BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8302

Length=913
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABK96436.1|  unknown                                                 311   7e-102   Populus trichocarpa x Populus deltoides
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             323   3e-100   Capsella rubella
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    318   5e-99    Solanum tuberosum [potatoes]
emb|CDP04437.1|  unnamed protein product                                319   7e-99    Coffea canephora [robusta coffee]
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             318   2e-98    
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    318   2e-98    Solanum tuberosum [potatoes]
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                317   6e-98    Erythranthe guttata [common monkey flower]
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      316   1e-97    Camelina sativa [gold-of-pleasure]
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    316   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    316   1e-97    Solanum lycopersicum
gb|AAL07154.1|  unknown protein                                         314   7e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    314   7e-97    Nicotiana tomentosiformis
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    314   7e-97    
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          313   2e-96    
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    312   2e-96    Nicotiana sylvestris
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             311   5e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_002317144.2|  early-responsive to dehydration family protein     311   7e-96    
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    311   9e-96    Sesamum indicum [beniseed]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    311   1e-95    Sesamum indicum [beniseed]
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         308   2e-95    Jatropha curcas
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    310   2e-95    Brassica rapa
emb|CDY27443.1|  BnaC03g64830D                                          310   2e-95    Brassica napus [oilseed rape]
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             309   4e-95    Capsella rubella
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    309   6e-95    Nicotiana sylvestris
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    308   8e-95    
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             308   8e-95    Eutrema salsugineum [saltwater cress]
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    308   1e-94    Camelina sativa [gold-of-pleasure]
emb|CDY21297.1|  BnaC03g29810D                                          308   1e-94    Brassica napus [oilseed rape]
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    308   1e-94    Populus euphratica
emb|CAA18115.1|  putative protein                                       306   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             307   2e-94    Brassica rapa
emb|CDX90856.1|  BnaA03g25360D                                          307   2e-94    
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             307   3e-94    
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    306   4e-94    
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    306   5e-94    Pyrus x bretschneideri [bai li]
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    306   6e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    306   6e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93792.1|  hypothetical protein                                   306   7e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    306   7e-94    Nicotiana tomentosiformis
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    306   9e-94    
emb|CDX82907.1|  BnaC01g13570D                                          305   1e-93    
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    305   2e-93    Populus euphratica
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             304   3e-93    Nicotiana tomentosiformis
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    304   4e-93    Solanum tuberosum [potatoes]
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             304   5e-93    Nicotiana sylvestris
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             303   6e-93    Populus euphratica
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    299   6e-93    
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             303   7e-93    Prunus persica
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    303   8e-93    Brassica rapa
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             302   1e-92    Eucalyptus grandis [rose gum]
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    303   1e-92    Prunus mume [ume]
gb|KJB69238.1|  hypothetical protein B456_011G012200                    298   2e-92    Gossypium raimondii
ref|XP_012080615.1|  PREDICTED: CSC1-like protein At3g21620             302   2e-92    Jatropha curcas
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    302   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_002321139.1|  early-responsive to dehydration family protein     301   3e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002301612.2|  early-responsive to dehydration family protein     301   6e-92    
ref|XP_012092360.1|  PREDICTED: uncharacterized protein LOC105650086    310   7e-92    
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    300   1e-91    
gb|KHN38468.1|  Putative membrane protein C2G11.09                      299   2e-91    Glycine soja [wild soybean]
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    299   2e-91    Glycine max [soybeans]
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             299   2e-91    Citrus clementina [clementine]
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    299   3e-91    Pyrus x bretschneideri [bai li]
ref|XP_003616997.1|  Transmembrane protein                              299   3e-91    Medicago truncatula
gb|KJB69243.1|  hypothetical protein B456_011G012200                    298   5e-91    Gossypium raimondii
ref|XP_010099166.1|  Uncharacterized membrane protein                   298   5e-91    Morus notabilis
gb|KJB69236.1|  hypothetical protein B456_011G012200                    298   6e-91    Gossypium raimondii
gb|KJB69239.1|  hypothetical protein B456_011G012200                    298   6e-91    Gossypium raimondii
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    298   8e-91    Nelumbo nucifera [Indian lotus]
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            298   9e-91    
dbj|BAF98597.1|  CM0545.360.nc                                          297   1e-90    Lotus japonicus
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     295   1e-90    Eucalyptus grandis [rose gum]
ref|XP_002518432.1|  conserved hypothetical protein                     297   1e-90    
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    297   2e-90    
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    296   3e-90    Cucumis melo [Oriental melon]
gb|KHG01808.1|  putative membrane C2G11.09                              296   4e-90    Gossypium arboreum [tree cotton]
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    295   7e-90    
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             295   9e-90    Populus euphratica
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    295   9e-90    Glycine max [soybeans]
gb|EPS60017.1|  hypothetical protein M569_14787                         295   9e-90    Genlisea aurea
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             295   1e-89    Populus euphratica
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    294   2e-89    Eucalyptus grandis [rose gum]
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             289   4e-89    
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    290   5e-89    Cucumis melo [Oriental melon]
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    292   6e-89    Fragaria vesca subsp. vesca
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    290   6e-89    
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             291   7e-89    
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             293   8e-89    Prunus persica
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   289   9e-89    Citrus sinensis [apfelsine]
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    292   1e-88    Fragaria vesca subsp. vesca
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             292   1e-88    Phaseolus vulgaris [French bean]
ref|XP_004151944.1|  PREDICTED: calcium permeable stress-gated ca...    292   1e-88    Cucumis sativus [cucumbers]
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    291   2e-88    Glycine max [soybeans]
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       291   2e-88    Cicer arietinum [garbanzo]
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    291   4e-88    
ref|XP_010089460.1|  Uncharacterized membrane protein                   290   7e-88    
ref|XP_004145433.1|  PREDICTED: calcium permeable stress-gated ca...    290   1e-87    Cucumis sativus [cucumbers]
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    289   2e-87    Cucumis melo [Oriental melon]
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       283   3e-87    
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    288   3e-87    Citrus sinensis [apfelsine]
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             288   4e-87    Phaseolus vulgaris [French bean]
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    287   9e-87    Populus euphratica
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    287   1e-86    Populus euphratica
gb|EPS71959.1|  hypothetical protein M569_02795                         286   2e-86    Genlisea aurea
gb|KHG22816.1|  putative membrane C2G11.09                              283   2e-86    Gossypium arboreum [tree cotton]
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    286   3e-86    Populus euphratica
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    283   3e-86    Populus euphratica
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    285   5e-86    Fragaria vesca subsp. vesca
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    285   5e-86    Solanum tuberosum [potatoes]
gb|KHG30770.1|  putative membrane C2G11.09                              285   7e-86    Gossypium arboreum [tree cotton]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             284   1e-85    Tarenaya hassleriana [spider flower]
gb|KJB57786.1|  hypothetical protein B456_009G181100                    284   1e-85    Gossypium raimondii
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    284   2e-85    Cicer arietinum [garbanzo]
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                284   2e-85    Erythranthe guttata [common monkey flower]
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    283   2e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             283   2e-85    Solanum lycopersicum
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    283   3e-85    Populus euphratica
gb|KHN28986.1|  Putative membrane protein C2G11.09                      283   5e-85    Glycine soja [wild soybean]
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    283   5e-85    Glycine max [soybeans]
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             281   1e-84    Vitis vinifera
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    281   1e-84    Glycine max [soybeans]
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    281   2e-84    Fragaria vesca subsp. vesca
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    281   2e-84    Brachypodium distachyon [annual false brome]
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           279   3e-84    
ref|XP_006383870.1|  early-responsive to dehydration family protein     281   3e-84    
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               276   9e-84    Triticum urartu
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    278   9e-84    
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    278   1e-83    Elaeis guineensis
gb|KJB10672.1|  hypothetical protein B456_001G215500                    275   1e-83    Gossypium raimondii
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    278   1e-83    
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          279   1e-83    Sorghum bicolor [broomcorn]
ref|XP_003610472.1|  Membrane protein, putative                         279   1e-83    Medicago truncatula
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    279   1e-83    Oryza brachyantha
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    278   2e-83    Elaeis guineensis
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    278   3e-83    Phoenix dactylifera
gb|KJB42870.1|  hypothetical protein B456_007G171500                    276   1e-82    Gossypium raimondii
gb|KJB42871.1|  hypothetical protein B456_007G171500                    277   1e-82    Gossypium raimondii
gb|KJB10674.1|  hypothetical protein B456_001G215500                    275   2e-82    Gossypium raimondii
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             276   2e-82    Phaseolus vulgaris [French bean]
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    273   3e-82    
gb|KJB10673.1|  hypothetical protein B456_001G215500                    275   3e-82    Gossypium raimondii
gb|EMT27455.1|  Putative membrane protein                               275   9e-82    
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    273   2e-81    Phoenix dactylifera
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    273   2e-81    Elaeis guineensis
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             273   3e-81    Tarenaya hassleriana [spider flower]
dbj|BAK03311.1|  predicted protein                                      272   4e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             272   5e-81    Eutrema salsugineum [saltwater cress]
ref|NP_001043256.1|  Os01g0534900                                       271   6e-81    
emb|CDP11354.1|  unnamed protein product                                271   2e-80    Coffea canephora [robusta coffee]
ref|XP_006843810.1|  PREDICTED: calcium permeable stress-gated ca...    268   2e-79    Amborella trichopoda
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             268   2e-79    
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    267   3e-79    
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    267   4e-79    
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             267   5e-79    Brassica rapa
ref|NP_001056508.1|  Os05g0594700                                       266   6e-79    
emb|CDY12941.1|  BnaA09g13330D                                          266   1e-78    Brassica napus [oilseed rape]
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    272   2e-78    Populus euphratica
gb|EEE64912.1|  hypothetical protein OsJ_19772                          266   5e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             264   5e-78    Brassica rapa
emb|CDX98089.1|  BnaA06g08400D                                          264   5e-78    
emb|CDY32438.1|  BnaC03g42220D                                          263   6e-78    Brassica napus [oilseed rape]
emb|CDY30043.1|  BnaC05g09770D                                          263   8e-78    Brassica napus [oilseed rape]
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             263   9e-78    Brassica rapa
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    263   1e-77    
emb|CDY48898.1|  BnaA03g36370D                                          263   1e-77    Brassica napus [oilseed rape]
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             263   1e-77    Capsella rubella
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    263   1e-77    Oryza brachyantha
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    262   3e-77    Setaria italica
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             261   4e-77    
ref|XP_010450765.1|  PREDICTED: protein OSCA1-like                      245   5e-77    Camelina sativa [gold-of-pleasure]
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    264   1e-76    Populus euphratica
ref|XP_011625695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    258   6e-76    
ref|XP_006850790.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    258   6e-76    Amborella trichopoda
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    256   7e-76    
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    256   7e-76    Camelina sativa [gold-of-pleasure]
emb|CDP03600.1|  unnamed protein product                                258   8e-76    Coffea canephora [robusta coffee]
emb|CDY19541.1|  BnaC09g13620D                                          258   8e-76    Brassica napus [oilseed rape]
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             258   1e-75    
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    257   2e-75    Brassica rapa
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    257   2e-75    Brassica rapa
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             256   2e-75    Capsella rubella
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    256   2e-75    
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    256   3e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             256   3e-75    Eutrema salsugineum [saltwater cress]
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             256   6e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             255   8e-75    Capsella rubella
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             255   8e-75    Camelina sativa [gold-of-pleasure]
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             254   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             255   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             255   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             254   1e-74    Arabidopsis lyrata subsp. lyrata
dbj|BAD94445.1|  hypothetical protein                                   254   2e-74    Arabidopsis thaliana [mouse-ear cress]
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      254   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    254   2e-74    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147493.1|  LOC100281102                                       254   2e-74    Zea mays [maize]
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             254   2e-74    Nelumbo nucifera [Indian lotus]
gb|AFW81357.1|  HYP1 isoform 1                                          254   2e-74    
ref|NP_172660.5|  putative ERD4 protein                                 253   6e-74    Arabidopsis thaliana [mouse-ear cress]
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    253   8e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    252   9e-74    Phoenix dactylifera
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          252   1e-73    Sorghum bicolor [broomcorn]
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    252   2e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    251   2e-73    Oryza brachyantha
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             251   3e-73    Capsella rubella
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             250   5e-73    Eucalyptus grandis [rose gum]
ref|NP_001055457.1|  Os05g0393800                                       250   8e-73    
gb|EAY97938.1|  hypothetical protein OsI_19855                          250   1e-72    Oryza sativa Indica Group [Indian rice]
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    249   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    248   1e-72    
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    249   1e-72    
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    249   2e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             248   5e-72    Brachypodium distachyon [annual false brome]
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                247   8e-72    Erythranthe guttata [common monkey flower]
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             247   1e-71    Camelina sativa [gold-of-pleasure]
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    246   2e-71    Setaria italica
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             246   2e-71    Sesamum indicum [beniseed]
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    244   4e-71    
ref|XP_006854105.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    245   5e-71    Amborella trichopoda
ref|XP_011626938.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    245   5e-71    
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    245   6e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             245   6e-71    Camelina sativa [gold-of-pleasure]
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    244   7e-71    Brachypodium distachyon [annual false brome]
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    244   9e-71    Camelina sativa [gold-of-pleasure]
dbj|BAJ96091.1|  predicted protein                                      244   1e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY22920.1|  BnaA01g18580D                                          243   2e-70    Brassica napus [oilseed rape]
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    243   2e-70    Brassica rapa
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    243   2e-70    Camelina sativa [gold-of-pleasure]
emb|CDY49293.1|  BnaC01g22480D                                          242   5e-70    Brassica napus [oilseed rape]
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             242   6e-70    Solanum lycopersicum
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          242   7e-70    Sorghum bicolor [broomcorn]
gb|EMS50375.1|  Transmembrane protein 63B                               241   8e-70    Triticum urartu
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             241   1e-69    Nelumbo nucifera [Indian lotus]
dbj|BAK05559.1|  predicted protein                                      241   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010110412.1|  Uncharacterized protein RSN1                       232   2e-69    
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            241   3e-69    
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    240   3e-69    
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    240   4e-69    Cucumis melo [Oriental melon]
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    240   4e-69    Camelina sativa [gold-of-pleasure]
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       239   6e-69    Setaria italica
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    239   9e-69    Solanum tuberosum [potatoes]
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    239   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            239   1e-68    Prunus mume [ume]
ref|XP_002886475.1|  F24O1.4                                            239   1e-68    Arabidopsis lyrata subsp. lyrata
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             238   1e-68    Vitis vinifera
emb|CBI32349.3|  unnamed protein product                                238   2e-68    Vitis vinifera
emb|CDY32032.1|  BnaA03g60360D                                          239   2e-68    Brassica napus [oilseed rape]
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             238   2e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             238   2e-68    Brassica rapa
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             238   3e-68    
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    235   4e-68    Vitis vinifera
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    236   6e-68    
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             237   6e-68    Prunus persica
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    236   8e-68    
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    236   9e-68    Solanum tuberosum [potatoes]
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             235   1e-67    Nelumbo nucifera [Indian lotus]
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    233   2e-67    Nicotiana tomentosiformis
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    235   2e-67    Cucumis melo [Oriental melon]
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               236   2e-67    Triticum urartu
ref|XP_006387596.1|  hypothetical protein POPTR_0796s00200g             220   2e-67    
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    235   2e-67    Medicago truncatula
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    235   2e-67    
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             235   2e-67    Citrus clementina [clementine]
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    235   2e-67    Vitis vinifera
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             236   2e-67    Pyrus x bretschneideri [bai li]
ref|XP_011625696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    235   2e-67    
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             235   2e-67    Nicotiana tomentosiformis
ref|XP_010090368.1|  Uncharacterized membrane protein                   236   3e-67    
ref|XP_004136187.1|  PREDICTED: CSC1-like protein At4g02900             234   5e-67    Cucumis sativus [cucumbers]
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    233   6e-67    Fragaria vesca subsp. vesca
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    234   9e-67    Solanum lycopersicum
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    233   9e-67    Nicotiana tomentosiformis
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    233   1e-66    
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    233   2e-66    
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             233   2e-66    Selaginella moellendorffii
ref|XP_012066469.1|  PREDICTED: CSC1-like protein At1g32090             233   3e-66    Jatropha curcas
gb|EMT18085.1|  Putative membrane protein                               232   4e-66    
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             232   4e-66    Solanum lycopersicum
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    231   5e-66    Prunus mume [ume]
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             231   6e-66    Selaginella moellendorffii
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       232   7e-66    Solanum tuberosum [potatoes]
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             230   1e-65    
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    230   2e-65    
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             231   2e-65    
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             230   4e-65    
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    229   4e-65    
gb|EMT11783.1|  Putative membrane protein                               229   4e-65    
gb|EMT13890.1|  Putative membrane protein                               229   6e-65    
gb|KJB51550.1|  hypothetical protein B456_008G222200                    228   6e-65    
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             228   8e-65    
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    228   9e-65    
gb|KHN19872.1|  Putative membrane protein C2G11.09                      227   1e-64    
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    228   1e-64    
gb|KJB51549.1|  hypothetical protein B456_008G222200                    228   1e-64    
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               228   1e-64    
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             228   2e-64    
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             228   2e-64    
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    227   2e-64    
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             227   2e-64    
emb|CDY09064.1|  BnaC08g10180D                                          226   3e-64    
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             226   4e-64    
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               227   4e-64    
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    225   8e-64    
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    225   8e-64    
emb|CDP11732.1|  unnamed protein product                                226   1e-63    
ref|XP_003612662.1|  Membrane protein, putative                         225   1e-63    
gb|EMT23208.1|  Putative membrane protein                               226   1e-63    
gb|EMT22148.1|  Putative membrane protein                               225   1e-63    
ref|XP_002533077.1|  conserved hypothetical protein                     224   2e-63    
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    223   3e-63    
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               224   3e-63    
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    223   3e-63    
ref|XP_002519965.1|  Extensin-3 precursor, putative                     224   4e-63    
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    223   8e-63    
gb|AFI41197.1|  dehydration stress protein                              223   9e-63    
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             222   1e-62    
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             221   2e-62    
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    221   4e-62    
gb|KHG26829.1|  putative membrane C2G11.09                              221   5e-62    
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    221   5e-62    
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    220   7e-62    
ref|XP_011626939.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    220   8e-62    
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             219   1e-61    
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             219   1e-61    
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    219   1e-61    
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            219   2e-61    
ref|XP_012092490.1|  PREDICTED: CSC1-like protein At4g02900             218   3e-61    
gb|AAC79116.1|  hypothetical protein                                    217   3e-61    
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                218   3e-61    
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             218   4e-61    
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             218   4e-61    
emb|CDX90914.1|  BnaA03g25940D                                          218   5e-61    
emb|CDP11733.1|  unnamed protein product                                219   5e-61    
emb|CDY17981.1|  BnaC03g30530D                                          218   5e-61    
gb|EPS71707.1|  hypothetical protein M569_03051                         218   5e-61    
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             218   5e-61    
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    217   6e-61    
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    217   8e-61    
gb|KJB42062.1|  hypothetical protein B456_007G134700                    216   9e-61    
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             217   9e-61    
gb|KHG10946.1|  putative membrane C2G11.09                              216   1e-60    
gb|KJB42060.1|  hypothetical protein B456_007G134700                    216   1e-60    
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    217   1e-60    
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             217   1e-60    
gb|EPS61105.1|  hypothetical protein M569_13694                         213   2e-60    
ref|NP_001065504.1|  Os10g0579100                                       216   2e-60    
gb|KJB42059.1|  hypothetical protein B456_007G134700                    216   2e-60    
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    216   2e-60    
gb|EAY79648.1|  hypothetical protein OsI_34792                          216   2e-60    
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   216   3e-60    
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             215   4e-60    
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            215   5e-60    
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    214   7e-60    
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    214   8e-60    
ref|XP_004146108.1|  PREDICTED: CSC1-like protein At1g32090             214   9e-60    
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            214   1e-59    
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    214   1e-59    
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             213   2e-59    
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             213   3e-59    
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       213   3e-59    
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             213   3e-59    
emb|CDX76386.1|  BnaA08g10140D                                          211   5e-59    
gb|KHN40403.1|  Putative membrane protein C2G11.09                      212   6e-59    
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       212   6e-59    
ref|XP_006368323.1|  early-responsive to dehydration family protein     212   7e-59    
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          212   7e-59    
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    211   8e-59    
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             211   2e-58    
emb|CDM81261.1|  unnamed protein product                                210   3e-58    
emb|CDX79125.1|  BnaA01g11920D                                          208   6e-58    
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             209   6e-58    
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             209   7e-58    
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             209   8e-58    
ref|XP_009347716.1|  PREDICTED: CSC1-like protein At4g02900             200   9e-58    
emb|CAB10322.1|  hypothetical protein                                   207   1e-57    
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    209   1e-57    
gb|EPS74192.1|  hypothetical protein M569_00556                         207   2e-57    
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    208   2e-57    
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    207   2e-57    
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             207   4e-57    
emb|CDY35541.1|  BnaA05g16450D                                          207   4e-57    
emb|CDY29933.1|  BnaC05g29030D                                          207   4e-57    
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             206   8e-57    
gb|KJB22581.1|  hypothetical protein B456_004G055300                    203   1e-56    
ref|XP_002529341.1|  conserved hypothetical protein                     204   2e-56    
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             205   2e-56    
gb|KHG17938.1|  putative membrane C2G11.09                              204   5e-56    
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             204   7e-56    
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    204   7e-56    
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             203   8e-56    
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             203   9e-56    
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    202   1e-55    
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                202   3e-55    
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             201   4e-55    
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             201   4e-55    
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                199   3e-54    
ref|XP_001782141.1|  predicted protein                                  198   5e-54    
ref|XP_008360740.1|  PREDICTED: uncharacterized protein RSN1-like       190   5e-54    
ref|XP_001754358.1|  predicted protein                                  198   5e-54    
ref|XP_006414510.1|  hypothetical protein EUTSA_v10024504mg             195   2e-53    
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    196   4e-53    
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              195   6e-53    
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             195   7e-53    
gb|KHG01781.1|  putative membrane C2G11.09                              194   7e-53    
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             192   6e-52    
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             187   6e-50    
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    184   3e-49    
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    181   3e-48    
gb|KDO68804.1|  hypothetical protein CISIN_1g0209791mg                  163   1e-45    
ref|XP_002317143.2|  hypothetical protein POPTR_0011s01450g             167   1e-44    
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    171   1e-44    
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             166   6e-43    
ref|XP_001759032.1|  predicted protein                                  167   7e-43    
gb|EPS60193.1|  hypothetical protein M569_14609                         165   1e-42    
ref|XP_001770572.1|  predicted protein                                  165   2e-42    
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             162   1e-41    
ref|XP_001757556.1|  predicted protein                                  161   7e-41    
gb|KJB22580.1|  hypothetical protein B456_004G055300                    154   5e-39    
ref|XP_010490005.1|  PREDICTED: CSC1-like protein At3g21620             143   5e-38    
emb|CDY27442.1|  BnaC03g64820D                                          124   4e-31    
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg             129   5e-30    
ref|XP_001764420.1|  predicted protein                                  121   7e-27    
gb|EYU34204.1|  hypothetical protein MIMGU_mgv1a001911mg                117   2e-25    
gb|ERN14627.1|  hypothetical protein AMTR_s00038p00185310               114   3e-25    
ref|XP_006483099.1|  PREDICTED: uncharacterized membrane protein ...    114   1e-24    
ref|XP_006483098.1|  PREDICTED: uncharacterized membrane protein ...    114   1e-24    
gb|EEC76105.1|  hypothetical protein OsI_13363                          113   3e-24    
ref|XP_004304272.1|  PREDICTED: CSC1-like protein HYP1                  113   4e-24    
gb|EYU26139.1|  hypothetical protein MIMGU_mgv1a022719mg                113   4e-24    
ref|XP_004981918.1|  PREDICTED: uncharacterized membrane protein ...    112   5e-24    
ref|NP_001051134.1|  Os03g0726300                                       112   5e-24    
gb|EEE59847.1|  hypothetical protein OsJ_12422                          112   5e-24    
ref|XP_009360589.1|  PREDICTED: CSC1-like protein HYP1                  112   6e-24    
ref|XP_002463956.1|  hypothetical protein SORBIDRAFT_01g009540          111   1e-23    
emb|CAA56145.1|  HYP1                                                   110   1e-23    
gb|KEH30799.1|  ERD (early-responsive to dehydration stress) fami...    110   1e-23    
gb|KEH30802.1|  ERD (early-responsive to dehydration stress) fami...    110   1e-23    
gb|AAF26164.1|AC008261_21  unknown protein                              109   2e-23    
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...    111   2e-23    
gb|KJB80261.1|  hypothetical protein B456_013G089300                    110   2e-23    
gb|KJB80259.1|  hypothetical protein B456_013G089300                    110   3e-23    
gb|KEH30798.1|  ERD (early-responsive to dehydration stress) fami...    110   3e-23    
gb|KEH30800.1|  ERD (early-responsive to dehydration stress) fami...    110   3e-23    
ref|XP_006855764.1|  PREDICTED: CSC1-like protein RXW8                  110   3e-23    
emb|CDY37544.1|  BnaA05g34090D                                          110   3e-23    
ref|XP_009147396.1|  PREDICTED: CSC1-like protein HYP1                  110   4e-23    
ref|XP_010943516.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       110   5e-23    
ref|NP_186759.2|  uncharacterized protein                               109   5e-23    
ref|XP_007157718.1|  hypothetical protein PHAVU_002G092500g             109   5e-23    
dbj|BAD94293.1|  hypothetical protein                                   109   5e-23    
ref|XP_002882200.1|  hypothetical protein ARALYDRAFT_477418             109   6e-23    
emb|CDY43268.1|  BnaC05g48610D                                          109   6e-23    
ref|XP_012068150.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       109   6e-23    
gb|KHN36998.1|  Putative membrane protein                               109   7e-23    
ref|XP_001765646.1|  predicted protein                                  109   7e-23    
ref|XP_010661092.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       109   8e-23    
ref|XP_012068148.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       109   8e-23    
ref|XP_010661094.1|  PREDICTED: CSC1-like protein HYP1 isoform X3       108   8e-23    
ref|XP_003556958.1|  PREDICTED: uncharacterized membrane protein ...    109   8e-23    
ref|XP_004516572.1|  PREDICTED: uncharacterized membrane protein ...    108   9e-23    
ref|XP_006408462.1|  hypothetical protein EUTSA_v10020163mg             108   9e-23    
ref|XP_009789228.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       108   1e-22    
ref|XP_010320285.1|  PREDICTED: CSC1-like protein RXW8                  108   1e-22    
ref|XP_009619283.1|  PREDICTED: CSC1-like protein RXW8                  108   1e-22    
ref|XP_008644541.1|  PREDICTED: calcium permeable stress-gated ca...    108   1e-22    
gb|KHN17195.1|  Putative membrane protein                               108   1e-22    
ref|XP_009789223.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       108   1e-22    
ref|XP_006356826.1|  PREDICTED: uncharacterized protein RSN1-like       108   1e-22    
ref|XP_003545361.2|  PREDICTED: uncharacterized membrane protein ...    108   1e-22    
emb|CBI22257.3|  unnamed protein product                                108   1e-22    
ref|XP_007216321.1|  hypothetical protein PRUPE_ppa019884mg             108   2e-22    
ref|XP_006299849.1|  hypothetical protein CARUB_v10016052mg             108   2e-22    
ref|XP_009625276.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       107   2e-22    
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...    108   2e-22    
ref|XP_009105488.1|  PREDICTED: CSC1-like protein At1g69450             108   2e-22    
ref|XP_009397320.1|  PREDICTED: CSC1-like protein RXW8                  107   2e-22    
ref|XP_011078463.1|  PREDICTED: CSC1-like protein RXW8                  107   3e-22    
ref|XP_009625272.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       107   3e-22    
gb|AAG60099.1|AC073178_10  unknown protein                              107   3e-22    
emb|CDY40924.1|  BnaC06g30620D                                          107   3e-22    
ref|XP_009623866.1|  PREDICTED: CSC1-like protein RXW8                  107   3e-22    
ref|XP_009797746.1|  PREDICTED: CSC1-like protein RXW8                  107   3e-22    
ref|XP_008341608.1|  PREDICTED: phosphate metabolism protein 7-like     107   3e-22    
ref|NP_177104.2|  Early-responsive to dehydration stress protein ...    107   3e-22    
ref|XP_010316242.1|  PREDICTED: CSC1-like protein HYP1 isoform X3       107   3e-22    
ref|XP_010316241.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       107   4e-22    
ref|XP_006338419.1|  PREDICTED: uncharacterized membrane protein ...    107   4e-22    
ref|XP_002522488.1|  conserved hypothetical protein                     107   4e-22    
ref|XP_006574920.1|  PREDICTED: uncharacterized membrane protein ...    106   4e-22    
ref|XP_010247468.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       104   5e-22    
ref|XP_004982191.1|  PREDICTED: uncharacterized membrane protein ...    107   5e-22    
gb|ABR16200.1|  unknown                                                 107   5e-22    
ref|XP_004232200.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       107   5e-22    
ref|XP_006300796.1|  hypothetical protein CARUB_v10019875mg             107   5e-22    
ref|XP_006391015.1|  hypothetical protein EUTSA_v10018196mg             106   5e-22    
gb|KEH30803.1|  ERD (early-responsive to dehydration stress) fami...    106   5e-22    
ref|XP_006574918.1|  PREDICTED: uncharacterized membrane protein ...    106   5e-22    
ref|XP_003575997.1|  PREDICTED: CSC1-like protein RXW8                  107   5e-22    
ref|XP_006839159.2|  PREDICTED: CSC1-like protein At3g54510             106   6e-22    
ref|XP_003621301.1|  Membrane protein, putative                         107   6e-22    
ref|XP_008674130.1|  PREDICTED: calcium permeable stress-gated ca...    106   6e-22    
ref|XP_006574916.1|  PREDICTED: uncharacterized membrane protein ...    106   8e-22    



