468   LESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_011235692.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Ailuropoda melanoleuca]
Length=476

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  SN ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  210   EKLVSKSVFPEQASNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  269

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  270   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  329

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  330   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  386

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  387   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  446

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  447   LESAEERREREQQDLEFAKEMAEDDDDSF  475



>ref|XP_009988054.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Tauraco erythrolophus]
Length=397

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  131   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  190

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  191   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  250

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  251   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  307

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKET DIYST EPQ+AF+ RI+FCL++HN +V+  RFPP S+ + 
Sbjct  308   GVIEASINHEKGYVQSKETIDIYSTREPQLAFHQRISFCLDIHNMSVKVXRFPPKSYNKD  367

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  368   LESAEERREREQQDLEFAKEMAEDDDDGF  396



>ref|XP_001961923.1| GF14695 [Drosophila ananassae]
 gb|EDV31144.1| GF14695 [Drosophila ananassae]
Length=494

 Score =   264 bits (675),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+DA + L+QA RK+P  AA+GFR  
Sbjct  229   DKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQT  288

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG IPER VF Q G+ ++L  YF+LT AVR+G+L+ F  V  ++   F 
Sbjct  289   VQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQ  348

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IVSKAIRD
Sbjct  349   LDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAE---DAEFIVSKAIRD  405

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD     M SKE+ DIYST EPQ+AF+ RI+FCLN+HN++V+A+R+PP S+ + 
Sbjct  406   GVIEATLDPAQNFMRSKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKD  465

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+D+D F
Sbjct  466   LESAEERREREQQDLELAKEMAEDDEDGF  494



>dbj|BAE01724.1| unnamed protein product [Macaca fascicularis]
Length=435

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  169   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  228

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  229   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  288

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  289   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  345

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  346   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  405

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  406   LESAEERREREQQDLEFAKEMAEDDDDSF  434



>ref|XP_011175669.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solenopsis invicta]
 gb|EFZ21345.1| hypothetical protein SINV_02611, partial [Solenopsis invicta]
Length=501

 Score =   265 bits (676),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E+ SN ++ R+L+YLG+++  +LEY+ A + L+QA RKAP + A+GFR  
Sbjct  235   DKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQAMRKAPQTTAVGFRQT  294

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + +AL PYF+LT AVR+G+L+ F +V E F   F 
Sbjct  295   VQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFR  354

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LDS+    DAE IV+KAIRD
Sbjct  355   ADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIARKLGLDSS---VDAEFIVAKAIRD  411

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++HN++V+A+R+PP S+ + 
Sbjct  412   GVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKD  471

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  472   LESAEERREREQQDLELAKEMAEEDDDGF  500



>ref|XP_003222495.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Anolis 
carolinensis]
Length=523

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  257   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  316

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++FS  F 
Sbjct  317   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFSDKFQ  376

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  377   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  433

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  434   GVIEASINHEKGYIQSKEMTDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  493

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  494   LESAEERREREQQDLEFAKEMAEDDDDGF  522



>ref|XP_009477980.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Pelecanus crispus]
Length=437

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  171   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  230

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  231   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  290

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  291   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  347

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  348   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  407

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  408   LESAEERREREQQDLEFAKEMAEDDDDGF  436



>gb|AAC18058.1| diphenol oxidase-A2 [Anopheles gambiae]
Length=496

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 194/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             +KL +K+   E  SN +  R+L+YLG+++  +LEY+ A + L+QA RKAP  AA+GFR  
Sbjct  231   DKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQALRKAPQQAAVGFRQT  290

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K  ++V LLLG+IPER VF Q  + ++L PYF+LT AVR+G+L+ F +V   F   F 
Sbjct  291   VQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGNLQRFGEVLVNFGEQFR  350

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
             +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LDS     DAE IV+KAIRD
Sbjct  351   QDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLDSPE---DAEFIVAKAIRD  407