>gb|ABK96436.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   311 bits (796),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFII+FF FA++V+RHQIINVYNQEY
Sbjct  38   AMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYVVFRHQIINVYNQEY  97

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLTI FH FC GR++
Sbjct  98   ESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHRFCNGRHK  157

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK GD DEDD++S+KLE E +
Sbjct  158  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGDGDEDDDLSKKLETESV  217

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR+NTPAPSK+SG SSP +
Sbjct  218  LVPTKRQSRKNTPAPSKISGASSPSL  243



>ref|XP_006287117.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
 gb|EOA20015.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
Length=772

 Score =   323 bits (827),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  559  AMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPLLLPFILVFFGLAYIVYRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLL TKHAA++APFLIALPV+TI FH FCKGRYE
Sbjct  619  ESAAAFWPDVHGRIITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCKGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQDAYVHPVFK  DDD+D +M  KLE E I
Sbjct  679  PAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYVHPVFKGDDDDDDSDMVGKLEDEVI  738

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS++SG SSP +
Sbjct  739  IVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_006348154.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
Length=703

 Score =   318 bits (814),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 190/214 (89%), Gaps = 3/214 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  490  AMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVYNQEY  549

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFAL FSQ+S LGLL TKHA  SAPFLIALPVLTISFHL+CKGRYE
Sbjct  550  ESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLTISFHLYCKGRYE  609

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFTKYP+QEA+M+DTLE+AREP LNLK YLQ+AYVHPVFK+ D+DED++   KLE + +
Sbjct  610  PAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDEDFMMKLETDSV  669

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILEKE  281
            LVPTKRQSR NTP PSKVS GSS   PDV++ ++
Sbjct  670  LVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  703



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   319 bits (817),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GF+TGEPQIQ YFLLGLVYAVVTPIL+PFI+VFFG A++V+RHQIINVYNQEY
Sbjct  554  AMDPGSLGFDTGEPQIQFYFLLGLVYAVVTPILLPFILVFFGLAYVVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII A+V SQ+  +GL+STKHAA S PFL+ALP+LTISFHL+CKGRYE
Sbjct  614  ESAAAFWPDVHGRIISAMVISQLLLMGLMSTKHAALSTPFLLALPILTISFHLYCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERA+EP LNLKAYLQ+AY+HPVFK GDDDED++   +     +
Sbjct  674  PAFRRYPLQEAMMKDTLERAKEPNLNLKAYLQNAYIHPVFKGGDDDEDEDEIIEKLEATV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTP PSKVSG SSP +
Sbjct  734  LVPTKRQSRRNTPVPSKVSGDSSPSL  759



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score =   318 bits (815),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  557  AMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFGLAYIVYRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I AL+ SQ+  +GLL TKHAA++APFLI LPVLTI FH FCKGRYE
Sbjct  617  ESGAAFWPDVHGRVISALIISQLLLMGLLGTKHAASAAPFLIVLPVLTIGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERA+EP LNLK YLQDAY+HPVFK GDDD++ +M  KLE E +
Sbjct  677  PAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDDDDESDMLGKLEEEVV  736

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS++SG SSP +
Sbjct  737  IVPTKRQSRRNTPAPSRISGESSPSL  762



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 190/214 (89%), Gaps = 3/214 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFAL FSQ+S LGLL TKHA  SAPFLIALPVLTISFHL+CKGRYE
Sbjct  614  ESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLTISFHLYCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFTKYP+QEA+M+DTLE+AREP LNLK YLQ+AYVHPVFK+ D+DED++   KLE + +
Sbjct  674  PAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDEDFMMKLETDSV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILEKE  281
            LVPTKRQSR NTP PSKVS GSS   PDV++ ++
Sbjct  734  LVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  767



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score =   317 bits (811),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 181/212 (85%), Gaps = 3/212 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPI +PFI+VFF  AF+VYRHQIINVYNQEY
Sbjct  556  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPIFLPFILVFFALAFVVYRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWPAVHGRI+FAL+FSQI  +GL+STK A T+ PFLIALP+++  FHLFC+GR+E
Sbjct  616  ESAAAFWPAVHGRIMFALIFSQIVLIGLMSTKRAVTTTPFLIALPIMSYFFHLFCRGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  YPLQEA MKDTLERAREP LNLK YLQ++YVHPVFK+ +++EDD+       +  
Sbjct  676  PAFVNYPLQEAMMKDTLERAREPNLNLKGYLQNSYVHPVFKDEEEEEDDDHVNGKYDDNA  735

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILE  287
            +V TKRQSRRNTPAPSK+SG SS   PDV+ E
Sbjct  736  VVATKRQSRRNTPAPSKMSGASSPSLPDVVPE  767



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP+L+P+I+VFFG A++VYRHQIINVYNQEY
Sbjct  559  AMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPYILVFFGLAYIVYRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL+TK AA +APFLIALPV+TI FH FCKGRYE
Sbjct  619  ESAAAFWPDVHGRVISALIISQLLLMGLLATKRAALAAPFLIALPVITIGFHRFCKGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPL+EA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+D ++  KLE E I
Sbjct  679  PAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDDSDVVGKLEDEVI  738

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS+VSG SSP +
Sbjct  739  IVPTKRQSRRNTPAPSRVSGESSPSL  764



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  559  AMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA++APFLIALPV+TI FH FCKGR+E
Sbjct  619  ESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCKGRFE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQDAY+HPVFK GD+D+D +M  KLE E I
Sbjct  679  PAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDDGDMIGKLENEVI  738

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS++SG SSP +
Sbjct  739  IVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFAL FSQ+S LGLLSTKHA  SAPFLIALPVLTISFHL+CKGRYE
Sbjct  614  ESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHATQSAPFLIALPVLTISFHLYCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFTKYP+QEA+M+DTLE+AREP LNLK YLQ+AYVHPVFK+ D+DED++   KLE + +
Sbjct  674  PAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDEDFMMKLENDSV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR NTP PSKVS GSSP +
Sbjct  734  LVPTKRQSRMNTPVPSKVSAGSSPSL  759



>gb|AAL07154.1| unknown protein [Arabidopsis thaliana]
Length=772

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  559  AMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA++APFLIALPV+T  FH FCKGR+E
Sbjct  619  ESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITTGFHRFCKGRFE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQDAY+HPVFK GD+D+D +M  KLE E I
Sbjct  679  PAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDDGDMIGKLENEVI  738

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS++SG SSP +
Sbjct  739  IVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRI+FAL FSQ+S LGLLSTKHAA SAPFLIALPVLTISFHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIVFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLTISFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFTKYP+QEA+M+DTLE+AREP  NLK YLQ+AYVHPVFK  D+DED++   KLE + +
Sbjct  674  PAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDEDEDFLNKLENDSV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSR NTP PSKVS GSSP +
Sbjct  734  IVPTKRQSRLNTPVPSKVSAGSSPSL  759



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 181/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP IQLYFLLGLVYA VTP+L+P+I+VFFG A++VYRHQIINVYNQEY
Sbjct  559  AMDPGSIGFNTGEPXIQLYFLLGLVYAPVTPMLLPYILVFFGLAYIVYRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL+TK AA +APFLIALPV+TI FH FCKGRYE
Sbjct  619  ESAAAFWPDVHGRVISALIISQLLLMGLLATKRAALAAPFLIALPVITIGFHRFCKGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPL+EA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+D ++  KLE E I
Sbjct  679  PAFIRYPLEEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDDSDVVGKLEDEVI  738

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS+VSG SSP +
Sbjct  739  IVPTKRQSRRNTPAPSRVSGESSPSL  764



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLY LLGLVYA VTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPQIQLYILLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+   GLLSTK AA+S PFLIALPVLT+SFH +CKGR+E
Sbjct  618  ESAAAFWPDVHGRIITALIISQLLLFGLLSTKEAASSTPFLIALPVLTLSFHRYCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFT YPLQEA MKDTLERAREP LNLK YLQ AY+HPVF E D++ED E  EK E E +
Sbjct  678  PAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVFHECDEEEDHESFEKEESESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
            +VPTKRQSRRNTP PS+++GGSSP ++  +E
Sbjct  738  IVPTKRQSRRNTPVPSRMTGGSSPSLLDVEE  768



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFAL FSQ+S LGLLSTKHAA SAPFLIALPVLTISFHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLTISFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFTKYP+QEA+M+DTLE+AREP  NLK YLQ+AYVHPVFK  D+DED++   KLE + +
Sbjct  674  PAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDEDEDFMNKLETDSV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKR SR NTP PSKVS GSSP +
Sbjct  734  IVPTKRHSRLNTPVPSKVSAGSSPSL  759



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   311 bits (798),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 177/206 (86%), Gaps = 1/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI++FF  A++VYRHQIINVYNQEY
Sbjct  559  AMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILIFFALAYVVYRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPV+TI FH FCKGRYE
Sbjct  619  ESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAAFAAPFLIALPVITIGFHRFCKGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQDAY+HPVFK GDDD+ D + +      I
Sbjct  679  PAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDDDDGDMIGKLENEV-I  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  IVPTKRQSRRNTPAPSRISGESSPSL  763



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   311 bits (796),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFII+FF FA++V+RHQIINVYNQEY
Sbjct  530  AMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYVVFRHQIINVYNQEY  589

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLTI FH FC GR++
Sbjct  590  ESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHGFCNGRHK  649

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK GDDDEDD++S+KLE E +
Sbjct  650  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGDDDEDDDLSKKLETESV  709

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR+NTPAPSK+SG SSP +
Sbjct  710  LVPTKRQSRKNTPAPSKISGASSPSL  735



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   311 bits (797),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYAVVTP+ +PFI+VFF  A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPQIQLYFLLGLVYAVVTPVFLPFILVFFALAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALVFSQ+  +GL+STK AA S PFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRIISALVFSQLVLMGLMSTKGAAQSTPFLIALPVLTIWFHRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK+YL+ AY+HPVFK  +D E D+   +   E +
Sbjct  678  PAFIRYPLQEAMMKDTLERAREPNLNLKSYLRYAYIHPVFKNDEDGEHDDDISEKLDETV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR+NTPAPS +SG SSP +
Sbjct  738  LVPTKRQSRKNTPAPSMLSGASSPSL  763



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF+TGEPQIQLYFLLGLVYAVVTP+ +PFI+VFF  A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFDTGEPQIQLYFLLGLVYAVVTPVFLPFILVFFVLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VHGRIIFALVFSQ+  +GL+STK AA S PFLIALPVLT  FH FCKGRYE
Sbjct  618  ESAGAFWPDVHGRIIFALVFSQLVLMGLMSTKGAAASTPFLIALPVLTFFFHRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA +KDTLERAREP LNLK YLQ AYVHPVFK  +DDEDD++  K+E    
Sbjct  678  PAFVKYPLQEAMIKDTLERAREPGLNLKGYLQYAYVHPVFKNDEDDEDDDLHGKIEESIT  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
            ++PTKRQSRRNTP PSK+S  SS DV+ EKE
Sbjct  738  IIPTKRQSRRNTPVPSKISSESSADVVPEKE  768



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 182/209 (87%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQ YFLLGLVYA VTP L+PFIIVFFGFA++V+RHQIINVYNQEY
Sbjct  476  AMDPGSLGFNTGEPRIQFYFLLGLVYATVTPALLPFIIVFFGFAYVVFRHQIINVYNQEY  535

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGR++ AL+ SQ+  +GLLSTK AA S PFLIALP+LTI FH FCKGRYE
Sbjct  536  ESAAAYWPDVHGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIWFHRFCKGRYE  595

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk---egdddeddemseklem  383
            PAF KYPLQEA M+DTLERAREP LNLK YLQ+AY HPVFK   +GD+DED+ +SEKLE 
Sbjct  596  PAFVKYPLQEAMMRDTLERAREPNLNLKGYLQNAYAHPVFKEADDGDEDEDEILSEKLES  655

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            E +LVPTKRQSRRNTPAPS++SG SSP +
Sbjct  656  ESVLVPTKRQSRRNTPAPSRISGASSPSL  684



>ref|XP_009108550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
 ref|XP_009108551.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
Length=774

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 179/210 (85%), Gaps = 4/210 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI++FF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILIFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALIISQVLLMGLLGTKHAALAAPFLIALPVLTIGFHRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl----e  386
            PAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFK G+DD+DDE  +      E
Sbjct  678  PAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDDDEYGDDKLGKFE  737

Query  385  mEGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             E I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  DEAIIVPTKRQSRRNTPAPSRISGESSPSL  767



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 179/211 (85%), Gaps = 5/211 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI++FF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILIFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALMISQVLLMGLLGTKHAALAAPFLIALPVLTIGFHRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklem---  383
            PAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFK G+DD+DD+     ++   
Sbjct  678  PAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDDDDDYGDDKLGKF  737

Query  382  --EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
              E I+VPTKRQSRRNTPAPSK+SG SSP +
Sbjct  738  EDEAIIVPTKRQSRRNTPAPSKISGESSPSL  768



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 176/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + D D  ++   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLENAREPNLNLKGYLQNAYIHPVFKGDEDGDNINDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  IIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score =   309 bits (791),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 185/205 (90%), Gaps = 1/205 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+AGS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG AF+V+RHQIINVYNQ+Y
Sbjct  554  AMNAGSLGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAFIVFRHQIINVYNQKY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRIIFALVFSQ+S LGLL TKHAA SAPFLIALPVLTISFH FCKGRYE
Sbjct  614  ESGAAFWPDVHGRIIFALVFSQLSLLGLLGTKHAAQSAPFLIALPVLTISFHKFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAFT+YPLQEA+ KDTLERA+EP LNLKAYLQ+AY+HPVFK  D+DED+E  +KLE  G 
Sbjct  674  PAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKSDDEDEDEEFDDKLESNGT  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSP  302
            +LVPTKRQSR NTPAPS++S  SSP
Sbjct  734  VLVPTKRQSRENTPAPSRMSANSSP  758



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   308 bits (790),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + DDD+ D+   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  IIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_006413690.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
 gb|ESQ55143.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
Length=771

 Score =   308 bits (790),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ AYVHPVF+ + DDD+ D+   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLESAREPNLNLKGYLQSAYVHPVFRGDEDDDDIDDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  IIVPTKRQSRRNTPAPSRISGESSPSL  764



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + DDD+ D+   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  IIVPTKRQSRRNTPAPSRISGESSPSL  764



>emb|CDY21297.1| BnaC03g29810D [Brassica napus]
Length=768

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 176/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLL TK AA +APF+IALPV+TI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALIISQLLLMGLLVTKRAALAAPFIIALPVITIGFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERA+EP LNLK YLQDAY+HPVFK GD+D+DD+          
Sbjct  674  PAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDNDDDDDSVLGKLEGEV  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  734  IIVPTKRQSRRNTPAPSRISGESSPSL  760



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFII+FF FA++V+RHQIINVYNQEY
Sbjct  558  AMDAGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLTI FH F  GR++
Sbjct  618  ESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHSFSNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK G DDEDD++S+ LE E +
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGGDDEDDDLSKILETESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKRQSR+NTP PSK+SG SSP
Sbjct  738  LVPTKRQSRKNTPVPSKISGASSP  761



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  484  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  543

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  544  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  603

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AYVHPVFK + DD + D+   K E E 
Sbjct  604  PAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDIDDKLGKFEDEA  663

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS +SG  SP +
Sbjct  664  IIVPTKRQSRRNTPAPSIISGDDSPSL  690



>ref|XP_009134294.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134295.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134297.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
Length=768

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLL TK AA +APF+IALPV+TI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVITIGFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERA+EP LNLK YLQ+AY+HPVFK GD D+DD+          
Sbjct  674  PAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDDDDSVLGKLEGEV  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  734  IIVPTKRQSRRNTPAPSRISGESSPSL  760



>emb|CDX90856.1| BnaA03g25360D [Brassica napus]
Length=768

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLL TK AA +APF+IALPV+TI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVITIGFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERA+EP LNLK YLQ+AY+HPVFK GD D+DD+          
Sbjct  674  PAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDDDDSVLGKLEGEV  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  734  IIVPTKRQSRRNTPAPSRISGESSPSL  760



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  560  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  619

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  620  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  679

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AY+HPVFK + DDD+ D+   K E E 
Sbjct  680  PAFIRYPLQEAMMKDTLESAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDKLGKFEDEA  739

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG  SP +
Sbjct  740  IIVPTKRQSRRNTPAPSRISGEDSPSL  766



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ +Y+HPVFK + +DD+ D+   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLETAREPNLNLKGYLQTSYIHPVFKGDEEDDDIDDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS++SG SSP +
Sbjct  738  IIVPTKRQSRRNTPAPSRISGDSSPSL  764



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   306 bits (784),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 178/211 (84%), Gaps = 1/211 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYA VTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPQIQLYFLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+   GLLSTK AA+S PFLIALPVLT+ F  +CKGR+E
Sbjct  618  ESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAASSTPFLIALPVLTLWFRSYCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFT YPLQEA MKDTLERAREP LNLK YLQ AY+HPVF +  D+E+D   EK E E +
Sbjct  678  PAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVF-QECDEEEDHEFEKDESESV  736

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
            +VPTKRQSRRNTP PS+++GGSSP ++  +E
Sbjct  737  IVPTKRQSRRNTPVPSRMTGGSSPSLLDVEE  767



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   306 bits (784),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGSIGF+TGEPQIQLY LLGLVYAVVTPIL+PFI+VFFGF++LVYRHQIINVYNQEY
Sbjct  554  AMDAGSIGFDTGEPQIQLYILLGLVYAVVTPILLPFILVFFGFSYLVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII A+VFSQ+  +GL+ TK AA+S+PFLIALP+LTI FH FCKGR+E
Sbjct  614  ESAAAFWPSVHGRIISAMVFSQLLLMGLIGTKKAASSSPFLIALPILTIWFHRFCKGRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  YPLQEA MKDTLERAR+P  NLK YLQ+AY+HPVFK  DDD+  +   ++E E  
Sbjct  674  PAFKTYPLQEAMMKDTLERARDPNFNLKGYLQNAYIHPVFKSEDDDDIIQNKLEMETE--  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPT+RQSRRNTP PSK+S  SS
Sbjct  732  LVPTRRQSRRNTPVPSKMSHASS  754



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   306 bits (784),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AYVHPVFK + DD + D+   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDIDDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS +SG  SP +
Sbjct  738  IIVPTKRQSRRNTPAPSIISGDDSPSL  764



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   306 bits (784),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I ALV SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALVISQLFLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF +YPLQEA MKDTLE AREP LNLK YLQ+AYVHPVFK + DD + D+   K E E 
Sbjct  678  PAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDIDDKLGKFEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            I+VPTKRQSRRNTPAPS +SG  SP +
Sbjct  738  IIVPTKRQSRRNTPAPSIISGDDSPSL  764



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   306 bits (783),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+AGS+GFNTGEPQIQLYFLLGLVYAVVTP L+PFI+VFFG AF+V+RHQIINVYNQ+Y
Sbjct  554  AMNAGSLGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAFIVFRHQIINVYNQKY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+IFALVFSQ+S LGLLSTKHA  SAPFLIALPVLTISFH FCKGRYE
Sbjct  614  ESGAAFWPDVHGRVIFALVFSQLSLLGLLSTKHAVQSAPFLIALPVLTISFHKFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAFT+YPLQEA+ KDTLERA+EP LNLKAYLQ+AY+HPVFK  D+DED+E+ +KLE  G 
Sbjct  674  PAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKGDDEDEDEEIDDKLESNGT  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSP  302
            +LVPTKRQSR NTPAPS++S  SSP
Sbjct  734  VLVPTKRQSRENTPAPSRMSANSSP  758



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   306 bits (783),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLG+VYA +TP+L+PFIIVFFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSLGFNTGEPRIQLYFLLGMVYATITPVLLPFIIVFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQI+ +GLLST  AA S PFLIAL VLTI F+ FCK RYE
Sbjct  616  ESAAAFWPDVHGRIIIALLISQITLIGLLSTMQAAQSTPFLIALAVLTIWFYRFCKARYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YL +AYVHPVFKE DDD+ D+   K E E +
Sbjct  676  PAFVRYPLQEAMMKDTLERAREPNLNLKPYLHNAYVHPVFKEEDDDDGDDFMFKSENESV  735

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTP PS++SG SSP +
Sbjct  736  LVPTKRQSRRNTPVPSRISGASSPSL  761



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 176/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVIAALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk--egdddeddemseklemE  380
            PAF +YPLQEAKMKDTLE AREP LNL+ YLQ AYVHPVF+  E +DD DD+   K E E
Sbjct  678  PAFVRYPLQEAKMKDTLESAREPNLNLRGYLQSAYVHPVFRGDEDEDDYDDDKLGKFEEE  737

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSP  302
             I+VPTKRQSRRNTPA S++SG SSP
Sbjct  738  AIIVPTKRQSRRNTPAHSRISGESSP  763



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFI++FF FA++V+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFILIFFAFAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ LGL+STK AA SAPFLIALPVLTI FH F  GR++
Sbjct  618  ESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHSFSNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAR+P  NLKAYLQDAY+HPVFK G DDEDD++S+ LE E +
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGGDDEDDDLSKILETESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKRQSR+NTP PSK+SG SSP
Sbjct  738  LVPTKRQSRKNTPVPSKISGASSP  761



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LPVLTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLER REP  NLK YLQDAY+HPVFK  +D E D  S+  E+E  
Sbjct  674  PAFVRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEEDIESDAASKDGELEPS  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKRQSR NTP PSK SG S P
Sbjct  734  LVPTKRQSRFNTPLPSKRSGSSPP  757



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 178/213 (84%), Gaps = 2/213 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGS+ FNTGEPQIQLYFLLGLVYA+VTP L+PFI+VFF  A+ V+RHQIINVY+Q+Y
Sbjct  554  AMDAGSLDFNTGEPQIQLYFLLGLVYAIVTPFLLPFILVFFALAYFVFRHQIINVYHQKY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRIIFALVFSQIS LGLLSTK AA SAPFLIALPVLT+SFH FCKGRYE
Sbjct  614  ESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALPVLTLSFHYFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAFT+YPLQEAK KDT+E+A+E  LNLK YLQ+AY+HPVF+  D+D+++E          
Sbjct  674  PAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQNAYLHPVFRGDDEDDNEEELNDKLESND  733

Query  376  -ILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
             +L+P KRQSR NTPAPS++SG S  +++  +E
Sbjct  734  IVLIPMKRQSRGNTPAPSRISGASQEEMLQHQE  766



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LPVLTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLER REP  NLK YLQDAY+HPVFK  +D E D  SE  ++E  
Sbjct  674  PAFIRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEEDIESDAASEDGKLEPS  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKRQSR NTP PSK SG S P
Sbjct  734  LVPTKRQSRFNTPLPSKRSGSSPP  757



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   303 bits (777),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LIALPVLTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLIALPVLTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ+AY+HPVFK  DD + DE  E+ E E  
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPKLNLKSFLQNAYIHPVFKGEDDSDSDEAPEEFEKEPD  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPTKRQSRRNTP PSK    +S
Sbjct  734  LVPTKRQSRRNTPLPSKHGSAAS  756



>ref|XP_006469645.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
Length=599

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVVTP L+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  394  AMDPGTVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFIIVFFALAFVVYRHQIINVYNQEY  453

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LP+LTI FH FCKGRYE
Sbjct  454  ESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYE  513

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE ++ E D  SE+ + E +
Sbjct  514  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVEECESDPASEESDQEPV  573

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            L+PTKRQSR NTP PSK SG  +
Sbjct  574  LIPTKRQSRMNTPLPSKHSGSMT  596



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   303 bits (777),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR++ AL+ SQ+   GLLSTK AA S PFLIALPVLTI F+ +CKGR+E
Sbjct  618  ESAAAFWPDVHGRVVSALIISQLLLFGLLSTKRAAQSTPFLIALPVLTIWFYRYCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  YPLQEA MKDTLERA+EP LNLK YLQ AYVHPVF++ DDDED+E  +K E E +
Sbjct  678  PAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDNESIDKGENESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKR SRRNTP PSK++GGSSP +
Sbjct  738  IVPTKRHSRRNTPVPSKMTGGSSPSL  763



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score =   303 bits (776),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR+I AL+ SQ+  +GLL TKHAA +APFLIALPVLTI FH FCKGRYE
Sbjct  618  ESAAAFWPDVHGRVISALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk--egdddeddemseklemE  380
            PAF +YPLQEAKMKDTLE AREP LNL+ YLQ AYVHPVF+  E DDD DD+   K E E
Sbjct  678  PAFVRYPLQEAKMKDTLENAREPNLNLRGYLQSAYVHPVFRGDEDDDDYDDDKLGKFEEE  737

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSP  302
             I+VPTKRQSRRNTPA S++SG S P
Sbjct  738  AIIVPTKRQSRRNTPAHSRISGESPP  763



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVVTPIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVTPILLPFILVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFA++ SQ+  +GLLSTK AA S P LI LPVLTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIFAMIISQLLLMGLLSTKEAAQSTPLLITLPVLTIGFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLE+ REP LNLK +LQ AY+HPVFKEGDD + D  ++++  E +
Sbjct  674  PAFRRYPLQEAMMKDTLEKVREPNLNLKGFLQTAYIHPVFKEGDDSDSDSATDEIVEEPV  733

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
            LVPTKR SRR+TP PSK SG 
Sbjct  734  LVPTKRHSRRSTPLPSKHSGS  754



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR++ AL+ SQ+   GLLSTK AA S PFLIALPVLTI F+ +CKGR+E
Sbjct  618  ESAAAFWPDVHGRVVSALIISQLLLFGLLSTKEAAQSTPFLIALPVLTIWFYRYCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  YPLQEA MKDTLERA+EP LNLK YLQ AYVHPVF++ DDDED+E  +K E E +
Sbjct  678  PAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDNESIDKGENESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +VPTKR SRRNTP PS+++GGSSP +
Sbjct  738  IVPTKRHSRRNTPVPSRMTGGSSPSL  763



>gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69240.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=610

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYA VTP L+PFI++FFG A++V+RHQIINVYNQEY
Sbjct  394  AMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVYNQEY  453

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLTI F+ FCK RYE
Sbjct  454  ESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCKARYE  513

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+DE   K E E +
Sbjct  514  PAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEEDEFDFKSENESV  571

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  572  LVPTKRQSRRSTPAPSRISGASSPSL  597



>ref|XP_012080615.1| PREDICTED: CSC1-like protein At3g21620 [Jatropha curcas]
 gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+I FNTGEPQIQLYFLLGLVYAVV+PIL+PFII+FFG A++VYRHQIINVYNQ Y
Sbjct  554  AMDPGTISFNTGEPQIQLYFLLGLVYAVVSPILLPFIIIFFGLAYVVYRHQIINVYNQAY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRII ALV SQ+  +GLLSTKHAA S P L+ LPVLTI FHLFCKGRYE
Sbjct  614  ESAAAYWPDVHGRIIVALVVSQLLLMGLLSTKHAAQSTPLLVTLPVLTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++ Q+AY+HPVF  GDD + +E++E+LE E +
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKSFFQNAYIHPVFNGGDDSDHEEVTEELEKEPV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
            LVPT+RQSRRNTP PS  SG  S   +L ++
Sbjct  734  LVPTRRQSRRNTPLPSNRSGSFSSLALLPED  764



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP+L+PFI++FFG A++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYFLLGLVYASVTPMLLPFILIFFGLAYVVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLL TKHAA SAPFLIALPVLT+ FH FCKGR+E
Sbjct  618  ESGAAFWPDVHGRIIAALIISQLLLLGLLGTKHAAMSAPFLIALPVLTLGFHRFCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk-egdddeddemseklemEG  377
            PAF KYPLQEA MKDTLERAREP LNLK YLQ+AY+HPVFK + DDD+ D+M  KLE E 
Sbjct  678  PAFVKYPLQEAMMKDTLERAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDMFGKLEDEA  737

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDVI  293
            + VPTKRQSRRNTPAPS++SG  SP ++
Sbjct  738  VTVPTKRQSRRNTPAPSRISGEDSPSLL  765



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   301 bits (772),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LP+LTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ+AY HPVFK  DD + DE  E+ E E  
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDSDEAPEEFEKEPD  733

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
            LVPTKRQSRRNTP PSK SG 
Sbjct  734  LVPTKRQSRRNTPLPSKHSGS  754



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   301 bits (770),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  550  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEY  609

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LPVLTI FHLFCKGRYE
Sbjct  610  ESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRYE  669

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERA+EP LNLK++LQ+AY+HPVFK  DD + DE  E+ E E  
Sbjct  670  PAFVRYPLQEAMMKDTLERAKEPNLNLKSFLQNAYIHPVFKGEDDSDSDEAPEEFEKEPD  729

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPTKRQSRRNTP PSK    +S
Sbjct  730  LVPTKRQSRRNTPLPSKHGSAAS  752



>ref|XP_012092360.1| PREDICTED: uncharacterized protein LOC105650086 [Jatropha curcas]
Length=1697

 Score =   310 bits (794),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 180/209 (86%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQ YFLLGLVYA VTP L+PFIIVFFGFA++V+RHQIINVYNQEY
Sbjct  557  AMDPGSLGFNTGEPRIQFYFLLGLVYATVTPALLPFIIVFFGFAYVVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGR++ AL+ SQ+  +GLLSTK AA S PFLIALP+LTI FH FCKGRYE
Sbjct  617  ESAAAYWPDVHGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIWFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddem---seklem  383
            PAF KYPLQEA M+DTLERAREP LNLK YLQ+AY HPVFKE DD ++DE    SEKLE 
Sbjct  677  PAFVKYPLQEAMMRDTLERAREPNLNLKGYLQNAYAHPVFKEADDGDEDEDEILSEKLES  736

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            E +LVPTKRQSRRNTPAPS++SG SSP +
Sbjct  737  ESVLVPTKRQSRRNTPAPSRISGASSPSL  765



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGS+ FNTGEPQIQLYFLLGLVYA+VTP L+PFI+VFF  A+ V+RHQIINVY+QEY
Sbjct  553  AMDAGSLNFNTGEPQIQLYFLLGLVYAIVTPFLLPFILVFFALAYFVFRHQIINVYHQEY  612

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRIIFALVFSQIS LGLLSTK AA SAPFLIALPVLT+SFH FCKGRYE
Sbjct  613  ESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALPVLTLSFHYFCKGRYE  672

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFT+YPLQEAK KDT+E+A+E  LNLK YLQ AY+HPVF+  D D+++++++KLE   +
Sbjct  673  PAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQKAYLHPVFRGDDVDDNEDVNDKLESNDV  732

Query  373  -LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
             L+P KR SR +TP PS++SG S  +++  +E
Sbjct  733  ELIPMKRHSRGSTPGPSRISGASQEEMLQHQE  764



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+ GFNTGEPQIQLYFLLGLVYAVVTP L+P+IIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFALV SQ+  +GLLSTK AA S P LI LP+LTISFHL+CKGRYE
Sbjct  614  ESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILTISFHLYCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF K+PLQEA MKDTLERAREP  NLK +LQ+AY+HPVFK  DD + D MSE  E +  
Sbjct  674  PAFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDSDVMSENWEEQEP  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSS  305
            +LV TKRQSR+NTP PSK SG  S
Sbjct  734  VLVQTKRQSRKNTPLPSKHSGSLS  757



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 171/204 (84%), Gaps = 1/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+ GFNTGEPQIQLYFLLGLVYAVVTP L+P+IIVFFG A++VYRHQIINVYNQEY
Sbjct  556  AMDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGLAYVVYRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFALV SQ+  +GLLSTK AA S P LI LP+LTISFHL+CKGRYE
Sbjct  616  ESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILTISFHLYCKGRYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF K+PLQEA MKDTLERAREP  NLK +LQ+AY+HPVFK  DD + D MSE  E +  
Sbjct  676  PAFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDSDVMSENWEEQEP  735

Query  376  ILVPTKRQSRRNTPAPSKVSGGSS  305
            +LV TKRQSR+NTP PSK SG  S
Sbjct  736  VLVQTKRQSRKNTPLPSKHSGSLS  759



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVVTP L+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  554  AMDPGTVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFIIVFFALAFVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LP+LTI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE ++ E D  SE+ + E +
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVEECESDPASEESDQEPV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            L+PTKRQSR NTP PSK SG  +
Sbjct  734  LIPTKRQSRMNTPLPSKHSGSMT  756



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GSIGFNTGEP+IQLY LLGLVYA VTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  558  AMNPGSIGFNTGEPRIQLYLLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+   GLLSTK AA S PFLIALPVLT+ FH +CKGR+E
Sbjct  618  ESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLWFHRYCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLE+AREP LNLK YLQ AY+HPVFKE DD+ED E  EK E E +
Sbjct  678  PAFKRYPLQEAMMKDTLEQAREPNLNLKGYLQSAYIHPVFKECDDEEDHESFEKGETESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            +V TKR SRRNTPAPS+++GGSSP
Sbjct  738  IVATKRHSRRNTPAPSRMTGGSSP  761



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 169/202 (84%), Gaps = 0/202 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVY+VVTP L+P+IIVFFG A+LVYRHQIINVYNQEY
Sbjct  554  AMDPGTIGFNTGEPQIQLYFLLGLVYSVVTPFLLPYIIVFFGLAYLVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VHGRI+FALV SQ+  +GLLSTK AA S P LIALPVLTI FH FCKG YE
Sbjct  614  ESAGAFWPDVHGRIVFALVVSQLLLMGLLSTKEAANSTPLLIALPVLTIWFHRFCKGSYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAFT +PLQEA +KDTLER +EP  NLK +L DAY+HPVF +  D + D MS++ + E +
Sbjct  674  PAFTTHPLQEAMVKDTLERTKEPNFNLKDFLHDAYIHPVFNDDGDTDSDVMSQEWKEEPV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGS  308
            +V TKRQSR+NTPAPSK SGGS
Sbjct  734  IVQTKRQSRKNTPAPSKHSGGS  755



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYA VTP L+PFI++FFG A++V+RHQIINVYNQEY
Sbjct  548  AMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVYNQEY  607

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLTI F+ FCK RYE
Sbjct  608  ESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCKARYE  667

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+DE   K E E +
Sbjct  668  PAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEEDEFDFKSENESV  725

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  726  LVPTKRQSRRSTPAPSRISGASSPSL  751



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA + P+++PFIIVFFGFA+LV+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNTGEPRIQLYFLLGLVYAAMNPVILPFIIVFFGFAYLVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII AL+ SQ++ LGLL TK  A S P LI LPVLTI F  FCKGRYE
Sbjct  618  ESGAAFWPDVHLRIIIALITSQVALLGLLGTKENAQSTPVLIVLPVLTIWFFRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAREP LNLK YLQ AY+HP+FKE +D++DD +SEK + E  
Sbjct  678  SAFVKYPLQEAMMKDTLERAREPHLNLKGYLQVAYIHPIFKESEDEDDDVVSEKWDTEST  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTP PSK+SGGSSP +
Sbjct  738  LVPTKRQSRRNTPLPSKISGGSSPSM  763



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   298 bits (764),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYA VTP L+PFI++FFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLTI F+ FCK RYE
Sbjct  616  ESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCKARYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+DE   K E E +
Sbjct  676  PAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEEDEFDFKSENESV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  734  LVPTKRQSRRSTPAPSRISGASSPSL  759



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   298 bits (764),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYA VTP L+PFI++FFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLTI F+ FCK RYE
Sbjct  616  ESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCKARYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+DE   K E E +
Sbjct  676  PAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEEDEFDFKSENESV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  734  LVPTKRQSRRSTPAPSRISGASSPSL  759



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   298 bits (762),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTPIL+PFI+VFFG A+LV+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNTGEPQIQLYFLLGLVYAVVTPILLPFIVVFFGLAYLVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LIALPVLTI FH FCK RYE
Sbjct  618  ESAAAFWPDVHGRIITALIISQLLLMGLLSTKRAAQSTPLLIALPVLTIWFHRFCKSRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQ+AYVHPVF +G+D++ D  +E+L+ E +
Sbjct  678  PAFIRYPLQEAMMKDTLERAREPNLNLKGYLQNAYVHPVF-KGEDEDSDAFTEELQKESV  736

Query  373  LVPTKRQSRRNTPAP  329
            LVPTKRQSRRNTP P
Sbjct  737  LVPTKRQSRRNTPLP  751



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   298 bits (762),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLY LLGLVYA VTP L+PFII+FFG A++V+RHQIINVY QEY
Sbjct  558  AMDPGSIGFNTGEPRIQLYVLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYKQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+   GLLSTK AA S PFLIALPVLT+ FH +CKGR+E
Sbjct  618  ESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLXFHRYCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  +PLQEA MKDTLE+AR+P LNLK YLQ AY+HPVFKE  D+ D+E  +K E E +
Sbjct  678  PAFKTFPLQEAMMKDTLEQARDPNLNLKGYLQSAYIHPVFKECGDEXDNESLZKSETESV  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +V TKRQSRRNTPAPS+++GGSSP +
Sbjct  738  IVATKRQSRRNTPAPSRMTGGSSPSM  763



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAV+TP L+P+IIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTIGFNTGEPQIQLYFLLGLVYAVITPFLLPYIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP +HGRIIFALV SQ+  +GLLSTK AA S P LI LPVLTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDIHGRIIFALVISQLLLMGLLSTKEAANSTPLLIILPVLTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF ++PLQEA MKDTLERAREP LN K +LQ+AY+HPVFK  +D + D MS++ E E +
Sbjct  674  PAFVQHPLQEAMMKDTLERAREPQLNYKEFLQNAYIHPVFKSDEDSDSDVMSQEFEDEPM  733

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
            LV TKRQSR+NTP PSK S  
Sbjct  734  LVQTKRQSRKNTPLPSKHSSS  754



>gb|KCW77011.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=663

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQ YFLLGLVYA VTP L+PFI+VFFG A++V+RHQIINVYNQEY
Sbjct  447  AMDPGSIGFNTGEPQIQFYFLLGLVYATVTPALLPFILVFFGLAYVVFRHQIINVYNQEY  506

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R+I ALV SQ+   GL++TK AA S PFLIALPVLTI FH+FCKGR+E
Sbjct  507  ESAAAFWPDVHRRVIVALVVSQLLLFGLMATKQAANSTPFLIALPVLTIYFHMFCKGRFE  566