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHkek  380
             G I+ATLD   G M +KE+ DIYST EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ ++
Sbjct  408   GVIEATLDPEKGYMRTKESTDIYSTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKE  467

Query  379   esaekrrerqqqe-qELAKHIAEEDDDDF  296
               + + R  ++Q+  ELAK +AEEDDD F
Sbjct  468   LESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_009874430.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Apaloderma vittatum]
Length=456

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  190   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  249

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  250   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLSKFNQVLDQFGDKFQ  309

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  310   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  366

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  367   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  426

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  427   LESAEERREREQQDLEFAKEMAEDDDDGF  455



>ref|XP_007062032.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Chelonia 
mydas]
Length=408

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  142   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  201

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F+  F 
Sbjct  202   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFADKFQ  261

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRI+LAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  262   ADGTYTLIIRLRHNVIKTGVRMISLSYSRIALADIAQKLQLDSPE---DAEFIVAKAIRD  318

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  319   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  378

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  379   LESAEERREREQQDLEFAKEMAEDDDDGF  407



>ref|XP_008484303.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3, partial [Diaphorina citri]
Length=347

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL  K+   E  SN ++ R+ FYLG+++ ++LEY+ A ++L+QA RKAP +AA+GFR  
Sbjct  81    DKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQT  140

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV+V LLLG+IP+R +F Q  + +AL PYF+LT AVR+G+L+ F +V   + + F 
Sbjct  141   TQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFR  200

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R+I  +YSRI+   +A+KL L+S     DAE I++KAIRD
Sbjct  201   TDYTFKLILRLRHNVIKTAIRSIGASYSRITPTKIAEKLGLESPE---DAEFIIAKAIRD  257

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLDR  G M SKE+ DIY T EPQ+AF+ RIAFCL++HN++V+A+R+PP S+ + 
Sbjct  258   GVIEATLDREKGYMQSKESADIYCTVEPQLAFHQRIAFCLDLHNQSVKAMRYPPKSYGKD  317

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  318   LESAEERREREQQDLELAKEMAEEDDDGF  346



>ref|XP_008414675.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Poecilia 
reticulata]
Length=527

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ +L  A RKAP   A+GF+  
Sbjct  261   EKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQT  320

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV E+F   F 
Sbjct  321   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLEQFGEKFQ  380

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  381   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  437

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++HN +V+A+RFPP ++ + 
Sbjct  438   GVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKAYNKD  497

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  498   LESAEERREREQQDLEFAKEMAEDDDDSF  526



>ref|XP_011190713.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Bactrocera cucurbitae]
Length=493

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 193/256 (75%), Gaps = 5/256 (2%)
 Frame = -1

Query  1057  SNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQCNKWAVIVRLLLG  881
             SN ++ R+L+YLG+++  +LEY+DA + L+QA RKAP +AA+GFR    K  ++V LLLG
Sbjct  241   SNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKAPQNAAVGFRQTVQKLIIVVELLLG  300

Query  880   EIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFSKDRTNNLIVRLRH  701
              IPER +F Q  + K+L PYF+LT AVR+G+L+ F +V E F   F  D T  LI+RLRH
Sbjct  301   NIPERQIFRQAALRKSLAPYFQLTQAVRLGNLQRFGEVVENFGPKFQLDHTYTLIIRLRH  360

Query  700   NVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRDGAIDATLDRTNGC  521
             NVI+T +R+I ++YSRIS  D+AK+L LDSA    DAE IV+KAIRDG I+ATLD     
Sbjct  361   NVIKTAIRSIGLSYSRISPKDIAKRLMLDSAE---DAEFIVAKAIRDGVIEATLDPEQNY  417

Query  520   MVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-kesaekrrerqqq  344
             M SKE+ DIYST EPQ+AF+ RI FCL++HN++V+A+R+PP ++ +  ESAE+RRER+QQ
Sbjct  418   MRSKESTDIYSTREPQLAFHERITFCLDLHNQSVKAMRYPPKAYGKDLESAEERREREQQ  477