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERAREP +NLK++LQ+AY+HPVFK  DDD++D+     + +  
Sbjct  567  PAFVRYPLQEAMMKDTLERAREPHVNLKSFLQNAYLHPVFKSADDDDEDDDDVDEKWDNE  626

Query  376  -ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             +LVPTKR SRRNTP PS++S  SSP +
Sbjct  627  SVLVPTKRSSRRNTPLPSRISTTSSPSL  654



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 178/214 (83%), Gaps = 3/214 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM  GS+GFNTGEP+IQ YFLLGLVYA VTP L+PFIIVFF FA++V+RHQIINVY+QEY
Sbjct  556  AMHPGSLGFNTGEPRIQFYFLLGLVYATVTPTLLPFIIVFFAFAYVVFRHQIINVYDQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I AL+ SQ+  +GLLSTK AA S PFLI LPVLTI FH FCKGRYE
Sbjct  616  ESGAAFWPDVHGRVITALIISQVLMIGLLSTKRAAQSTPFLIVLPVLTIWFHRFCKGRYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk---egdddeddemseklem  383
            PAF KYPLQEA MKDTLERAREP LNLK +LQ+AY HPVFK     DDDE+D++SEKLE 
Sbjct  676  PAFVKYPLQEAMMKDTLERAREPNLNLKPFLQNAYRHPVFKNDDGDDDDENDDISEKLET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
            E +LVPTKRQSRRNTP PS++SG SSP +   KE
Sbjct  736  ESVLVPTKRQSRRNTPVPSRISGASSPSLSELKE  769



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 181/213 (85%), Gaps = 3/213 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYAVVTP+L+PFIIVFF  A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAVVTPVLLPFIIVFFCLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  +GLLSTK AA S PFLIALP+LTISFH +CKGR+E
Sbjct  616  ESGAAFWPDVHGRIIGALIISQLLLMGLLSTKQAAQSTPFLIALPILTISFHYYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEAKMKDTLERAREP LNLK YLQ AY+HPVFK  +DDE++E+  K E +  
Sbjct  676  PAFIRYPLQEAKMKDTLERAREPHLNLKGYLQTAYIHPVFKSAEDDEEEEIHGKWEHDAE  735

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILEK  284
            LVPTKRQSRRNTP PSK SG SS   P+V+ E+
Sbjct  736  LVPTKRQSRRNTPLPSKFSGSSSPSLPEVVEER  768



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFIIVFF   F+V+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNTGEPRIQLYFLLGLVYATVTPLLLPFIIVFFALGFVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII+AL+FSQ+  +GLLSTK AA S PFLIALPV+TISFHL+CKGRYE
Sbjct  618  ESAAAFWPDVHGRIIYALIFSQVVLMGLLSTKKAAQSTPFLIALPVITISFHLYCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YP+QEA MKDTLERAREP LNLK YL  AY HPVFKE +DD++ E +E  E E +
Sbjct  678  PAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVFKESEDDDEVESNEAFETESV  737

Query  373  LVPTKRQSRRNTP  335
            LV TKRQSRRNTP
Sbjct  738  LVATKRQSRRNTP  750



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYA VTP L+PFI++FFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ++ +GLL++K AA S PFLIAL VLTI F+  CK RYE
Sbjct  616  ESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTLCKARYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK YLQ+AY+HPV    ++DE+DE   K E E +
Sbjct  676  PAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPV--FKEEDEEDEFDFKSENESV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRR+TPAPS++SG SSP +
Sbjct  734  LVPTKRQSRRSTPAPSRISGASSPSL  759



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   295 bits (756),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 163/201 (81%), Gaps = 0/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAVVTPIL+PFIIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII AL+ SQ+  +GLLSTK AA S P LI LPVLTI FH FCKGRYE
Sbjct  614  ESGAAFWPDVHARIIVALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK +LQ AY HPVFK  DD E D   E+ E E  
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKGFLQSAYTHPVFKSADDSESDITMEESEQEPA  733

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
            L+PTKR SRR TP PSK SG 
Sbjct  734  LIPTKRTSRRCTPLPSKHSGS  754



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   295 bits (755),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LP+LTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ+AY HPVFK  DD + DE  E+ E E  
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDSDEAPEEFEKEPD  733

Query  373  LVPTKRQSRRNTPAP  329
            LVPTKRQSRRNTP P
Sbjct  734  LVPTKRQSRRNTPLP  748



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   295 bits (756),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 176/209 (84%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFIIVFFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYASVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH R+I AL+ SQI  +GLL+TK AA+S PFLI LPVLTI FH++CKGR+E
Sbjct  616  ESGAAFWPDVHFRVIIALIVSQIVLMGLLTTKKAASSTPFLIVLPVLTIWFHIYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkeg---dddeddemseklem  383
            PAF +YPLQEA MKDTLERA +P  NLKAYLQ+AYVHPVFK     +D++++ MS KLE 
Sbjct  676  PAFVRYPLQEAMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDEDEEVMSLKLET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            E + VPTKRQSRRNTP PS++SG SSP +
Sbjct  736  ESLTVPTKRQSRRNTPLPSRISGASSPSL  764



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   295 bits (755),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 172/205 (84%), Gaps = 6/205 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF+TGEPQIQLYFLLGLVYAVVTPI +PFI+VFF FA++VYRHQIINVYNQEY
Sbjct  558  AMDPGSIGFDTGEPQIQLYFLLGLVYAVVTPIFLPFILVFFAFAYMVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP VHGRII A++FSQ+  +GL+STK AA S PFL+ LPV+TI FH FCKGRYE
Sbjct  618  ESAAEFWPDVHGRIISAMIFSQLVLMGLMSTKGAAASTPFLLVLPVITIFFHRFCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemE--  380
            PAF KYPLQEA M+DTLERAREP  NLK+++++AYVHPVFK  +DD+++E       +  
Sbjct  678  PAFLKYPLQEAMMRDTLERAREPNFNLKSFMRNAYVHPVFKNDEDDDEEEDEVGSNRKNG  737

Query  379  ----GILVPTKRQSRRNTPAPSKVS  317
                G++VPTKRQSRR+TPAPSK+S
Sbjct  738  DDDGGVIVPTKRQSRRSTPAPSKIS  762



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  AF+VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII A++ SQ+  +GLLSTK AA S P LI LPVLTI FHLFCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ+AY HPVFK  DD + D   E+ E E  
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKGEDDSDSDGAPEEFEKEPD  733

Query  373  LVPTKRQSRRNTPAP  329
            LVPTKRQSRRNTP P
Sbjct  734  LVPTKRQSRRNTPLP  748



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   294 bits (753),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQ YFLLGLVYA VTP L+PFI+VFFG A++V+RHQIINVYNQEY
Sbjct  558  AMDPGSIGFNTGEPQIQFYFLLGLVYATVTPALLPFILVFFGLAYVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R+I ALV SQ+   GL++TK AA S PFLIALPVLTI FH+FCKGR+E
Sbjct  618  ESAAAFWPDVHRRVIVALVVSQLLLFGLMATKQAANSTPFLIALPVLTIYFHMFCKGRFE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERAREP +NLK++LQ+AY+HPVFK  DDD++D+     + +  
Sbjct  678  PAFVRYPLQEAMMKDTLERAREPHVNLKSFLQNAYLHPVFKSADDDDEDDDDVDEKWDNE  737

Query  376  -ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             +LVPTKR SRRNTP PS++S  SSP +
Sbjct  738  SVLVPTKRSSRRNTPLPSRISTTSSPSL  765



>ref|XP_006447608.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
 gb|ESR60848.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
Length=590

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAVV P L+PFIIVFF  AF+VY HQ+INVYNQEY
Sbjct  385  AMDPGAIGFNTGEPQIQLYFLLGLVYAVVAPFLLPFIIVFFALAFVVYIHQVINVYNQEY  444

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LP+LTI FH FCKGRYE
Sbjct  445  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYE  504

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE  + E D  SE+ + E +
Sbjct  505  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVQESESDPASEESDQEPV  564

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            L+PTKRQSR NT  PSK SG  +
Sbjct  565  LIPTKRQSRMNTLLPSKHSGSMT  587



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   290 bits (742),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++ FNTGEP+IQLYFLLGLVYAVVTP+L+PFI+ FFG A++VYRHQIINVYNQEY
Sbjct  415  AMDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEY  474

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LTI F+ FCKGRYE
Sbjct  475  ESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYE  534

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD + E   +   +  
Sbjct  535  PAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIETDSEDRQQEP  594

Query  376  ILVPTKRQSRRNTPAPSKVSG  314
             LVPTKRQSRRNTP  SK SG
Sbjct  595  ALVPTKRQSRRNTPLQSKHSG  615



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  A++VYRHQIINVYNQEY
Sbjct  504  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEY  563

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LPVLTISFH FCKGRYE
Sbjct  564  ESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRYE  623

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K PLQEA  KDTLE  REP LNLK +LQ AYVHPVFK  DD + D  +E+LE+E  
Sbjct  624  PAFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDSDSDGAAEELEVEPA  683

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
            +V TKRQSRRNTP PSK SG 
Sbjct  684  VVRTKRQSRRNTPVPSKYSGS  704



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   290 bits (742),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++ FNTGEP+IQLYFLLGLVYAVVTP+L+PFI+ FFG A++VYRHQIINVYNQEY
Sbjct  435  AMDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEY  494

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LTI F+ FCKGRYE
Sbjct  495  ESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYE  554

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD + E   +   +  
Sbjct  555  PAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIETDSEDRQQEP  614

Query  376  ILVPTKRQSRRNTPAPSKVSG  314
             LVPTKRQSRRNTP  SK SG
Sbjct  615  ALVPTKRQSRRNTPLQSKHSG  635



>ref|XP_006387597.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
 gb|ERP46511.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
Length=696

 Score =   291 bits (745),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GF+TGEP+IQLYFLLGLVYA VTP+L+PFI++FF FA+LV+RHQIINVYN EY
Sbjct  483  AMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIVIFFAFAYLVFRHQIINVYNHEY  542

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII  LV SQ++ +GLLSTK AA S PFLIALPVLTI FH FC GR++
Sbjct  543  ESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLTIWFHRFCNGRHK  602

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAR+P  NLKA L  AYVHP+F +GDDD++D++S ++E E +
Sbjct  603  SAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIF-KGDDDDEDDLSVEMETESV  661

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQS+RNTP PSK+SGG SP +
Sbjct  662  LVPTKRQSQRNTPVPSKISGGYSPSL  687



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   293 bits (749),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLTI FH FCKG YE
Sbjct  614  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGCYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  DD E++  +E+ E E  
Sbjct  674  PAFIRYPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKGEDDSENEAAAEECEKEPA  733

Query  373  LVPTKRQSRRNTPAP  329
            +VPTKRQSRRNTP P
Sbjct  734  VVPTKRQSRRNTPLP  748



>gb|KDO39720.1| hypothetical protein CISIN_1g048588mg [Citrus sinensis]
Length=615

 Score =   289 bits (739),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAVV P L+PFIIVFF  AF+VY HQ+INVYNQEY
Sbjct  378  AMDPGAIGFNTGEPQIQLYFLLGLVYAVVAPFLLPFIIVFFALAFVVYIHQVINVYNQEY  437

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LP+LTI FH FCKGRYE
Sbjct  438  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYE  497

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAREP LNLK++LQ AY+HPVFKE  + E D  SE+ + E +
Sbjct  498  PAFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVQESESDPASEESDQEPV  557

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            L+PTKRQSR NT  PSK SG  +
Sbjct  558  LIPTKRQSRMNTLLPSKHSGSMT  580



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  A++VYRHQIINVYNQEY
Sbjct  553  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEY  612

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LPVLTISFH FCKGRYE
Sbjct  613  ESAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRYE  672

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K PLQEA  KDTLE  REP LNLK +LQ AYVHPVFK  DD + D  +E+LE+E  
Sbjct  673  PAFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDSDSDGAAEELEVEPA  732

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
            +V TKRQSRRNTP PSK SG 
Sbjct  733  VVRTKRQSRRNTPVPSKYSGS  753



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score =   292 bits (748),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFIIVFFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAAVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII AL+ SQI  +GLL+TK AA+S PFLI LP+LTI FH +CKGR+E
Sbjct  616  ESGAAFWPDVHFRIILALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---ddeddemseklem  383
             AF KYPLQEA MKDTLERA EP LNLKAYLQ+AYVHPVFK      DDED+E       
Sbjct  676  SAFVKYPLQEAMMKDTLERATEPNLNLKAYLQNAYVHPVFKASLGEDDDEDEEAISLKWE  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
               +VPTKRQSR+NTP PS++SG SSP +
Sbjct  736  TESIVPTKRQSRKNTPLPSRISGASSPSL  764



>ref|XP_004151944.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Cucumis 
sativus]
 ref|XP_011649986.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Cucumis 
sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++ FNTGEP+IQLYFLLGLVYAVVTP+L+PFI+ FFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LTI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD + E   +   +  
Sbjct  674  PAFVRYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIEADSEDWQQEP  733

Query  376  ILVPTKRQSRRNTPAPSKVSG  314
             LVPTKRQSRRNTP  SK SG
Sbjct  734  ALVPTKRQSRRNTPLQSKHSG  754



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 174/210 (83%), Gaps = 4/210 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFIIVFFG A++V+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYASVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH R+I AL+ SQI  +GLL+TK AA+S PFLI LPVLTI FH++CKGR+E
Sbjct  616  ESGAAFWPDVHFRVIIALIVSQIVLMGLLTTKEAASSTPFLIVLPVLTIWFHIYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd----ddeddemsekle  386
            PAF +YPLQEA MKDTLERA +P  NLKAYLQ+AYVHPVFK       +++++ MS KLE
Sbjct  676  PAFVRYPLQEAMMKDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDEEDEEVMSLKLE  735

Query  385  mEGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             E + VPTKRQSRRNTP  S++SG SSP +
Sbjct  736  TESVTVPTKRQSRRNTPLASRISGASSPSL  765



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+ GFNTGEPQIQLYFLLGLVYAVVTP L+P+I+VFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIVVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VHGRI+FALV SQ+  +GLLSTK AA S P LI LP+LTI FH FCKG YE
Sbjct  614  ESAGAFWPDVHGRIVFALVISQLLLMGLLSTKKAANSTPLLITLPILTIWFHRFCKGSYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  +PLQEA +KDTLER +EP  NLK +LQ+AY+HPVF   +D + D MS++ E E +
Sbjct  674  PAFITHPLQEAMVKDTLERTKEPNFNLKEFLQNAYIHPVFNGDEDTDSDVMSKEWEQEPV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
             V TKRQSRRNTP PSK SGGS P
Sbjct  734  TVQTKRQSRRNTPMPSKHSGGSLP  757



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   291 bits (744),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLTI FH FCKG YE
Sbjct  614  ESAAAFWPDVHGRIITALIISQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGCYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERA EP LNLK++LQ+AY+HPVFK  DD E++  +E+ E E  
Sbjct  674  PAFIRYPLQEAMMKDTLERATEPNLNLKSFLQNAYIHPVFKGEDDGENETAAEECEKEPA  733

Query  373  LVPTKRQSRRNTPAP  329
            +VPTKRQSRRNTP P
Sbjct  734  VVPTKRQSRRNTPLP  748



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   290 bits (743),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 168/217 (77%), Gaps = 13/217 (6%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVVTP+L+PFIIVFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSLGFNTGEPQIQLYFLLGLVYAVVTPVLLPFIIVFFALAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH RII ALV SQ+  +GLLSTK A  S P LI LPVLTI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHRRIITALVVSQLLLMGLLSTKEATQSTPLLITLPVLTIWFHFFCKGRYE  673

Query  553  PAFTKYPL-------------QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddde  413
            PAF  YPL             QEA MKDTLERAREP LNLK +LQ+AYVHPVFK  DD +
Sbjct  674  PAFVTYPLQLFLLFVSSSAGSQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKGEDDSD  733

Query  412  ddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSP  302
             D  +E L+ E  +VPTKRQSRRNTP PSK SG  +P
Sbjct  734  SDAATEDLKEEPAIVPTKRQSRRNTPLPSKQSGPLNP  770



>ref|XP_004145433.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Cucumis sativus]
 ref|XP_011660305.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Cucumis sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFIIVFF   F+V+RHQIINVYNQEY
Sbjct  558  AMNPGSLGFNTGEPRIQLYFLLGLVYATVTPLLLPFIIVFFALGFVVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII+AL+FSQ+  +GLLSTK AA S PFL+ALPV+TISFHL+CKGRYE
Sbjct  618  ESAAAFWPDVHGRIIYALIFSQVILMGLLSTKKAAQSTPFLLALPVITISFHLYCKGRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YP+QEA MKDTLERAREP LNLK YL  AY HPV KE ++D++ E +E  E E +
Sbjct  678  PAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVIKESEEDDEVESNEAFETESV  737

Query  373  LVPTKRQSRRNTP  335
            LV TKRQSRRNTP
Sbjct  738  LVATKRQSRRNTP  750



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++ FNTGEP+IQLYFLLGLVYAVVTP+L+PFI+ FFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  +GLLSTK AA S P LIALP+LTI F+ FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEA MKDTLERAREP LNLK +LQ+AYVHPVFK  +DD + E   +   +  
Sbjct  674  PAFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIETDSEDRQQEP  733

Query  376  ILVPTKRQSRRNTPAPSKVSG  314
             LVPTKRQSRRNTP  SK SG
Sbjct  734  ALVPTKRQSRRNTPLQSKHSG  754



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  A++VYRHQIINVYNQEY
Sbjct  351  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEY  410

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLTI FH FCKGRYE
Sbjct  411  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHXFCKGRYE  470

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF ++PLQEA MKDTLER REP LN+K +LQ+AY+HPVFK  DD E+   +++ E E  
Sbjct  471  PAFIRHPLQEAMMKDTLERTREPNLNMKGFLQNAYIHPVFKGEDDSENXAPAQEFEKEPX  530

Query  373  LVPTKRQSRRNTPAP  329
            +V TKR SRRNTP P
Sbjct  531  VVLTKRSSRRNTPMP  545



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 176/214 (82%), Gaps = 3/214 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFN+GEP+IQ YFLLGLVYA VTP+L+PFIIVFF  A++V+RHQIINVYNQ Y
Sbjct  558  AMDPGSLGFNSGEPRIQFYFLLGLVYATVTPLLLPFIIVFFALAYVVFRHQIINVYNQRY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH RII AL+ SQ+  +GLLSTK AA S PFLIALPVLTI FH F K RYE
Sbjct  618  ESAAAFWPDVHRRIIAALIISQLLLMGLLSTKKAALSTPFLIALPVLTIWFHYFSKDRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAREP LNLK YL++AY+HPVF +G+DD+DD +    E E +
Sbjct  678  SAFVKYPLQEAMMKDTLERAREPNLNLKGYLRNAYIHPVF-KGEDDDDDALFNNEENENV  736

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV--ILEKEP  278
            LV TKRQSRRNTP PSK+SG SSP +  +++++P
Sbjct  737  LVLTKRQSRRNTPVPSKMSGASSPSLPEVVQEDP  770



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+ GFNTGEPQIQLYFLLGLVYAVVTP L+P+IIVFFGFA++VYRHQIINVYNQEY
Sbjct  556  AMDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGFAYVVYRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRIIFALV SQ+  +GLLSTK AA S P LI LPVLTISFHL+CKGRY+
Sbjct  616  ESAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPVLTISFHLYCKGRYQ  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF K+PLQEA MKDTLERAREP  NLK +LQ AY+HPVFK  DD + + MSEK E +  
Sbjct  676  PAFIKHPLQEAMMKDTLERAREPNFNLKEFLQSAYIHPVFKGDDDSDSEVMSEKWEEQEP  735

Query  376  ILVPTKRQSRRNT  338
            ++V TKRQSRRNT
Sbjct  736  VVVQTKRQSRRNT  748



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   287 bits (735),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFII+FF FAF V+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAFAVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLTI FH+FC GR++
Sbjct  618  ESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIWFHMFCNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsek--lemE  380
             AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  DDD D++      +E E
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDEDDLLSGKMETE  737

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  738  SVLVPTKRQSRRNTPAPSKISGGSSPSL  765



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEP+IQLYFLLGLVYA VTP+L+PFII+FF FAF V+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAFAVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLTI FH+FC GR++
Sbjct  618  ESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIWFHMFCNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsek--lemE  380
             AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  DDD D++      +E E
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDEDDLLSGKMETE  737

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  738  SVLVPTKRQSRRNTPAPSKISGGSSPSL  765



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLG VYAVVTP LIPFI+VFF FA+++YRHQIINVYNQ Y
Sbjct  558  AMDPGSIGFNTGEPQIQLYFLLGFVYAVVTPFLIPFILVFFAFAYVIYRHQIINVYNQVY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSA-PFLIALPVLTISFHLFCKGRY  557
            ESAAAFWP VHGRIIF+LVFSQI  LGLLS+K AA  A PFLIALP+LTI FH+ CKGRY
Sbjct  618  ESAAAFWPGVHGRIIFSLVFSQIVLLGLLSSKGAAQEATPFLIALPILTIWFHIVCKGRY  677

Query  556  EPAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegddd--eddemseklem  383
            EPAF +YPLQEA +KDTLE+ RE  LNLK YL+DAYVHPVFK  D +     +  +    
Sbjct  678  EPAFIRYPLQEAMIKDTLEKTRERNLNLKKYLRDAYVHPVFKNDDANDDHGYDYDDDSTK  737

Query  382  EGILVPTKRQSRRNTPAPSKVSGG  311
            +  LVPTKRQSRR+TP PS  S  
Sbjct  738  DNNLVPTKRQSRRSTPVPSIASND  761



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 171/212 (81%), Gaps = 2/212 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYA+VTPIL+PFIIVFF  AF+V+RHQIINVYNQEY
Sbjct  435  AMDPGTIGFNTGEPQIQLYFLLGLVYAIVTPILLPFIIVFFALAFVVFRHQIINVYNQEY  494

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LPVLTI FH FCKGRYE
Sbjct  495  ESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPVLTIWFHRFCKGRYE  554

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  DDD+ D + E+ E E  
Sbjct  555  PAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADDDKIDVVMEEWEEEPS  614

Query  373  LVPTKRQSRRNTPAPSK--VSGGSSPDVILEK  284
            L+ TKR S+R+TP  SK   S  SSP+   E+
Sbjct  615  LIATKRTSKRSTPLSSKHGRSSFSSPEANKER  646



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFN+GEP+IQLYFLLGLVYA VTP+L+PFII+FF FAF V+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFNSGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAFAVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGR+I ALV SQ++ +GL+STK AA S PFLIALPVLTI FH+FC GR++
Sbjct  618  ESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIWFHMFCNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsek--lemE  380
             AF KYPLQEA MKDTLERAR+P  NLKAYLQ AYVHPVFK  DDD D++      +E E
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDEDDLLSGKMETE  737

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             +LVPTKRQSRRNTPAPSK+SGGSSP +
Sbjct  738  SVLVPTKRQSRRNTPAPSKISGGSSPSL  765



>ref|XP_011046982.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=672

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 171/208 (82%), Gaps = 7/208 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGS+GFNTGEP+IQLYFLLGLVYA VTPIL+PFI++FFGFA++VYRHQIINVYNQEY
Sbjct  455  AMDAGSLGFNTGEPRIQLYFLLGLVYAPVTPILLPFIVMFFGFAYVVYRHQIINVYNQEY  514

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWPAVHGR+I ALV +Q+  +GLLSTK A++S PFLIALPVLTI FH+FC GRY+
Sbjct  515  ESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLTIWFHVFCNGRYK  574

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk----egdddeddemsekle  386
             AF KYPLQEA MKD+LERA  P  N K+YL+ AYVHPVFK    + D ++    +++ +
Sbjct  575  SAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDDYEQYLSENQEAD  634

Query  385  mEGILVPTKRQSRRNTPAPSKVSGGSSP  302
             E +LVPT+RQS+RN+PA   VS  +SP
Sbjct  635  AENVLVPTRRQSQRNSPA---VSRAASP  659



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLY LLGLVYA +TP+L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  559  AMDPGSIGFNTGEPRIQLYILLGLVYATLTPVLLPFIIIFFGLAYVVFRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRI+ AL+ SQ+  LGLL+TK AA S PFL+ALPVLT +F+ +C+GR+E
Sbjct  619  ESAAAFWPDVHGRILSALLISQLVLLGLLTTKKAAQSTPFLLALPVLTFAFYKYCQGRFE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFKE DDD+D++     + E  
Sbjct  679  PAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKECDDDDDEDHYSFEKYENE  738

Query  376  --ILVPTKRQSRRNTPAPSKVSGGSS---PDVILEKEP  278
              + V TKRQSRRNTP PS+++  S+   PD + + +P
Sbjct  739  SCVTVATKRQSRRNTPVPSRMTDQSTPSLPDAVEDLQP  776



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   285 bits (730),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYA V+PIL+PFIIVFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSLGFNTGEPQIQLYFLLGLVYAAVSPILLPFIIVFFALAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LP+LTI FH+FCKGRYE
Sbjct  614  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQE   KDTL+R +EP  +LK +LQ+AY+HPVFK   D E D  SE  E+E  
Sbjct  674  PAFVRYPLQETVRKDTLDRTKEPNFDLKEFLQNAYIHPVFKGEVDSEIDAASEDGELEPS  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKRQSR NTP PSK SG S P
Sbjct  734  LVQTKRQSRFNTPLPSKRSGSSPP  757



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   285 bits (729),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+ FN GEP+IQLYFLLG+VYA VTP+L+PFI+VFFG A++V+RHQIINVYNQEY
Sbjct  556  AMNPGSLSFNVGEPRIQLYFLLGMVYATVTPVLLPFIVVFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ S ++ +GLLSTKH A +AP LI L VLTI F+ FCK RYE
Sbjct  616  ESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVLTIWFYRFCKARYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAR+   NLK YLQ+AY+HPVF + +D+E++E   KLE E +
Sbjct  676  PAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVF-KEEDEEEEEEVVKLENESV  734

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPTKRQSRRNTP PSK+SG SS
Sbjct  735  LVPTKRQSRRNTPVPSKMSGASS  757



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAVV+PIL+PFI+VFF  A++VYRHQ+INVYNQEY
Sbjct  557  AMDPGTIGFNTGEPQIQLYFLLGLVYAVVSPILLPFILVFFSLAYVVYRHQVINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VHGRII ALV SQ+  +GLLSTK AA S P LI LPVLTI FH+FC+GRYE
Sbjct  617  ESAGAFWPDVHGRIIAALVVSQLLLMGLLSTKQAAQSTPLLITLPVLTIWFHVFCRGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA +KDTLE+ REP LNLKA+L +AY HPVFK  +++ ++   E+   E  
Sbjct  677  PAFVKYPLQEAMIKDTLEKTREPNLNLKAFLGNAYAHPVFKAAENEREETGLEETRPERT  736

Query  373  --LVPTKRQSRRNTPAPSKVSGGSS  305
              LVPTKR SR NTP PSK SG  S
Sbjct  737  PELVPTKRGSRMNTPLPSKHSGSVS  761



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 170/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+ FN GEP+IQLYFLLG+VYA VTP+L+PFI+VFFG A++V+RHQIINVYNQEY
Sbjct  556  AMNPGSLSFNVGEPRIQLYFLLGMVYATVTPVLLPFILVFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ S ++ +GLLSTKH A +AP LI L V+TI F+ FCK RYE
Sbjct  616  ESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVVTIWFYRFCKARYE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERAR+   NLK YLQ+AY+HPVF + ++D+++E   KLE E +
Sbjct  676  PAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVF-KEEEDDEEEEVVKLENESV  734

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPTKRQSRRNTP PSK+SG SS
Sbjct  735  LVPTKRQSRRNTPVPSKMSGASS  757



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 170/209 (81%), Gaps = 2/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFII+FFG A++V+RHQ+INVYNQ+Y
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAAVTPTVLPFIIIFFGLAYVVFRHQMINVYNQQY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++ AL+ SQ+  +GLL+TK AA+S PFLI LP+LTI FH +CKGR+E
Sbjct  616  ESAAAFWPDVHVRVVIALIVSQLVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd--ddeddemseklemE  380
             AF KYPLQEA MKDTLE+A +P LN+K YLQ AYVHPVFK      DE+D +S K E E
Sbjct  676  SAFVKYPLQEAMMKDTLEKATDPNLNIKGYLQHAYVHPVFKASQDDVDEEDAISLKWETE  735

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDVI  293
               VPTKR SRRNTP PS++SG SSP ++
Sbjct  736  SATVPTKRHSRRNTPLPSRISGASSPSML  764



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEPQIQLYFLLGLVYAVVTPI +PFI+VFF  A++V+RHQIINVYNQEY
Sbjct  559  AMDPGSIGFNTGEPQIQLYFLLGLVYAVVTPIFLPFILVFFALAYVVFRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALVFSQ+  +GL+STK  A S P LIALPVLTI FH FCKGRYE
Sbjct  619  ESAAAFWPGVHGRIISALVFSQLVLMGLMSTKGNAQSTPILIALPVLTIWFHRFCKGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemse-----kl  389
            PAF +YPLQEA MKDTLER+REP LN+K+YL+ AY+HPVFK  D+D++DE        KL
Sbjct  679  PAFIRYPLQEAMMKDTLERSREPNLNVKSYLEYAYIHPVFKNEDEDDEDEYEGECNNGKL  738

Query  388  emEGILVPTKRQSRRNTPAPSKVSGG  311
                +LVPTKR SRR+T  PSK S  
Sbjct  739  LDGSVLVPTKRHSRRHTHDPSKFSDD  764



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F T EPQIQLYFLLGLVYA VTP L+PFI++FFG A++V+RHQIINVYNQEY
Sbjct  555  AMDPGSIEFATSEPQIQLYFLLGLVYATVTPFLLPFILIFFGLAYVVFRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII ALV SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  615  ESAAAFWPDVHGRIISALVISQLLLLGLLSTKKAADSTPFLIALPILTIWFHRFCKNRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYP+QEA MKDTLERAREP L+LKAYL +AYVHPVFK+G+D++     E+ E+E +
Sbjct  675  SAFVKYPIQEAMMKDTLERAREPNLDLKAYLSNAYVHPVFKDGEDEDSVATDEEKEVENV  734

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKR SRRNTP PSK  G SSP
Sbjct  735  LVPTKRASRRNTPVPSKF-GCSSP  757



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 165/204 (81%), Gaps = 2/204 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK A+ S P LI LP+LTI FH+FCKGR+E
Sbjct  614  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQE   KDTLER +EP  NLK +LQ+AY+HPVFK   D E D  SE  ++E  
Sbjct  674  PAFVRYPLQETVRKDTLERTKEPNFNLKEFLQNAYIHPVFKGEVDSEIDAASEDGDLEPS  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKRQSR NTP PSK   GSSP
Sbjct  734  LVQTKRQSRFNTPLPSK--RGSSP  755



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 171/208 (82%), Gaps = 7/208 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGS+GFNTGEP+IQLYFLLGLVYA VTPIL+PFI++FFGFA++VYRHQIINVYNQEY
Sbjct  558  AMDAGSLGFNTGEPRIQLYFLLGLVYAPVTPILLPFIVMFFGFAYVVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWPAVHGR+I ALV +Q+  +GLLSTK A++S PFLIALPVLTI FH+FC GRY+
Sbjct  618  ESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLTIWFHVFCNGRYK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk----egdddeddemsekle  386
             AF KYPLQEA MKD+LERA  P  N K+YL+ AYVHPVFK    + D ++    +++ +
Sbjct  678  SAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDDYEQYLSENQEAD  737

Query  385  mEGILVPTKRQSRRNTPAPSKVSGGSSP  302
             E +LVPT+RQS+RN+PA   VS  +SP
Sbjct  738  AENVLVPTRRQSQRNSPA---VSRAASP  762



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFI VFFG A+LV+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAAVTPAVLPFITVFFGLAYLVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RI+ AL+ SQI  +GLL+TK AA+S PFLI LP+LTI FH +CKGR+E
Sbjct  616  ESGAAFWPDVHFRIVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---ddeddemseklem  383
             AF K+PLQEA MKDTLERA EP LNLK YLQ+AYVHPVFK+     DDE+D +S  LE 
Sbjct  676  SAFVKFPLQEAMMKDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDDDEEDRLSIDLET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            E + V TKRQSRRNTP PSK +  SSP +
Sbjct  736  ESVTVRTKRQSRRNTPLPSKNNDASSPSL  764



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFI VFFG A+LV+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAAVTPAVLPFITVFFGLAYLVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RI+ AL+ SQI  +GLL+TK AA+S PFLI LP+LTI FH +CKGR+E
Sbjct  616  ESGAAFWPDVHFRIVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---ddeddemseklem  383
             AF K+PLQEA MKDTLERA EP LNLK YLQ+AYVHPVFK+     DDE+D +S  LE 
Sbjct  676  SAFVKFPLQEAMMKDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDDDEEDRLSIDLET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            E + V TKRQSRRNTP PSK +  SSP +
Sbjct  736  ESVTVRTKRQSRRNTPLPSKNNDASSPSL  764



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 167/206 (81%), Gaps = 4/206 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ FNTGEPQIQLYFLLGLVYAVVTPIL+PFIIVFFG A++V+RHQIINVYNQEY
Sbjct  554  AMDPGSLSFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH RII ALV SQ+  +GLLSTK AA S P LIALPVLTI FH FCKGRYE
Sbjct  614  ESAAAFWPDVHMRIIVALVVSQLLLMGLLSTKQAAQSTPLLIALPVLTIWFHFFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLER REP LNLK YL++AY HP+FK GDDD + + + ++EM   
Sbjct  674  PAFVRYPLQEAMMKDTLERVREPNLNLKGYLREAYFHPIFKAGDDDSEMDEANEVEMVQK  733

Query  373  --LVPTKRQSRRNTPAPSKVSGGSSP  302
              LVPTKR SRR+TP  S   G  +P
Sbjct  734  PELVPTKRHSRRHTPMSS--IGSDAP  757



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFIIVFFG A+LV+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAAVTPAVLPFIIVFFGLAYLVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RI+ AL+ SQI  +GLL+TK AA+S PFL+ LP+LTI FH +CKGR+E
Sbjct  616  ESGAAFWPDVHFRIVMALLVSQIVLMGLLTTKKAASSTPFLVVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd---ddeddemseklem  383
             AF K+PLQEA MKDTLER  EP LNLK YLQ+AYVHPVFK+     DDE+D +S  LE 
Sbjct  676  SAFVKFPLQEAMMKDTLERTTEPNLNLKGYLQNAYVHPVFKDSMDDDDDEEDILSMDLET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            E + V TKRQSRRNTP PSK +  SSP +
Sbjct  736  ESVTVRTKRQSRRNTPLPSKNNDASSPSL  764



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 5/213 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF+T EP+IQLY LLGLVY+ +TP+L+PFI+VFFG A+LV+RHQIINVYNQEY
Sbjct  559  AMDPGSIGFHTREPRIQLYILLGLVYSTMTPVLLPFIVVFFGLAYLVFRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGR++ AL+ SQ+  +GLLSTK A  S PFL+ LP++T++F+ +C GRYE
Sbjct  619  ESAAAFWPDVHGRVVSALILSQLVLMGLLSTKGAKISTPFLLPLPIMTVAFYKYCAGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEAKMKDTLE AREP LNLK YLQ AYVHPVFKE  +D+D+E     E   +
Sbjct  679  PAFVRYPLQEAKMKDTLEHAREPNLNLKGYLQSAYVHPVFKECAEDDDEEEKALYET--V  736

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILEK  284
            +V TKRQSRRNTP  SK++GGS+   PD   E 
Sbjct  737  IVATKRQSRRNTPVQSKMTGGSTSPLPDAAHED  769



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYAVVTP L+PFI++FFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILIFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +CK RYE
Sbjct  614  ESAAAFWPSVHGRIITALIISQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK  DDDE   M++++E + +
Sbjct  674  PAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEKFSMADEVEADQV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PS+ +G  SP +
Sbjct  734  LVATKRQSRRNTPVPSRHNGSESPSL  759



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A+ V+RHQIINVYNQEY
Sbjct  472  AMDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEY  531

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  532  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYE  591

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+   + E++  + +
Sbjct  592  PAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDSFSVDEEVVYDNV  651

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  652  LVPTKRQSRRNTPAHSRYNGSSSPSL  677



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 170/208 (82%), Gaps = 7/208 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAGS+GFNTGEP+IQLYFLLGLVYA VTPIL+PFI++FFGFA++VYRHQIINVYNQEY
Sbjct  558  AMDAGSLGFNTGEPRIQLYFLLGLVYAPVTPILLPFIVMFFGFAYVVYRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWPAVHGR+I ALV +Q+  +GLLSTK A+++ PFLIALPVLTI FH+FC GRY+
Sbjct  618  ESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSTTPFLIALPVLTIWFHVFCNGRYK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFk----egdddeddemsekle  386
             AF KYPLQEA MKD+LERA  P  N ++YL+ AYVHPVFK    + D ++    +++ +
Sbjct  678  SAFVKYPLQEAMMKDSLERASSPNFNFRSYLEKAYVHPVFKGDGNDDDYEQYLSENQEAD  737

Query  385  mEGILVPTKRQSRRNTPAPSKVSGGSSP  302
             E +LVPT+R SRRN+PA   VS  +SP
Sbjct  738  AENVLVPTRRHSRRNSPA---VSRAASP  762



>gb|EMS56194.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=612

 Score =   276 bits (705),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYAVVTP L+PFI+VF+  A++VYRHQIINVYNQEY
Sbjct  398  AMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFYVLAYVVYRHQIINVYNQEY  457

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +CK RYE
Sbjct  458  ESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYE  517

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK  DDDE   M ++ E + +
Sbjct  518  PAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEKFSMMDEAEADQV  577

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PS+ +G  +P +
Sbjct  578  LVATKRQSRRNTPVPSRHNGSEAPSL  603



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   278 bits (712),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A+ V+RHQIINVYNQEY
Sbjct  520  AMDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEY  579

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  580  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYE  639

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+   + E++  + +
Sbjct  640  PAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDSFSVDEEVVYDNV  699

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  700  LVPTKRQSRRNTPAHSRYNGSSSPSL  725



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A+ V+RHQIINVYNQEY
Sbjct  514  AMDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEY  573

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  574  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYE  633

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+   + E++  + +
Sbjct  634  PAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDSFSVDEEVVYDNV  693

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  694  LVPTKRQSRRNTPAHSRYNGSSSPSL  719



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYA+VTPIL+PF+IVFF  A++V+RHQIINVYNQEY
Sbjct  394  AMDPGTIGFNTGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEY  453

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LP+LTI FH FCKGRYE
Sbjct  454  ESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYE  513

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  D D+ D   E+ E E  
Sbjct  514  PAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGDKIDVAMEEWEEEPS  573

Query  373  LVPTKRQSRRNTP  335
            L+ TKR S+R+TP
Sbjct  574  LIATKRTSKRSTP  586



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   278 bits (712),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A+ V+RHQIINVYNQEY
Sbjct  533  AMDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEY  592

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  593  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYE  652

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+   + E++  + +
Sbjct  653  PAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDSFSVDEEVVYDNV  712

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  713  LVPTKRQSRRNTPAHSRYNGSSSPSL  738



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYA VTP L+PF+++FFGFA++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSSEPQIQLYFLLGLVYAAVTPFLLPFVLIFFGFAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ   LGLLSTK A  S P L+ LPV+T  FH +CK RYE
Sbjct  614  ESAAAFWPSVHGRIITALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK  +DDE   ++++ E E +
Sbjct  674  PTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEKFSIADEPETEQV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PSK +G  SP +
Sbjct  734  LVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFII+FFG A++V+RHQIINVYNQEY
Sbjct  556  AMNPGSIGFNTGEPRIQLYFLLGLVYAAVTPTVLPFIIIFFGLAYVVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH R+I AL+ SQI  +GLL+TK AA+S PFLI LP+LTI FH +CKGR+E
Sbjct  616  ESGAAFWPDVHFRVIIALLVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkeg---dddeddemseklem  383
             AF K+PLQEA MKDTLERA EP LN+K YLQ AYVHPVFK     D DE+D MS K E 
Sbjct  676  SAFVKFPLQEAMMKDTLERATEPNLNVKGYLQHAYVHPVFKASHDDDADEEDAMSLKWET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDVI  293
            E   V TKRQSRR+TP PS+ SG SSP ++
Sbjct  736  ESATVATKRQSRRSTPLPSRFSGASSPSML  765



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 166/207 (80%), Gaps = 1/207 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYAVVTP L+PFI+VFFGFA++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFFGFAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+V+GRII AL+ SQ   LGLLSTK A  S P L+ LPV+T  F+ +CK RYE
Sbjct  614  ESAAAFWPSVNGRIIVALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVTFYFYKYCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl-emEG  377
            PAF +YPLQEA  KDTLERAREP L+LKAYL +AYVHPVFK G DD++        E E 
Sbjct  674  PAFVEYPLQEAMRKDTLERAREPGLDLKAYLMNAYVHPVFKGGGDDDERFSMSDEPEAEQ  733

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            +LV TKRQSRRNTP PSK +G  SP +
Sbjct  734  VLVATKRQSRRNTPVPSKHNGSESPSL  760



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A+ V+RHQIINVYNQEY
Sbjct  554  AMDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  614  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLERA+EP L+LKAYL +AYVHPVFK+GD+D+   + E++  + +
Sbjct  674  PAFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFKDGDEDDSFSVDEEVVYDNV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSRRNTPA S+ +G SSP +
Sbjct  734  LVPTKRQSRRNTPAHSRYNGSSSPSL  759



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  554  AMDPGSIDFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYVVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWPAVHGRII AL+ SQ+  LGLLSTK AA S P LIALP+LTISFH FCK RYE
Sbjct  614  ESGAAFWPAVHGRIICALIISQLLLLGLLSTKQAAQSTPLLIALPILTISFHRFCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLE AREP L+LK+YL +AY+HPVFK+ +DD++  M E+ E +  
Sbjct  674  PAFVKYPLQEAMMKDTLEHAREPNLDLKSYLLNAYIHPVFKDEEDDDNFSMGEEREYDNT  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKRQSR+NTPA SK  G SSP
Sbjct  734  LVPTKRQSRKNTPAQSKYGGSSSP  757



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   276 bits (707),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAVVTPIL+PFIIVFF  A++VYRHQIINVY+QEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++ AL+ SQ+  +GLLSTK A+ S P LI LPVLTI FH FCKGRYE
Sbjct  615  ESAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERA+E  LNLK +LQ+AY+HPVFK  D+ + +  SE       
Sbjct  675  PAFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDSESESEWERSPA-  733

Query  373  LVPTKRQSRRNTPAPSKVSGGS  308
            LV TKR S+R TP PSK  GGS
Sbjct  734  LVATKRTSKRFTPMPSK-DGGS  754



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYAVVTPIL+PFIIVFF  A++VYRHQIINVY+QEY
Sbjct  575  AMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEY  634

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++ AL+ SQ+  +GLLSTK A+ S P LI LPVLTI FH FCKGRYE
Sbjct  635  ESAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRYE  694

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA MKDTLERA+E  LNLK +LQ+AY+HPVFK  D+ + +  SE       
Sbjct  695  PAFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDSESESEWERSPA-  753

Query  373  LVPTKRQSRRNTPAPSKVSGGS  308
            LV TKR S+R TP PSK  GGS
Sbjct  754  LVATKRTSKRFTPMPSK-DGGS  774



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYA+VTPIL+PF+IVFF  A++V+RHQIINVYNQEY
Sbjct  515  AMDPGTIGFNTGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEY  574

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LP+LTI FH FCKGRYE
Sbjct  575  ESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYE  634

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  D D+ D   E+ E E  
Sbjct  635  PAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGDKIDVAMEEWEEEPS  694

Query  373  LVPTKRQSRRNTP  335
            L+ TKR S+R+TP
Sbjct  695  LIATKRTSKRSTP  707



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGFNTGEP+IQLYFLLGLVYA VTP ++PFIIVFFG A+LV+RHQIINVYNQEY
Sbjct  556  AMDPGSIGFNTGEPRIQLYFLLGLVYAAVTPAVLPFIIVFFGLAYLVFRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII AL+ SQI  +GLL+TK AA+S PFLI LP+LTI FH +CKGR+E
Sbjct  616  ESGAAFWPDVHFRIILALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddems---eklem  383
             AF K+PLQEA MKDTLERA EP LNLK YLQ+AYVHP+FK+  ++E DE      + E 
Sbjct  676  SAFVKFPLQEAMMKDTLERAIEPNLNLKGYLQNAYVHPIFKDSMEEETDEEEILGMEFET  735

Query  382  EGILVPTKRQSRRNTPAPSKVSGGS  308
            E  +V TKRQSR+NTP PS  +  S
Sbjct  736  ESAIVRTKRQSRKNTPLPSTNNASS  760



>ref|XP_008363043.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Malus domestica]
Length=660

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G++GFNTGEPQIQLYFLLGLVYAVV+PIL+PFIIVFF  A++VYR QIINVYNQEY
Sbjct  447  AMDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRRQIINVYNQEY  506

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  +GLLSTK AA S P LI LPVLTI FH FCKGRY+
Sbjct  507  ESAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAXSTPLLITLPVLTIWFHRFCKGRYK  566

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF ++PLQEA MKDTLE  REP LNLK +LQ+AY+HPVFK  DD ++D  +++ E E  
Sbjct  567  PAFIRHPLQEAMMKDTLECTREPNLNLKXFLQNAYIHPVFKSEDDSKNDAPAQEFEKEPA  626