Query  343   eqELAKHIAEEDDDDF  296
             + ELAK +AE+D+D F
Sbjct  478   DLELAKEMAEDDEDGF  493



>ref|XP_010308532.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Balearica regulorum gibbericeps]
Length=460

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  194   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  253

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  254   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  313

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  314   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  370

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  371   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  430

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  431   LESAEERREREQQDLEFAKEMAEDDDDGF  459



>ref|XP_004608798.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X2 [Sorex araneus]
Length=498

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  232   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  291

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  292   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  351

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  352   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  408

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  409   GVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  468

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  469   LESAEERREREQQDLEFAKEMAEDDDDSF  497



>gb|KDR10975.1| hypothetical protein L798_15053 [Zootermopsis nevadensis]
Length=499

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAP-SAALGFRVQ  920
             +KL SK+   E  SN ++ R+ +YLG+++  +LEY+ A + L+QA RKAP +AA+GFR  
Sbjct  233   DKLVSKSVFPETASNNEWARFFYYLGRIKAARLEYSAAHKHLVQAMRKAPQTAAVGFRQT  292

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
               K AV V LLLG+IPER +F Q  + ++L PYF+LT AVR+G+L  F +V E F   F 
Sbjct  293   VQKLAVTVELLLGDIPERQIFRQAALRRSLAPYFQLTQAVRMGNLHRFGEVLENFGPQFR  352

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+T +R++ ++YSRIS  D+A KL LDS     DAE IV+KAIRD
Sbjct  353   ADHTFTLILRLRHNVIKTAIRSVGLSYSRISPDDIAHKLGLDSPE---DAEFIVAKAIRD  409

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+ATLD  +G M SKET DIY T EPQ+AF+ RI+FCL++HN++V+A+R+PP S+ + 
Sbjct  410   GVIEATLDPEHGYMRSKETTDIYCTREPQLAFHQRISFCLDLHNQSVKAMRYPPKSYGKD  469

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ ELAK +AE+DDD F
Sbjct  470   LESAEERREREQQDMELAKEMAEDDDDGF  498



>ref|XP_010295693.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Phaethon lepturus]
Length=460

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  194   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  253

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  254   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  313

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  314   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  370

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  371   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  430

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  431   LESAEERREREQQDLEFAKEMAEDDDDGF  459



>gb|EMC77897.1| 26S proteasome non-ATPase regulatory subunit 3, partial [Columba 
livia]
Length=461

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  195   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  254

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  255   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  314

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  315   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  371

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  372   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  431

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  432   LESAEERREREQQDLEFAKEMAEDDDDGF  460



>ref|XP_009578233.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Fulmarus glacialis]
Length=460

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  194   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  253

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  254   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  313

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  314   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  370

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  371   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  430

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  431   LESAEERREREQQDLEFAKEMAEDDDDGF  459



>ref|XP_006638287.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
[Lepisosteus oculatus]
Length=514

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ +L  A RKAP   A+GF+  
Sbjct  248   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQT  307

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV E+F   F 
Sbjct  308   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLEQFGEKFQ  367

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISL+D+A+KL+LDS     DAE IV+KAIRD
Sbjct  368   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLSDIAQKLQLDSPE---DAEFIVAKAIRD  424

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  425   GVIEASINHDKGYVQSKETIDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  484

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  485   LESAEERREREQQDLEFAKEMAEDDDDSF  513



>ref|XP_005999586.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Latimeria 
chalumnae]
Length=524

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 200/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ +L  A RKAP   A+GF+  
Sbjct  258   EKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQT  317

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  318   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  377

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  378   TDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  434

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKET DIY+T EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  435   GVIEASINHEKGYVQSKETIDIYTTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  494

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  495   LESAEERREREQQDLEFAKEMAEDDDDGF  523



>ref|XP_008293025.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Stegastes 
partitus]
Length=518