Query  373  LVPTKRQSRRNTPAPSKVS  317
            +V TK  SRRNTP P+ ++
Sbjct  627  VVLTKCSSRRNTPMPANIA  645



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYFLLGLVYA+VTPIL+PF+IVFF  A++V+RHQIINVYNQEY
Sbjct  554  AMDPGTIGFNTGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VH RII AL+ SQ+  +GLLSTK AA+S P LI LP+LTI FH FCKGRYE
Sbjct  614  ESAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA MKDTLERAREP LNLK +LQ+AY+HPVFK  D D+ D   E+ E E  
Sbjct  674  PAFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGDKIDVAMEEWEEEPS  733

Query  373  LVPTKRQSRRNTP  335
            L+ TKR S+R+TP
Sbjct  734  LIATKRTSKRSTP  746



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYAVVTP L+PFI+VF+  A++VYRHQIINVYNQEY
Sbjct  602  AMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFYVLAYVVYRHQIINVYNQEY  661

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +CK RYE
Sbjct  662  ESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYE  721

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK GDDDE   M ++ E + +
Sbjct  722  PAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGGDDDEKFSMMDEAEADQV  781

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PS+ +G  +P +
Sbjct  782  LVATKRQSRRNTPVPSRHNGSEAPSL  807



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 174/213 (82%), Gaps = 3/213 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFIIVFF  A+ V+RHQIINVYNQEY
Sbjct  554  AMDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIVFFVLAYAVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTK AA S PFLIALP+LTI FH FCK RYE
Sbjct  614  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLERA+EP L+LKAYL +AY+HPVFK+G++D+   + ++ E + +
Sbjct  674  PAFVKYPLQEAMMKDTLERAKEPNLDLKAYLINAYIHPVFKDGEEDDSFAVGDEREYDNV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILEK  284
            LVPTKRQSRR+TPA SK +G SS   PD I E+
Sbjct  734  LVPTKRQSRRSTPAHSKYNGSSSPSLPDAIQEQ  766



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F + EPQIQLYFLLGLVYAVVTP L+PFII+FFG A++V+RHQIINVYNQEY
Sbjct  554  AMDPGSVDFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYVVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTKHA+ S P LIALP+LTI FH FCK RYE
Sbjct  614  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKHASQSTPLLIALPILTIWFHRFCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  YPLQEA MKDT+E+AREP L+LKAYL +AY+HPVFK+G+DD++  + E+ E +  
Sbjct  674  PAFVIYPLQEAMMKDTVEQAREPNLDLKAYLLNAYIHPVFKDGEDDDNFSIGEEQEYDNT  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LVPTKRQSRRNTPA SK  G SSP
Sbjct  734  LVPTKRQSRRNTPAHSKCDGSSSP  757



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   273 bits (697),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I F + EP+IQLYFLLGLVYA VTP L+PFII+FFG AFLV+RHQIINVYNQEY
Sbjct  557  AMNPGQIDFYSSEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAFLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AA+WP VHGRII AL+ SQI  +GL+STK AA S PFLIALP+LT+ FH FCKGRYE
Sbjct  617  ESGAAYWPDVHGRIITALIISQILLMGLMSTKKAAQSTPFLIALPILTLGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkeg-dddeddemseklemEG  377
            PAF +YPLQEA +KDTLERAREP L+LK YLQ AY+HPVFK+  +D  DD + +  + + 
Sbjct  677  PAFIRYPLQEAMIKDTLERAREPNLDLKPYLQKAYIHPVFKDEGEDRFDDMLEKSEDDKC  736

Query  376  ILVPTKRQSRRNTPAPSK  323
            ++VPTKRQSRR TPA S 
Sbjct  737  LIVPTKRQSRRTTPAVSN  754



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 162/206 (79%), Gaps = 1/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYAVVTP L+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFFVLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +CK RYE
Sbjct  614  ESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQEA  KDTLERAREP  +LK YL  AY+HPVFK  DD++   M E    + +
Sbjct  674  PAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGEDDEKFSMMDEGEADQ-V  732

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PS+ +G  +P +
Sbjct  733  LVATKRQSRRNTPVPSRNNGSEAPSM  758



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score =   272 bits (695),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 5/209 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I F+  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRI  AL+ SQI  +GL+STK AA S PFLIALPVLT  FH FCKGRYE
Sbjct  617  ESAAAFWPDVHGRITSALIISQILLMGLMSTKGAAQSTPFLIALPVLTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemse-----kl  389
            PAF ++PLQEA +KDTLERAREP+ NLK YLQ AY+HPVFK+ D ++             
Sbjct  677  PAFLRHPLQEAMIKDTLERAREPSFNLKPYLQKAYIHPVFKDDDYEDSRSEISGYCFEDS  736

Query  388  emEGILVPTKRQSRRNTPAPSKVSGGSSP  302
            + E + VPTKRQSR+ TPA S  S GSSP
Sbjct  737  DEECVTVPTKRQSRKTTPAVSHASRGSSP  765



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYAVVTP L+PFI++FFG A++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILIFFGLAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  F+ +CK RYE
Sbjct  614  ESAAAFWPSVHGRIIVALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFYKYCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQ+A  KDTLERAREP  +LK YL +AY+HPVFK  +DDE   +S++ E E +
Sbjct  674  PAFVEYPLQDAMRKDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEKFSISDEPEAEQV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PSK +G  SP +
Sbjct  734  LVATKRQSRRNTPVPSKYNGSESPSL  759



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+GFNTGEPQIQLYFLLGLVYAVV+PIL+PFI++FFG A++VYRHQI+NVYNQEY
Sbjct  563  AMNPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIVIFFGLAYIVYRHQIMNVYNQEY  622

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQ+  LGLLSTK A+ S PFLI LPVLTI F  +CKGRYE
Sbjct  623  ESAAAFWPDVHGRIIIALIVSQLLLLGLLSTKDASQSTPFLITLPVLTICFDRYCKGRYE  682

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPLQ+A MKD L R REP +NLK YL+ AY+HPVFK GDD E++ +SE  E E  
Sbjct  683  PAFVRYPLQQAMMKDILNRTREPNVNLKDYLRSAYIHPVFKAGDDYENNLVSEDEEQEPT  742

Query  373  LVPTKRQSRRNTP  335
            LVPTKRQSRR+TP
Sbjct  743  LVPTKRQSRRSTP  755



>ref|XP_006843810.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Amborella 
trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GFN+ EPQIQLYFLLGLVYAVVTP+L+PFI+VFFGFA++V+RHQ+INVYNQEY
Sbjct  554  AMDPGSLGFNSSEPQIQLYFLLGLVYAVVTPVLLPFIVVFFGFAYVVFRHQVINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII ALV SQ+  LGLLSTK AA S P L+ALPVLTI FH FCK R+E
Sbjct  614  ESGAAFWPDVHGRIITALVISQLLLLGLLSTKLAAQSTPLLLALPVLTIWFHRFCKDRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PL+EA +KDTLERA +P LNLK YL +AY+HPVFK G++ +   +++  + E  
Sbjct  674  SAFVKFPLEEAMIKDTLERATDPNLNLKGYLSNAYIHPVFKGGEESDSVSLADIEQDEA-  732

Query  373  LVPTKRQSRRNTPAPSK  323
            LVPTKRQSR NTP PSK
Sbjct  733  LVPTKRQSRMNTPQPSK  749



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 175/206 (85%), Gaps = 1/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GF+TGEP+IQLYFLLGLVYA VTP+L+PFI++FF FAF V+RHQIINVYNQEY
Sbjct  589  AMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIVIFFAFAFAVFRHQIINVYNQEY  648

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII  LV SQ++ +GLLSTK AA S PFLIALPVLTI FH FC GR++
Sbjct  649  ESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLTIWFHRFCNGRHK  708

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF KYPLQEA MKDTLERAR+P  NLKA L  AYVHP+F +GDDD++D++S ++E E +
Sbjct  709  SAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIF-KGDDDDEDDLSVEMETESV  767

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQS+RNTP PSK+SGG SP +
Sbjct  768  LVPTKRQSQRNTPVPSKISGGYSPSL  793



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYA VTP L+PF+++FFGFA++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSSEPQIQLYFLLGLVYAAVTPFLLPFVLIFFGFAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +C  RY+
Sbjct  614  ESAAAFWPSVHGRIITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCNNRYK  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK   DD+   ++++ E E +
Sbjct  674  PTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDGDDDKFSVADEPEAEQV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PSK +G  SP +
Sbjct  734  LVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   267 bits (682),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 162/206 (79%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYA VTP L+PF+++FFGFA++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSSEPQIQLYFLLGLVYAAVTPFLLPFVLIFFGFAYVVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +C  RY+
Sbjct  614  ESAAAFWPSVHGRIITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCNNRYK  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK   DD+   + ++ E E +
Sbjct  674  PTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKGDGDDDKFSVVDQPEAEQV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PSK +G  SP +
Sbjct  734  LVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_009113086.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=779

 Score =   267 bits (682),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRII AL+ SQI  +GL+STK  A S PFL+ LP+LTI FH FCKGRYE
Sbjct  617  ESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
             AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D+      + +  
Sbjct  677  SAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDEYEELIEDSDDE  736

Query  376  --ILVPTKRQSRRNTPAPSKVSGGSS  305
              ++VPTKRQSRR T   S  +GGSS
Sbjct  737  NCVVVPTKRQSRRTTATSSNPNGGSS  762



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   266 bits (680),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 168/213 (79%), Gaps = 3/213 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F+  EP+IQLYFLLGLVYAVVTP+L+PFI+VFFG A++VYRHQIINVYNQ+Y
Sbjct  554  AMDPGSICFDWCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP+VHGRII AL+ SQ+  +GLLSTK    + P L+ LPVLT  F+ +CK R+E
Sbjct  614  ESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA  KDTLERAREPT +LKAYL +AY+HPVFK  +++++  +SE + ME +
Sbjct  674  PAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEEDNMSISEDVGMEEV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVILEK  284
            +VPTKRQSRRNTPA SK  G  +   P+ + E+
Sbjct  734  IVPTKRQSRRNTPAQSKYEGSDTLSLPETVHER  766



>emb|CDY12941.1| BnaA09g13330D [Brassica napus]
Length=779

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA++++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYIIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRII AL+ SQI  +GL+STK  A S PFL+ LP+LTI FH FCKGRYE
Sbjct  617  ESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
             AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D+      + +  
Sbjct  677  SAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDEYEELIEDSDDE  736

Query  376  --ILVPTKRQSRRNTPAPSKVSGGSS  305
              ++VPTKRQSRR T   S  +GGSS
Sbjct  737  NCVVVPTKRQSRRTTATSSNPNGGSS  762



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   272 bits (695),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GF+TGEP+IQLYFLLGLVYA VTP+L+PFII+FF FA+LV+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYLVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII  LV SQ++ +GLL TK AA S PFLI+LPVLTI FH+FC GR++
Sbjct  618  ESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLTIWFHMFCNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF KYPLQEA MKDTLERAR+P  NLK+YL  AYVHP+F
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIF  717



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   266 bits (680),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 167/211 (79%), Gaps = 3/211 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F+  EP+IQLYFLLGLVYAVVTP+L+PFI+VFFG A++VYRHQIINVYNQ+Y
Sbjct  554  AMDPGSICFDWCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP+VHGRII AL+ SQ+  +GLLSTK    + P L+ LPVLT  F+ +CK R+E
Sbjct  614  ESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA  KDTLERAREPT +LKAYL +AY+HPVFK  +++++  +SE + ME +
Sbjct  674  PAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEEDNMSISEDVGMEEV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PDVIL  290
            +VPTKRQSRRNTPA SK  G  +   P+ +L
Sbjct  734  IVPTKRQSRRNTPAQSKYEGSDTLSLPETLL  764


 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = -1

Query  658  LGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTL  479
            +GLLSTK    + P L+ LPVLT  F+ +CK R+EPAF + PLQEA  KDTLERAREPT 
Sbjct  766  IGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTF  825

Query  478  NLKAYLQDAYVHPVFkegdddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSS--  305
            +LKAYL +AY+HPVFK  +++++  +SE + ME ++VPTKRQSRRNTPA SK  G  +  
Sbjct  826  DLKAYLANAYLHPVFKGREEEDNMSISEDVGMEEVIVPTKRQSRRNTPAQSKYEGSDTLS  885

Query  304  -PDVILEK  284
             P+ + E+
Sbjct  886  LPETVHER  893



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I F+  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VHGRII AL+ SQ+  LGL+STK AA S PFLIALPVLT  FH FCKGRYE
Sbjct  617  ESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemse-----kl  389
            PAF ++PLQEA +KDTLE+AREP  NLK YL+ AY+HPVFK+ + ++             
Sbjct  677  PAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFKDDEYEDVRSEVSGYYLGDT  736

Query  388  emEGILVPTKRQSRRNTPAPSKVSGGS  308
            + E + VPTKRQSR  TPA S  SGGS
Sbjct  737  DEECVTVPTKRQSRITTPAASHASGGS  763



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I F+  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VHGRII AL+ SQ+  LGL+STK AA S PFLIALPVLT  FH FCKGRYE
Sbjct  617  ESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemse-----kl  389
            PAF ++PLQEA +KDTLE+AREP  NLK YL+ AY+HPVFK+ + ++             
Sbjct  677  PAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFKDDEYEDVRSEVSGYYLGDT  736

Query  388  emEGILVPTKRQSRRNTPAPSKVSGGS  308
            + E + VPTKRQSR  TPA S  SGGS
Sbjct  737  DEECVTVPTKRQSRITTPAASHASGGS  763



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score =   263 bits (673),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH RI+ AL+ SQ+  +GLLSTKHA+ S P L  LPVLTI FH FCKGRYE
Sbjct  615  ESAGAFWPDVHRRIVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIGFHRFCKGRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F +YPLQ+A +KDTLER +EP LNLK +LQ+AYVHPVFK  D+ +D+ + E+   +  
Sbjct  675  PVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEMVVEEPRADQT  734

Query  373  --LVPTKRQSRRNTPAPS  326
              LV TKR S+R+T   S
Sbjct  735  PDLVATKRSSKRHTSGSS  752



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   263 bits (673),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I F+  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VHGRII AL+ SQ+  LGL+STK AA S PFL+ALPVLT  FH FCKGRYE
Sbjct  617  ESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLVALPVLTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemse-----kl  389
            PAF ++PLQEA +KDTLE+AREP  NLK YL+ AY+HPVFK+ + ++             
Sbjct  677  PAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFKDDEYEDVRSEVSGYYLGDT  736

Query  388  emEGILVPTKRQSRRNTPAPSKVSGGS  308
            + E + VPTKRQSR  TPA S  SGGS
Sbjct  737  DDECVTVPTKRQSRITTPAASHASGGS  763



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L  LPVLTI FH FCKGRYE
Sbjct  615  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIGFHRFCKGRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F +YPLQ+A +KDTLER +EP LNLK +LQ+AYVHPVFK  D+ +D+ + E+   +  
Sbjct  675  PVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEMVVEEPRADQT  734

Query  373  --LVPTKRQSRRNTPAPS  326
              LV TKR S+R+T   S
Sbjct  735  PDLVATKRSSKRHTSGSS  752



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 158/209 (76%), Gaps = 6/209 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFIIVFF  A+LV+RHQIINVYNQEY
Sbjct  567  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVYNQEY  626

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VHGRII AL+ SQ+  +GLLSTK AA S PFL+ LP+LT  FH FCKGRYE
Sbjct  627  ESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCKGRYE  686

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd------ddeddemsek  392
            PAF ++PL+EA +KDTLE+AREP  NLK YLQ AY+HPVFK+        DD      E 
Sbjct  687  PAFLRHPLKEAMVKDTLEKAREPNFNLKPYLQKAYIHPVFKDDHYEDSRFDDMSSYCGED  746

Query  391  lemEGILVPTKRQSRRNTPAPSKVSGGSS  305
             + E + VPTKRQSR NTPA S VS GSS
Sbjct  747  SDDECVTVPTKRQSRLNTPAASHVSRGSS  775



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L  LPVLTI FH FCKGRYE
Sbjct  615  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIGFHRFCKGRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F +YPLQ+A +KDTLER +EP LNLK +LQ+AYVHPVFK  D+ +D+ + E+   +  
Sbjct  675  PVFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEMVVEEPRADQT  734

Query  373  --LVPTKRQSRRNTPAPS  326
              LV TKR S+R+T   S
Sbjct  735  PDLVATKRSSKRHTSGSS  752



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 160/209 (77%), Gaps = 6/209 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VHGRII AL+ SQ+  +GL+STK AA S PFL+ LP+LT  FH FCKGRYE
Sbjct  617  ESGARFWPDVHGRIISALMISQVLLMGLMSTKGAAQSTPFLLVLPILTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd------ddeddemsek  392
            PAF ++PL+EA +KDTLE+AR+P  NLK YLQ AY+HPVF++        D+     +E 
Sbjct  677  PAFLRHPLKEAMVKDTLEKARDPYFNLKPYLQKAYIHPVFRDDHFEDSRFDEISSYRAED  736

Query  391  lemEGILVPTKRQSRRNTPAPSKVSGGSS  305
             + + + VPTKRQSR+NTPAPS  S GSS
Sbjct  737  SDEDCVTVPTKRQSRKNTPAPSHASRGSS  765



>ref|XP_006654880.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=770

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 163/208 (78%), Gaps = 3/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F++ EP+IQLYFLLGLVYAVVTP+L+PFI+VFFG A++VYRHQIINVYNQ+Y
Sbjct  554  AMDPGSICFDSCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP+VHGRII AL+ SQ+  +GLLSTK    S P L+ LPVLT  F+ +CK R+E
Sbjct  614  ESGAQFWPSVHGRIIVALIVSQLLLIGLLSTKGFEESTPVLLVLPVLTFWFYKYCKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQEA  KDT+ERAREPT +LKAYL +AY+HPVFK  +++E   +SE + ME +
Sbjct  674  PAFVRNPLQEAMRKDTVERAREPTFDLKAYLTNAYLHPVFKSNEEEEKMSISEDIGMEEV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSS---PD  299
            +VPTKRQSRR TP  SK  G  +   PD
Sbjct  734  IVPTKRQSRRTTPVQSKYEGSDTLSLPD  761



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSIGF++ EPQIQLYFLLGLVYA VTP L+PFI++FFGFA++VYRHQIINVYNQEY
Sbjct  554  AMDPGSIGFDSSEPQIQLYFLLGLVYAAVTPFLLPFILIFFGFAYIVYRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP+VHGRII AL+ SQ+  LGLLSTK A  S P L+ LPV+T  FH +CK RYE
Sbjct  614  ESAAAFWPSVHGRIITALIISQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F K PLQEA  KDTLERAREP  +LK YL +AY+HPVFK  DDDE   ++ + E E +
Sbjct  674  PTFVKCPLQEAMKKDTLERAREPGFDLKGYLMNAYIHPVFKVDDDDEKFSIAGEPEAEQV  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LV TKRQSRRNTP PSK +G  SP +
Sbjct  734  LVATKRQSRRNTPVPSKYNGSESPSL  759



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   261 bits (668),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG AF+VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAFVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ ALV SQ+  +GLLSTKHA+ S PFL+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALVVSQLLLMGLLSTKHASKSTPFLLVLPLLTIGFHMHCKNRYQ  676

Query  553  PAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG  377
            PAF  YPL QEA +KDTL+R REP  NLKA+L+DAY HP F+ G+D E +E  E      
Sbjct  677  PAFVTYPLQQEAMIKDTLDRIREPNFNLKAFLRDAYAHPEFRVGEDPEPEEKLESDMSPP  736

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSP  302
             LV TKR S RNTP PSK S    P
Sbjct  737  ELVATKRGSWRNTPLPSKQSCRDIP  761



>ref|XP_010450765.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=183

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  820  ILIPFIIVFFGFAFLVYRHQIINVYNQEYESAAAFWPAVHGRIIFALVFSQISTLGLLST  641
            +L+ +I+VFFG A++VYRHQIINVYNQEYESAAAFWP VHGR+I AL+ SQ+  + LL+T
Sbjct  1    MLLHYILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDVHGRVISALIISQLLLMDLLAT  60

Query  640  KHAATSAPFLIALPVLTISFHLFCKGRYEPAFTKYPLQEAKMKDTLERAREPTLNLKAYL  461
            K AA +APFLIALPV+TI FH F KGRYEPAF +YPL+EA MKDTLERAREP LNLK YL
Sbjct  61   KRAALAAPFLIALPVITIGFHRFSKGRYEPAFIRYPLEEAMMKDTLERAREPNLNLKGYL  120

Query  460  QDAYVHPVFkegdddeddemseklemEGILVPTKRQSRRNTPAPSKVSGGSSPDV  296
            QDAY+HPVFK GDDD+D ++  KLE E I+VPTKRQ RRNTPAPS+VSG SSP +
Sbjct  121  QDAYIHPVFKGGDDDDDSDVVGKLEDEVIIVPTKRQLRRNTPAPSRVSGESSPSL  175



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score =   264 bits (675),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+GF+TGEP+IQLYFLLGLVYA VTP+L+PFII+FF FA+LV+RHQIINVYNQEY
Sbjct  558  AMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYLVFRHQIINVYNQEY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII  LV SQ++ +GLL TK AA S PFLI+LPVLTI FH+FC GR++
Sbjct  618  ESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLTIWFHMFCNGRHK  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF KYPLQEA MKDTLERAR+P  NLK+YL  AYVHP+F
Sbjct  678  SAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIF  717



>ref|XP_011625695.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Amborella 
trichopoda]
Length=765

 Score =   258 bits (660),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+GF + EPQ+QLYFLLGLVYAVVTPIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  556  AMNPGSLGFASSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA+FWP VHGRI+ A+V SQ+  +GL+ST+ AA S   LI LP+LTI FHL CK R+E
Sbjct  616  ESAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQEA MKDTLERA EP LNLK YLQDAY+HPVF +G +          E    
Sbjct  676  SAFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVF-KGGNGHHQPKPGFEEETNP  734

Query  373  LVPTKRQSRRNTPAPSK  323
            LVPTKR S+ +TPA SK
Sbjct  735  LVPTKRHSQLSTPALSK  751



>ref|XP_006850790.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Amborella 
trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   258 bits (660),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+GF + EPQ+QLYFLLGLVYAVVTPIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  556  AMNPGSLGFASSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA+FWP VHGRI+ A+V SQ+  +GL+ST+ AA S   LI LP+LTI FHL CK R+E
Sbjct  616  ESAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQEA MKDTLERA EP LNLK YLQDAY+HPVF +G +          E    
Sbjct  676  SAFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVF-KGGNGHHQPKPGFEEETNP  734

Query  373  LVPTKRQSRRNTPAPSK  323
            LVPTKR S+ +TPA SK
Sbjct  735  LVPTKRHSQLSTPALSK  751



>ref|XP_010488177.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  480  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEY  539

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGRY+
Sbjct  540  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQ  599

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  600  PVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  639



>ref|XP_010466416.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  480  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEY  539

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGRY+
Sbjct  540  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQ  599

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  600  PVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  639



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   258 bits (659),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 150/197 (76%), Gaps = 2/197 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F+T EP+IQLYFLLGLVY+VVTPIL+PFII+FF FA++V+RHQIINVY+Q+Y
Sbjct  555  AMDPGSINFSTSEPRIQLYFLLGLVYSVVTPILLPFIIIFFAFAYVVFRHQIINVYDQKY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VH RII ALV SQ+  +GLLSTK AA S P LI LPVLTI FHLFCKGR+E
Sbjct  615  ESGAKFWPDVHRRIIVALVISQLLLMGLLSTKKAANSTPLLIVLPVLTIWFHLFCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLERA EP LNLKAYL DAY+HPVF       D   +   E    
Sbjct  675  SAFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYIHPVF--KCVQLDKPKAVDDEENNP  732

Query  373  LVPTKRQSRRNTPAPSK  323
            LV TKR SRR++   S 
Sbjct  733  LVATKRNSRRDSKTGSD  749



>emb|CDY19541.1| BnaC09g13620D [Brassica napus]
Length=779

 Score =   258 bits (659),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 153/195 (78%), Gaps = 3/195 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRII AL+ SQI  +GL+STK  A S PFL+ LP+LTI FH FCKGRYE
Sbjct  617  ESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
             AF   PLQE+ +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D       + +  
Sbjct  677  SAFVVNPLQESMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDQYEELNEDSDDE  736

Query  376  --ILVPTKRQSRRNT  338
              ++VPTKRQSRR T
Sbjct  737  NCVVVPTKRQSRRTT  751



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 154/202 (76%), Gaps = 6/202 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  559  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  618

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP VHGRII AL+ SQI  +GLLSTK AA S PFL+ LP+LT  FH FCKGRYE
Sbjct  619  ESAARFWPDVHGRIISALIISQILLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCKGRYE  678

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsek------  392
            PAF ++PL+EA +KDTLERAREP  NLK YLQ AY+HPVFK+ D ++             
Sbjct  679  PAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRFDEISGYCIED  738

Query  391  lemEGILVPTKRQSRRNTPAPS  326
             + E + VPTKRQSR NTPA S
Sbjct  739  SDDECVTVPTKRQSRINTPAVS  760



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 155/204 (76%), Gaps = 2/204 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A DAG+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFII+FF  A++VYRHQ+INVYNQ Y
Sbjct  558  ATDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTK A+ S PFL+ LPVLTI FH+ CK RY+
Sbjct  618  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQ  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +Y LQEA +KDTLER REP LNLKA+ ++AY HP F+ G+D E +   EK      
Sbjct  678  PAFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLELEMAVEKPNKTPE  737

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKR S RNTP PS  S  S P
Sbjct  738  LVATKRGSWRNTPLPS--SKHSCP  759



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 155/204 (76%), Gaps = 2/204 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A DAG+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFII+FF  A++VYRHQ+INVYNQ Y
Sbjct  557  ATDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTK A+ S PFL+ LPVLTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQ  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +Y LQEA +KDTLER REP LNLKA+ ++AY HP F+ G+D E +   EK      
Sbjct  677  PAFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLELEMAVEKPNKTPE  736

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKR S RNTP PS  S  S P
Sbjct  737  LVATKRGSWRNTPLPS--SKHSCP  758



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ ALV SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGRY+
Sbjct  615  ESAGAFWPDVHRRVVIALVVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  675  PVFVRYPLQDAMVKDTLERIREPNLNLKPFLQNAYAHPVF  714



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGRY+
Sbjct  615  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  675  PVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  714



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGRY+
Sbjct  615  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  675  PVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  714



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 157/204 (77%), Gaps = 8/204 (4%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA +FWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGRY+
Sbjct  615  ESAGSFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHRFCKGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F  YPLQ+A +KDTLER REP LNLK +LQ+AYVHPVFK  D+  ++ + E+ + +  
Sbjct  675  PVFVTYPLQDAMVKDTLERTREPNLNLKTFLQNAYVHPVFKAADNIGNEMVVEEPQPDRT  734

Query  373  --LVPTKRQSRRNTPAPSKVSGGS  308
              LV TKR SRR+      VS GS
Sbjct  735  PDLVATKRGSRRH------VSSGS  752



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   256 bits (653),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 154/204 (75%), Gaps = 6/204 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFIIVFF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VHGRII AL+ SQ+  +GLLSTK AA S PFL+ LP+LT  FH FCKGRYE
Sbjct  617  ESGARFWPDVHGRIISALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd------ddeddemsek  392
            PAF ++PL++A +KDTLE+AREP  NLK YLQ AY+HPVF++        DD      E 
Sbjct  677  PAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDSRFDDMSSYCVED  736

Query  391  lemEGILVPTKRQSRRNTPAPSKV  320
             + E + VPTKRQSR NTPA S V
Sbjct  737  SDDECVTVPTKRQSRLNTPAASHV  760



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG A++VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAYVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPMLTIGFHIHCKCRYQ  676

Query  553  PAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFke--gdddeddemseklem  383
            PAF  YPL QEA +KDTLER REP LNLKA+L+DAY HP F+     D+E      K +M
Sbjct  677  PAFVTYPLQQEAMIKDTLERTREPNLNLKAFLRDAYAHPEFRVGEDIDEEMGMTKAKSDM  736

Query  382  EGILVPTKRQSRRNTPAPSKVS  317
               LV T+R S RNTP PSK S
Sbjct  737  SPELVATRRGSWRNTPLPSKNS  758



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 154/204 (75%), Gaps = 6/204 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFIIVFF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VHGRII AL+ SQ+  +GLLSTK AA S PFL+ LP+LT  FH FCKGRYE
Sbjct  617  ESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegd------ddeddemsek  392
            PAF ++PL++A +KDTLE+AREP  NLK YLQ AY+HPVF++        DD      E 
Sbjct  677  PAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDSRFDDISSYCVED  736

Query  391  lemEGILVPTKRQSRRNTPAPSKV  320
             + E + VPTKRQSR NTPA S V
Sbjct  737  SDDECVTVPTKRQSRLNTPAASHV  760



>ref|XP_010510410.1| PREDICTED: CSC1-like protein At3g21620 [Camelina sativa]
Length=757

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFFG A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FCKGR++
Sbjct  615  ESAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRHQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVF
Sbjct  675  PVFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVF  714



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 156/208 (75%), Gaps = 5/208 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT  FH FCKGRYE
Sbjct  617  ESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddedd----emsekle  386
             AF   PLQEA +KDTLERAREP +NLK +LQ+AY+HPVFK+ + ++D        +  +
Sbjct  677  SAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQFDEGLTEDSDD  736

Query  385  mEGILVPTKRQS-RRNTPAPSKVSGGSS  305
             + ++VPTKR   RR T A S VSGG S
Sbjct  737  EDCVVVPTKRHRPRRKTVASSNVSGGLS  764



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 156/208 (75%), Gaps = 5/208 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT  FH FCKGRYE
Sbjct  617  ESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddedd----emsekle  386
             AF   PLQEA +KDTLERAREP +NLK +LQ+AY+HPVFK+ + ++D        +  +
Sbjct  677  SAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQFDEGLTEDSDD  736

Query  385  mEGILVPTKRQS-RRNTPAPSKVSGGSS  305
             + ++VPTKR   RR T A S VSGG S
Sbjct  737  EDCVVVPTKRHRPRRKTVASSNVSGGLS  764



>ref|XP_002885454.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61713.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 152/192 (79%), Gaps = 2/192 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQ+INVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQVINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FC+GRY+
Sbjct  615  ESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCQGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F +YPLQ+A +KDTLER REP LNLK +LQ+AY HPVFK  D+  ++ + E+   +  
Sbjct  675  PIFVRYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEMVVEEPHPDRT  734

Query  373  --LVPTKRQSRR  344
              LV TKR SRR
Sbjct  735  PDLVATKRGSRR  746



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FC+GRY+
Sbjct  615  ESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLTIGFHKFCQGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F  YPLQ+A +KDTLER REP LNLK +LQ+AY HPVFK  D+  ++ + E+   +  
Sbjct  675  PIFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEMVVEEPAPDKT  734

Query  373  --LVPTKRQSRR  344
              LV TKR SRR
Sbjct  735  PDLVATKRGSRR  746



>sp|F4HYR3.2|CSCL6_ARATH RecName: Full=CSC1-like protein At1g62320 [Arabidopsis thaliana]
 gb|AAF70851.1|AC003113_18 F24O1.4 [Arabidopsis thaliana]
Length=778

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+LV+RHQIINVYNQ+Y
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLVFRHQIINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA AFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT  FH FCKGRYE
Sbjct  617  ESAGAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
             AF   PLQEA +KDTLERAREP LNLK +LQ+AYVHPVFK+ +D +++ + E  + E  
Sbjct  677  SAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYVHPVFKDEEDSDEEGLIEDSDDEDC  736

Query  376  ILVPTKRQ-SRRNTPAPSKVSGGSS  305
            ++V TKRQ SRR T A S  S GSS
Sbjct  737  VVVQTKRQRSRRTTVASSNASRGSS  761



>ref|NP_188799.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9LVE4.1|CSCL4_ARATH RecName: Full=CSC1-like protein At3g21620 [Arabidopsis thaliana]
 dbj|BAB02357.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76531.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34617.1| hyperosmolality-gated Ca2+ permeable channel 1.5 [Arabidopsis 
thaliana]
Length=756

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G+IGFNTGEPQIQLYF+LGLVYA V+PIL+PFI+VFF  A++VYRHQIINVYNQEY
Sbjct  555  AMDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++ AL+ SQ+  +GLLSTK AA S P L  LPVLTI FH FC+GRY+
Sbjct  615  ESAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLTIGFHKFCQGRYQ  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            P F  YPLQ+A +KDTLER REP LNLK +LQ+AY HPVFK  D+  ++ + E+   +  
Sbjct  675  PIFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEMVVEEPAPDKT  734

Query  373  --LVPTKRQSRR  344
              LV TKR SRR
Sbjct  735  PDLVATKRGSRR  746



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 158/209 (76%), Gaps = 2/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F++ EP+IQLYFLLGLVYA VTP L+PFI+VFFGFA++V+RHQIINVYNQ+Y
Sbjct  554  AMDPGSICFDSTEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP+VHGRII AL+ SQ+  LGL+ST     + P L+ LPVLT  F+ +CK R+E
Sbjct  614  ESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFGFYKYCKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl--emE  380
            PAF + PLQEA  KDTLERAREP L+LKAYL ++Y+HPVFK  + D+   + +      E
Sbjct  674  PAFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRYSVMDDDGWMEE  733

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDVI  293
             ++VPTKR SRR TPA SK  G  S  V+
Sbjct  734  EVIVPTKRHSRRTTPAQSKHEGSDSLSVL  762



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EP+IQLYFLLGLVY+VV PIL+PFI+VFFG A+LV+RHQIINVY+Q+Y
Sbjct  554  AMDPGSIAFASSEPRIQLYFLLGLVYSVVAPILLPFIVVFFGLAYLVFRHQIINVYDQKY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R+I  ++ SQ+  +GLLSTK A  S P L+ LP+LTI FH  CK R+E
Sbjct  614  ESAAAFWPDVHWRLIIGMIISQLLLMGLLSTKDAELSTPLLVVLPILTIWFHRICKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLERA EP LNLK YLQDAY+HPVF   D+  +   +   +    
Sbjct  674  SAFVKFPLQDAMVKDTLERATEPNLNLKNYLQDAYIHPVF--KDNQIEVPTAIYEDENNP  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            LVPT+R S RNTP  SK S   S +
Sbjct  732  LVPTRRTSNRNTPGESKRSSEISSE  756



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 158/209 (76%), Gaps = 2/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F++ EP+IQLYFLLGLVYA VTP L+PFI+VFFGFA++V+RHQIINVYNQ+Y
Sbjct  554  AMDPGSICFDSTEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP+VHGRII AL+ SQ+  LGL+ST     + P L+ LPVLT  F+ +CK R+E
Sbjct  614  ESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFGFYKYCKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl--emE  380
            PAF + PLQEA  KDTLERAREP L+LKAYL ++Y+HPVFK  + D+   + +      E
Sbjct  674  PAFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRYSVMDDDGWMEE  733

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDVI  293
             ++VPTKR SRR TPA SK  G  S  V+
Sbjct  734  EVIVPTKRHSRRTTPAQSKHEGSDSLSVL  762



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score =   253 bits (646),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 6/202 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  557  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP VHGRII AL+ +QI  +GLLSTK AA S PFL+ LP++T  FH +CKGRYE
Sbjct  617  ESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIITFFFHRYCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddems------ek  392
            PAF ++PL+EA +KDTLERAREP  NLK YLQ AY+HPVFK+ D ++           E 
Sbjct  677  PAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRFDEISGYCIED  736

Query  391  lemEGILVPTKRQSRRNTPAPS  326
             + E + VPTKRQSR NTPA S
Sbjct  737  SDEECVTVPTKRQSRINTPAVS  758



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score =   253 bits (646),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 6/202 (3%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ G I ++  EP+IQLYFLLGLVYA VTP+L+PFII+FF  A+LV+RHQIINVYNQEY
Sbjct  569  AMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVYNQEY  628

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP VHGRII AL+ +QI  +GLLSTK AA S PFL+ LP++T  FH +CKGRYE
Sbjct  629  ESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIITFFFHRYCKGRYE  688

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddems------ek  392
            PAF ++PL+EA +KDTLERAREP  NLK YLQ AY+HPVFK+ D ++           E 
Sbjct  689  PAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRFDEISGYCIED  748

Query  391  lemEGILVPTKRQSRRNTPAPS  326
             + E + VPTKRQSR NTPA S
Sbjct  749  SDEECVTVPTKRQSRINTPAVS  770



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   252 bits (644),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F + EP+IQLYFLLGLVY+VVTPI +PFI+VFF  +++V+RHQIINVY+QEY
Sbjct  555  AMDPGSLDFASSEPRIQLYFLLGLVYSVVTPIFLPFIVVFFSLSYVVFRHQIINVYDQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH R+I A++ SQ++ +GL+STK    + P LIALP+LTI FH +CK R+E
Sbjct  615  ESGAAFWPDVHRRLIIAMIISQLTLMGLMSTKDPKHATPVLIALPILTIWFHKYCKSRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQEA +KDTLERA++P LNL++YLQDAYVHPVF     D +  ++   E    
Sbjct  675  PAFVKFPLQEAVVKDTLERAKDPNLNLRSYLQDAYVHPVF--HSKDIERLVAIDEEENNP  732

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKR S R+TP  SK    +  ++
Sbjct  733  LVPTKRNSNRSTPGGSKYGSEAGSEI  758



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 156/208 (75%), Gaps = 2/208 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F++ EP+IQLYFLLGLVYA VTP L+PFI+VFFGFA++V+RHQIINVYNQ+Y
Sbjct  554  AMDPGSICFDSTEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAA FWP+VHGRII AL+ SQ+  LGL+ST     S P L+ LPVLT  F+ +CK R+E
Sbjct  614  ESAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQSTPVLLVLPVLTFWFYKYCKNRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl--emE  380
            PAF + PLQEA  KDTLERAREP  +LKAYL ++Y+HPVFK  + D+   + +      E
Sbjct  674  PAFVRNPLQEAMKKDTLERAREPNFDLKAYLANSYLHPVFKGDEGDDRYSVVDDEGWMEE  733

Query  379  GILVPTKRQSRRNTPAPSKVSGGSSPDV  296
             ++VPTKR SRR TPA SK  G  S  V
Sbjct  734  EVIVPTKRHSRRTTPAQSKHEGSDSLSV  761



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 159/206 (77%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F   EPQIQLYFLLGLVYA VTP L+PFI+VFFG A++V+RHQIINVYNQEY
Sbjct  554  AMDPGSIEFAISEPQIQLYFLLGLVYAAVTPFLLPFILVFFGLAYVVFRHQIINVYNQEY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP V+ RII AL+ SQ+  LGLLSTKHAA S P LI LPVLTI FH FCK RYE
Sbjct  614  ESAAAFWPDVNRRIITALIISQLLLLGLLSTKHAAISTPLLIPLPVLTIWFHRFCKNRYE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTL+  REP L++KAYL +AY HPVF   + + +D++    E E I
Sbjct  674  PAFVKYPLQEAIMKDTLDHVREPNLDMKAYLLNAYTHPVF--KNGETEDKVPGDEEFENI  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR+ T  PSK    SSP +
Sbjct  732  LVPTKRQSRKGTSVPSKFGCSSSPSL  757



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 2/202 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F T EP+IQLYFLLGLVYAVVTPIL+PFIIVFF  A+LV+RHQIINVY Q+Y
Sbjct  555  AMDPGSLDFGTTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYTQQY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP V  R++ AL+ SQI  LGLLST+ A  S   LI LPVL+I FH FCKGR+E
Sbjct  615  ESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVTLIPLPVLSIWFHHFCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLERA +PTLNL+ YL+DAYVHPVF    +D  + ++   E +  
Sbjct  675  PAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVF--HKNDIYELVAIDEEEKNP  732

Query  373  LVPTKRQSRRNTPAPSKVSGGS  308
            LV TKRQSR NTP  SK +  S
Sbjct  733  LVATKRQSRMNTPVDSKFNSSS  754



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   251 bits (642),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 153/207 (74%), Gaps = 10/207 (5%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT  FH  CKGRYE
Sbjct  617  ESAAAFWPDVHGRIITALIISQILLLGLMSTKGKVQSTPFLLVLSILTFGFHRICKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
             AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + +EDD+     E    
Sbjct  677  SAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEYEEDDQFERLTEDSDD  736

Query  376  ---ILVPTKRQSRRNTPAPSKVSGGSS  305
               ++VPTKRQ       P + SGGSS
Sbjct  737  EDCVVVPTKRQK------PRRTSGGSS  757



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   250 bits (639),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 154/200 (77%), Gaps = 2/200 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G +GF T EP+IQLYFLLG VY+VVTP+L+PFIIVFF  A++V+RHQ+INVY+Q+Y
Sbjct  555  AMDPGCLGFATSEPRIQLYFLLGFVYSVVTPVLLPFIIVFFALAYMVFRHQVINVYDQKY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP V  R+I  +V SQ+  +GL+STK A +S P LI LP+LTI FHLFCKGR+E
Sbjct  615  ESGAAFWPDVQRRLIIGMVISQLLLMGLMSTKGAKSSTPLLIVLPILTIWFHLFCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLERA EP LNLKAYL DAYVHPVF+ G+ ++   + E+      
Sbjct  675  SAFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYVHPVFRGGELEKPAVIDEEENNP--  732

Query  373  LVPTKRQSRRNTPAPSKVSG  314
            LVPTKR SRR++   S VS 
Sbjct  733  LVPTKRMSRRSSKYGSDVSS  752



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   250 bits (638),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F T EP+IQLYFLLGLVYAVVTPIL+PFIIVFF  A+LV+RHQIINVYNQ+Y
Sbjct  555  AMDPGSLDFGTTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP V  R++ AL+ SQI  LGLLST+ A  S   L+ LPVL+I FH  CKGR+E
Sbjct  615  ESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLERA +PTLNL+ YL+DAYVHPVF    +D  +      E +  
Sbjct  675  PAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVF--QKNDIYEFAGIDEEEKNP  732

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            +V TKRQSR NTP  SK +  S  +
Sbjct  733  MVATKRQSRMNTPVDSKFNSSSGTN  757



>gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group]
 gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group]
Length=783

 Score =   250 bits (638),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F T EP+IQLYFLLGLVYAVVTPIL+PFIIVFF  A+LV+RHQIINVYNQ+Y
Sbjct  571  AMDPGSLDFGTTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQY  630

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP V  R++ AL+ SQI  LGLLST+ A  S   L+ LPVL+I FH  CKGR+E
Sbjct  631  ESGAQFWPDVQRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRFE  690

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLERA +PTLNL+ YL+DAYVHPVF    +D  +      E +  
Sbjct  691  PAFIKFPLQDAMVKDTLERANDPTLNLREYLKDAYVHPVF--QKNDIYEFAGIDEEEKNP  748

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            +V TKRQSR NTP  SK +  S  +
Sbjct  749  MVATKRQSRMNTPVDSKFNSSSGTN  773



>ref|NP_001154237.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE83603.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34618.1| hyperosmolality-gated Ca2+ permeable channel 1.6 [Arabidopsis 
thaliana]
Length=760

 Score =   249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 156/204 (76%), Gaps = 0/204 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG AF+VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAFVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ ALV SQ+  +GLLSTKHA+ S P L+ LP+LTI FH  CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALVVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHKHCKNRYQ  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF  YPLQEA +KDTL+R REP LNLKA+L+DAY HP F+ G+D E +E  E       
Sbjct  677  PAFVTYPLQEAMIKDTLDRIREPNLNLKAFLRDAYAHPEFRVGEDPEPEEKLESDMSPPD  736

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKR S RNTP PSK S    P
Sbjct  737  LVATKRWSWRNTPLPSKDSCREIP  760



>ref|XP_009404947.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=718

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EP+IQLYFLLGLVYAVVTP L+PFII+FF  AF+V+RHQIINVYNQEY
Sbjct  505  AMDPGSIDFASSEPKIQLYFLLGLVYAVVTPFLLPFIIIFFALAFVVFRHQIINVYNQEY  564

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII AL+ SQ+  LGLLSTKHA  S P L+ LPVLTI FH FCK RYE
Sbjct  565  ESGAAFWPDVHRRIITALIISQLLLLGLLSTKHAVNSTPLLLVLPVLTIWFHRFCKNRYE  624

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQEA MKDTLE AREP L+L+AYL + YVHPVFK+G+DD+      + E E +
Sbjct  625  PAFVKFPLQEAMMKDTLEHAREPNLDLRAYLLNTYVHPVFKDGEDDDSFSDDGEQECENV  684

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR+NTP PSK +G SSP +
Sbjct  685  LVPTKRQSRKNTPVPSKYNGSSSPSL  710



>ref|XP_009395092.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395094.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395095.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EPQIQLYFLLGLVYAVVTP L+PFII+FF  A+ V+RHQIINVYNQEY
Sbjct  555  AMDPGSIDFASSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFALAYAVFRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII AL+ SQ+  LGLLSTKHAA S P L+ LPVLTISFH FCK RYE
Sbjct  615  ESGAAFWPDVHGRIITALIISQLLLLGLLSTKHAANSTPLLLVLPVLTISFHRFCKNRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPLQEA MKDTLE A EP L+L+AYL +AYVHP+FK+ DDD+      + E E  
Sbjct  675  PAFVKYPLQEAMMKDTLEHATEPNLDLRAYLLNAYVHPLFKDEDDDDSFSGGGEQEYETK  734