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ +L  A RKAP   A+GF+  
Sbjct  252   EKLVSKSVFPELANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQT  311

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV E+F   F 
Sbjct  312   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLEQFGEKFQ  371

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  372   TDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  428

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++HN +V+A+RFPP ++ + 
Sbjct  429   GVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKAYNKD  488

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  489   LESAEERREREQQDLEFAKEMAEDDDDSF  517



>ref|XP_010206163.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Colius striatus]
Length=460

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  194   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  253

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  254   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  313

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  314   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  370

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  371   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  430

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  431   LESAEERREREQQDLEFAKEMAEDDDDGF  459



>ref|XP_009883974.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Charadrius 
vociferus]
Length=464

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  198   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  257

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  258   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  317

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  318   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  374

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  375   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  434

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  435   LESAEERREREQQDLEFAKEMAEDDDDGF  463



>ref|XP_005232750.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Falco 
peregrinus]
Length=464

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  198   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  257

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  258   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  317

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  318   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  374

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  375   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  434

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  435   LESAEERREREQQDLEFAKEMAEDDDDGF  463



>gb|AFM88771.1| 26S proteasome non-ATPase regulatory subunit 3-like protein [Callorhinchus 
milii]
Length=522

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 198/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ +L  A RKAP   A+GF+  
Sbjct  256   EKLVSKSIFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTLTNALRKAPQHTAVGFKQT  315

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV E+F   F 
Sbjct  316   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLSKFNQVLEQFGEKFQ  375

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRI+L D+A+KL+LDS     DAE IV+KAIRD
Sbjct  376   ADGTYTLIIRLRHNVIKTGVRMISLSYSRIALTDIAQKLQLDSPE---DAEFIVAKAIRD  432

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A++D   G + SKET DIY T EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  433   GVIEASIDHERGYVQSKETIDIYGTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  492

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  493   LESAEERREREQQDLEFAKEMAEDDDDGF  521



>ref|XP_009463186.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Nipponia 
nippon]
Length=466

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  200   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  259

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  260   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  319

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  320   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  376

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  377   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  436

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  437   LESAEERREREQQDLEFAKEMAEDDDDGF  465



>ref|XP_005368329.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Microtus 
ochrogaster]
Length=530

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  264   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  323

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  324   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQ  383

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  384   TDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  440

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  441   GVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  500

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  501   LESAEERREREQQDLEFAKEMAEDDDDSF  529



>ref|XP_009569021.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Cuculus 
canorus]
Length=465

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  199   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  258

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV ++F   F 
Sbjct  259   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDKFQ  318

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  319   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  375

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  376   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  435

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  436   LESAEERREREQQDLEFAKEMAEDDDDGF  464



>ref|XP_006214329.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Vicugna 
pacos]
Length=534

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 199/269 (74%), Gaps = 5/269 (2%)
 Frame = -1

Query  1096  EKLRSKAPRFEAHSNQQFCRYLFYLGKVRTIQLEYTDAKESLLQAARKAPS-AALGFRVQ  920
             EKL SK+   E  +N ++ RYL+Y G+++ IQLEY++A+ ++  A RKAP   A+GF+  
Sbjct  268   EKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQT  327

Query  919   CNKWAVIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRQVAEKFSSTFS  740
              +K  ++V LLLGEIP+R  F Q  ++++L PYF LT AVR G+L  F QV E+F   F 
Sbjct  328   VHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLEQFGEKFQ  387

Query  739   KDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAESIVSKAIRD  560
              D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LDS     DAE IV+KAIRD
Sbjct  388   ADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPE---DAEFIVAKAIRD  444

Query  559   GAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHke-  383
             G I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++HN +V+A+RFPP S+ + 
Sbjct  445   GVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKD  504

Query  382   kesaekrrerqqqeqELAKHIAEEDDDDF  296
              ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  505   LESAEERREREQQDLEFAKEMAEDDDDSF  533



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2896626386480