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQS++NTP PSK +G SSP +
Sbjct  735  LVPTKRQSQKNTPVPSKYNGSSSPSL  760



>ref|XP_009404922.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404937.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=768

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 165/206 (80%), Gaps = 0/206 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F + EP+IQLYFLLGLVYAVVTP L+PFII+FF  AF+V+RHQIINVYNQEY
Sbjct  555  AMDPGSIDFASSEPKIQLYFLLGLVYAVVTPFLLPFIIIFFALAFVVFRHQIINVYNQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII AL+ SQ+  LGLLSTKHA  S P L+ LPVLTI FH FCK RYE
Sbjct  615  ESGAAFWPDVHRRIITALIISQLLLLGLLSTKHAVNSTPLLLVLPVLTIWFHRFCKNRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQEA MKDTLE AREP L+L+AYL + YVHPVFK+G+DD+      + E E +
Sbjct  675  PAFVKFPLQEAMMKDTLEHAREPNLDLRAYLLNTYVHPVFKDGEDDDSFSDDGEQECENV  734

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDV  296
            LVPTKRQSR+NTP PSK +G SSP +
Sbjct  735  LVPTKRQSRKNTPVPSKYNGSSSPSL  760



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   248 bits (632),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+ F T EP+IQLYFLLGLVYAVVTPIL+PFIIVFF  A+LV+RHQIINVYNQ+Y
Sbjct  555  AMNPGSLDFGTTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES   FWP V  RI+ AL+ SQI  LGLLST+ A  S   L+ LPVLTI FH  CKGR+E
Sbjct  615  ESGGLFWPDVQRRIVAALIVSQILLLGLLSTQEAEKSTVSLLPLPVLTIWFHYVCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PA+ K+PLQEA +KDTLERA +PTLNL+ YL+DAYVHPVF    +D  + ++   E +  
Sbjct  675  PAYIKFPLQEAMVKDTLERANDPTLNLRDYLKDAYVHPVF--QKNDLYELVAMDEEEKNP  732

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            LV T+RQSR NTP  SK +  S  +
Sbjct  733  LVATRRQSRMNTPVESKFNSSSGTN  757



>gb|EYU46618.1| hypothetical protein MIMGU_mgv1a001779mg [Erythranthe guttata]
Length=760

 Score =   247 bits (631),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMDAG I F + EP+IQLYFLLGLVY+VVTP+++PFIIVFF F+++V+RHQIINVY+Q+Y
Sbjct  555  AMDAGCINFPSSEPRIQLYFLLGLVYSVVTPLILPFIIVFFAFSYVVFRHQIINVYDQKY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWPAVH R+I  LV SQ   LGLLSTK  A + PFLIALPVLTI FH FCKGR+E
Sbjct  615  ESGAAFWPAVHRRVIIGLVISQFLLLGLLSTKRIAKATPFLIALPVLTIWFHRFCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF K+PLQ+  +KDTLERA EP LNLKAYLQD+Y+HPVF
Sbjct  675  SAFVKFPLQDTMVKDTLERATEPNLNLKAYLQDSYLHPVF  714



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 150/196 (77%), Gaps = 4/196 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQEY
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L +LT  FH FCKGRYE
Sbjct  617  ESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddedd---emseklem  383
             AF   PLQEA +KDTLERAREP LNLK +LQ+AY+HPVFK+ + ++D       +  + 
Sbjct  677  SAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEFEDDQFEGLTEDSDDE  736

Query  382  EGILVPTKRQS-RRNT  338
            + ++VPTKRQ  RR T
Sbjct  737  DCVVVPTKRQRPRRKT  752



>ref|XP_004960982.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 157/213 (74%), Gaps = 3/213 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F++ EP+IQLYFLLGLVYA VTP+L+PFI+VFFGFA++VYRHQIINVYNQ+Y
Sbjct  555  AMDPGSICFDSCEPRIQLYFLLGLVYAAVTPLLLPFILVFFGFAYVVYRHQIINVYNQQY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP+VHGRII AL+ SQ+  LGLLSTK    + P L+ LPVLT  F  +CK RYE
Sbjct  615  ESGAQFWPSVHGRIITALIVSQLLLLGLLSTKGLEEATPVLLVLPVLTFWFFKYCKHRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl---em  383
            PAF + PLQEA  KDTLERAREP  +LKAYL ++Y+HPVFK  D D+D   +        
Sbjct  675  PAFVRNPLQEAMRKDTLERAREPNFDLKAYLANSYLHPVFKGTDHDDDRYSTVDDDGWME  734

Query  382  EGILVPTKRQSRRNTPAPSKVSGGSSPDVILEK  284
            E +LVPTKR SRR TPA SK  G      + EK
Sbjct  735  EEVLVPTKRHSRRTTPAQSKYDGSDGLSSVPEK  767



>ref|XP_011079804.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
 ref|XP_011079805.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
Length=765

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 151/205 (74%), Gaps = 4/205 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F + EP+IQLYFLLGLVYAVVTP ++PFII+FF FA++V+RHQIINVY+Q Y
Sbjct  555  AMDPGCITFASSEPRIQLYFLLGLVYAVVTPFVLPFIIIFFAFAYVVFRHQIINVYDQNY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH R++  LV SQ+  +GLLSTK  A S P L+ LPVLTI FH FCKGR+E
Sbjct  615  ESAAAFWPDVHRRVVIGLVISQLLLMGLLSTKSIAKSTPVLLILPVLTIWFHRFCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLERA EP LNLKAYLQDAYVHPVF     + +   +   E    
Sbjct  675  SAFVKFPLQDAVVKDTLERATEPNLNLKAYLQDAYVHPVF--RTIEIEKAAAVDEEENNP  732

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            LV TKR SR +  A +  + G +P+
Sbjct  733  LVETKRNSRMSKSAST--ASGITPE  755



>ref|XP_010231849.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Brachypodium distachyon]
Length=703

 Score =   244 bits (623),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 150/209 (72%), Gaps = 1/209 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F   EP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQ Y
Sbjct  488  AMDPGSICFYWSEPRIQLYFLLGLVYACVTPLLLPFILVFFALAYVVYRHQIINVYNQRY  547

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP+VH RII AL+ SQ+  LGLLSTK    S P LI LP+LT  FH +CK RYE
Sbjct  548  ESGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILTFWFHRYCKNRYE  607

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl-emEG  377
            PAF + PLQEA  KDTLERAREP  +LKAYL DAY+HPVFK   D  D          E 
Sbjct  608  PAFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVDKFYVADDPGAEE  667

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDVIL  290
            ++V TKRQSRR TP  SK  G SS  ++L
Sbjct  668  VIVATKRQSRRTTPVQSKHDGSSSDRLLL  696



>ref|XP_006854105.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Amborella 
trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   245 bits (625),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI  +   P +QLYFLLGLVYAVVTPIL+PFI+VFFGFA+LVYRHQIINVYNQEY
Sbjct  557  AMDPGSIELSNSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII +L+ SQ   LGLLSTK AA S P LI LPVLTI FH +CK R+E
Sbjct  617  ESVAAFWPHVHGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            PAF KYPL+EA  +DT+ERA EP LNL AYL DAY+HP+F
Sbjct  677  PAFRKYPLEEAMARDTMERAEEPNLNLMAYLADAYLHPIF  716



>ref|XP_011626938.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Amborella 
trichopoda]
Length=760

 Score =   245 bits (625),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI  +   P +QLYFLLGLVYAVVTPIL+PFI+VFFGFA+LVYRHQIINVYNQEY
Sbjct  557  AMDPGSIELSNSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VHGRII +L+ SQ   LGLLSTK AA S P LI LPVLTI FH +CK R+E
Sbjct  617  ESVAAFWPHVHGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            PAF KYPL+EA  +DT+ERA EP LNL AYL DAY+HP+F
Sbjct  677  PAFRKYPLEEAMARDTMERAEEPNLNLMAYLADAYLHPIF  716



>ref|NP_193278.4| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q8VZM5.1|CSCL3_ARATH RecName: Full=CSC1-like protein At4g15430 [Arabidopsis thaliana]
 gb|AAL36364.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83602.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
Length=761

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 156/205 (76%), Gaps = 1/205 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG AF+VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAFVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ ALV SQ+  +GLLSTKHA+ S P L+ LP+LTI FH  CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALVVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHKHCKNRYQ  676

Query  553  PAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG  377
            PAF  YPL QEA +KDTL+R REP LNLKA+L+DAY HP F+ G+D E +E  E      
Sbjct  677  PAFVTYPLQQEAMIKDTLDRIREPNLNLKAFLRDAYAHPEFRVGEDPEPEEKLESDMSPP  736

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSP  302
             LV TKR S RNTP PSK S    P
Sbjct  737  DLVATKRWSWRNTPLPSKDSCREIP  761



>ref|XP_010440309.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=762

 Score =   245 bits (625),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 157/206 (76%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG A++VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYATVSPILLPFILVFFGLAYVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHIHCKCRYQ  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF  YPLQEA +KDTLER REP LNLK +L+DAY HP F+ G+  + +   EK   +  
Sbjct  677  PAFVTYPLQEAMIKDTLERTREPNLNLKEFLRDAYAHPEFRVGESSDQEMGLEKARSDKS  736

Query  376  -ILVPTKRQSRRNTPAPSKVSGGSSP  302
              LV TKR S RNT  PSK S  +SP
Sbjct  737  PDLVATKRGSWRNTSLPSKHSYTNSP  762



>ref|XP_003569103.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Brachypodium 
distachyon]
Length=768

 Score =   244 bits (624),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 150/209 (72%), Gaps = 1/209 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI F   EP+IQLYFLLGLVYA VTP+L+PFI+VFF  A++VYRHQIINVYNQ Y
Sbjct  553  AMDPGSICFYWSEPRIQLYFLLGLVYACVTPLLLPFILVFFALAYVVYRHQIINVYNQRY  612

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP+VH RII AL+ SQ+  LGLLSTK    S P LI LP+LT  FH +CK RYE
Sbjct  613  ESGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILTFWFHRYCKNRYE  672

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemsekl-emEG  377
            PAF + PLQEA  KDTLERAREP  +LKAYL DAY+HPVFK   D  D          E 
Sbjct  673  PAFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVDKFYVADDPGAEE  732

Query  376  ILVPTKRQSRRNTPAPSKVSGGSSPDVIL  290
            ++V TKRQSRR TP  SK  G SS  ++L
Sbjct  733  VIVATKRQSRRTTPVQSKHDGSSSDRLLL  761



>ref|XP_010434984.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   244 bits (623),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 158/206 (77%), Gaps = 2/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG A++VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYATVSPILLPFILVFFGLAYVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHIHCKCRYQ  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF  YPLQEA +KDTLER REP LNLK +L+DAY HP F+ G++ + +   EK   +  
Sbjct  677  PAFVTYPLQEAMIKDTLERTREPNLNLKEFLRDAYAHPEFRVGENYDQEMGLEKARSDKS  736

Query  376  -ILVPTKRQSRRNTPAPSKVSGGSSP  302
              LV TKR S RNT  PSK S  +SP
Sbjct  737  PDLVATKRGSWRNTSLPSKHSYTNSP  762



>dbj|BAJ96091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   244 bits (623),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F + EP+IQLYFLLGLVYAVV+PI++PFIIVFFG A+LV+RHQIINVYNQ+Y
Sbjct  556  AMDPGSLEFGSTEPRIQLYFLLGLVYAVVSPIILPFIIVFFGLAYLVFRHQIINVYNQQY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VHGRI+ ALV SQ+  +GLLST+ A  S   L+ LPVLTI F   CKGR+E
Sbjct  616  ESGAQFWPDVHGRIVTALVISQVLLIGLLSTQEAEQSTVALLPLPVLTIWFRYVCKGRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PA+ K+PLQEA +KDTL+RA +P LNL+ YL+DAYVHPVF+ GD  E   M E+      
Sbjct  676  PAYIKFPLQEAMVKDTLQRANDPMLNLREYLKDAYVHPVFRSGDVYELLAMDEEENPH--  733

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            LV TKR+SR  TP  SK +  S  +
Sbjct  734  LVATKRRSRMTTPVDSKFNSSSGTN  758



>emb|CDY22920.1| BnaA01g18580D [Brassica napus]
Length=756

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 152/204 (75%), Gaps = 8/204 (4%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A DAG+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFII+FF  A++VYRHQ+INVYNQ Y
Sbjct  558  ATDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTK A+ S PFL+ LPVLTI FH+ CK RY+
Sbjct  618  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQ  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF      EA +KDTLER REP LNLKA+ ++AY HP F+ G+D E +   EK +    
Sbjct  678  PAF------EAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLELEMAVEKPDKTPE  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKR S RNTP PS  S  S P
Sbjct  732  LVATKRGSWRNTPLPS--SKHSCP  753



>ref|XP_009147369.1| PREDICTED: CSC1-like protein At4g15430 isoform X3 [Brassica rapa]
Length=756

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 151/204 (74%), Gaps = 8/204 (4%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A DAG+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFII+FF  A++VYRHQ+INVYNQ Y
Sbjct  558  ATDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTK A+ S PFL+ LPVLTI FH+ CK RY+
Sbjct  618  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQ  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF      EA +KDTLER REP LNLKA+ ++AY HP F+ G+D E +   EK      
Sbjct  678  PAF------EAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLELEMAVEKPNKTPE  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKR S RNTP PS  S  S P
Sbjct  732  LVATKRGSWRNTPLPS--SKHSCP  753



>ref|XP_010449938.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG A++VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYATVSPILLPFILVFFGLAYVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHIHCKCRYQ  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
            PAF  YPLQEA +KDTLER REP LNL+A+L+DAY HP F+ G+  + +   EK   +  
Sbjct  677  PAFVTYPLQEAMIKDTLERTREPNLNLRAFLRDAYAHPEFRVGESSDQEMDLEKARSDKS  736

Query  376  -ILVPTKRQSRRNTPAPSKVSGGSS  305
              LV TKR S RNT  PSK S  +S
Sbjct  737  PDLVATKRGSWRNTSLPSKHSYTNS  761



>emb|CDY49293.1| BnaC01g22480D [Brassica napus]
Length=756

 Score =   242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 151/204 (74%), Gaps = 8/204 (4%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A DAG+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFII+FF  A++VYRHQ+INVYNQ Y
Sbjct  558  ATDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+   GLLSTK A+ S PFL+ LPVLTI FH+ CK RY+
Sbjct  618  ESAGKFWPDVHRRVVTALIVSQLLLTGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQ  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF      EA +KDTLER REP LNLKA+ ++AY HP F+ G+D E +   EK +    
Sbjct  678  PAF------EAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGEDLELEMAVEKPDKTPE  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSSP  302
            LV TKR S RNTP PS  S  S P
Sbjct  732  LVATKRGSWRNTPLPS--SKHSCP  753



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score =   242 bits (617),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 154/197 (78%), Gaps = 3/197 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D GS+ F+  EP+IQLYFLLGLVY+VVTPIL+PFIIVFF F+++V+RHQIINVY+Q+Y
Sbjct  555  ATDPGSLNFSVSEPRIQLYFLLGLVYSVVTPILLPFIIVFFAFSYMVFRHQIINVYDQKY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RI+  LV SQ+  LGLLSTK+ + S P +IALPVLTI FH+FCKGRYE
Sbjct  615  ESGAAFWPDVHRRILTGLVISQLLLLGLLSTKNISKSTPVMIALPVLTIWFHIFCKGRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLERA EPTLNLKAYL+ AYVHPVF     + D   +   E    
Sbjct  675  SAFVKFPLQDAMVKDTLERATEPTLNLKAYLKTAYVHPVF--KGVELDRPSAVDDEENNP  732

Query  373  LVPTKRQSRRNTPAPSK  323
            LVPTKR SRRN+ + S+
Sbjct  733  LVPTKR-SRRNSKSHSE  748



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score =   242 bits (617),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 156/206 (76%), Gaps = 5/206 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F   EP++QLYFLLGLVYAVVTP+L+PFIIVFF  A+LV+RHQIINVY+Q Y
Sbjct  555  AMDPGSLDFYNSEPRLQLYFLLGLVYAVVTPMLLPFIIVFFSLAYLVFRHQIINVYSQRY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+I FH  CKGR+E
Sbjct  615  ESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHHVCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLE AR+PTLNL+ YL+ AYVHPVF++ D  +   M E+ +    
Sbjct  675  PAFVKFPLQDAMVKDTLELARDPTLNLREYLKGAYVHPVFQKNDIYKVVAMDEEEKNP--  732

Query  373  LVPTKRQSRRNTPAPSKV---SGGSS  305
            +V TKRQSR NTP  SK+   SGG++
Sbjct  733  IVVTKRQSRMNTPGGSKLNSSSGGTN  758



>gb|EMS50375.1| Transmembrane protein 63B [Triticum urartu]
Length=749

 Score =   241 bits (616),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 153/209 (73%), Gaps = 2/209 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GSI     EP+IQLYFLLGLVYAVVTP+L+PFI+VFF  A++VYRHQIINVYNQ Y
Sbjct  538  AMDPGSICLYWSEPRIQLYFLLGLVYAVVTPLLLPFILVFFALAYVVYRHQIINVYNQRY  597

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VH RII AL+ SQ+  LGLLSTK    + P L+ALPVLTI FH +CK RYE
Sbjct  598  ESGAQFWPNVHLRIITALIVSQLLFLGLLSTKGLEEATPALLALPVLTIWFHKYCKHRYE  657

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF + PLQ+   KDTLERARE   +LKAYL DAY+HPVF + ++     +++    E +
Sbjct  658  PAFVRNPLQDVMRKDTLERARERNFDLKAYLADAYLHPVF-KSNEAGKFYVADDPGAEAV  716

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILE  287
            +VPTKRQSRR TP  S+  GGS    ++E
Sbjct  717  IVPTKRQSRRITPVQSE-DGGSGRLNLME  744



>ref|XP_010261636.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=780

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+G     P +QLYFLLG+VYAVVTPIL+PFI+VFFGFA+LVYRHQIINVYNQEY
Sbjct  556  AMDPGSVGLPETLPTLQLYFLLGIVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII +L+ S +  +GLLSTK AA S P L+ LP+LT+ FH +CK R+E
Sbjct  616  ESVAAFWPHVHSRIIASLLISHLLLMGLLSTKXAANSTPLLVVLPILTLWFHKYCKSRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            PAF KYPL+EA  KDT+ERA EP LNLKAYL DAY+HP+F
Sbjct  676  PAFRKYPLEEAMAKDTMERASEPNLNLKAYLADAYLHPIF  715



>dbj|BAK05559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 151/201 (75%), Gaps = 2/201 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F T EP+IQLYFLLGLVYAVVTPIL+PFIIVFF  A+LV+RHQIINVYNQ+Y
Sbjct  555  AMDPGSLDFGTTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP V  R+I AL+ SQI  LGLLST+ A  S   L+ LPVLTI FH  CK R+E
Sbjct  615  ESGALFWPDVQTRLIAALIVSQILLLGLLSTQEAEKSTVALLPLPVLTIWFHYVCKCRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PA+ K+PLQEA +KDTL+RA +PTL+L+ YL+DAYVHPVF++ D  E   M E+ +    
Sbjct  675  PAYVKFPLQEAMVKDTLQRANDPTLSLREYLKDAYVHPVFQKDDMYELVAMDEEEKNPT-  733

Query  373  LVPTKRQSRRNTPAPSKVSGG  311
             V TKRQSR NTP  SK +  
Sbjct  734  -VATKRQSRMNTPVESKFNSS  753



>ref|XP_010110412.1| Uncharacterized protein RSN1 [Morus notabilis]
 gb|EXC26244.1| Uncharacterized protein RSN1 [Morus notabilis]
Length=365

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+ F    P +QLYFLLGLVY VVTPIL+PF++VFF  A+LVYRHQIINVYNQ+Y
Sbjct  113  AMNPGSVDFPETIPSLQLYFLLGLVYMVVTPILLPFMVVFFALAYLVYRHQIINVYNQQY  172

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH RII +L  SQ+  +GLLSTK AA S P L+ LP+LTI+FH +CK R+E
Sbjct  173  ESAAAFWPHVHTRIIASLFISQLLLMGLLSTKKAANSTPLLVVLPILTIAFHKYCKHRFE  232

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            PAF KYPL+EA  KDT ERA EP LNLKAYL DAY+HP+F
Sbjct  233  PAFRKYPLEEAMAKDTAERAAEPDLNLKAYLADAYLHPIF  272



>ref|XP_008373502.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=805

 Score =   241 bits (615),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 153/211 (73%), Gaps = 3/211 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D GS+ F    P +QLYFLLG+VYAV+TPIL+PFI+VFF FA+LVYRHQIINVYNQ Y
Sbjct  556  ATDPGSVDFPETLPSLQLYFLLGIVYAVITPILLPFILVFFAFAYLVYRHQIINVYNQRY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH RI+ +L+ SQ+  +GLLSTK AA S P L+ LP+LT+SFH FCK R+E
Sbjct  616  ESAAAFWPQVHSRIVASLLISQLLLMGLLSTKKAANSTPLLVVLPILTLSFHKFCKYRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF KYPL EA  KDT+ER  EP LN+K+YL DAY+HP+F+  +++   E  ++L    +
Sbjct  676  PAFRKYPLXEAMAKDTMERTAEPDLNMKSYLADAYLHPIFRSFEEEPPFEEEQELVEVRV  735

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILEKE  281
                K+Q+R  TP  SK+S  S P  +   E
Sbjct  736  ---DKQQTRIATPITSKLSSHSPPHYVHHTE  763



>ref|XP_008451390.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
 ref|XP_008451391.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Cucumis melo]
Length=761

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G + F   EP+IQLY LLG VY+VVTPIL+PFIIVFF F++LVYRHQIINVYNQ+Y
Sbjct  554  AMDPGCLDFPVSEPRIQLYILLGFVYSVVTPILLPFIIVFFSFSYLVYRHQIINVYNQKY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH R+I  L+ +Q+  +GL S + A  S+ FL+ALP+LTI  H FCKGR+E
Sbjct  614  ESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSSLFLVALPILTIWVHKFCKGRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLE+A EP L+LKAYL+DAYVHPVF       +  +    E    
Sbjct  674  SAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHPVF--KSSSIEQTLLIDDEENNT  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPTKR S R +  PS+ +  + 
Sbjct  732  LVPTKRTSHRGSKLPSEDNSETD  754



>ref|XP_008451392.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Cucumis melo]
Length=759

 Score =   240 bits (612),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G + F   EP+IQLY LLG VY+VVTPIL+PFIIVFF F++LVYRHQIINVYNQ+Y
Sbjct  554  AMDPGCLDFPVSEPRIQLYILLGFVYSVVTPILLPFIIVFFSFSYLVYRHQIINVYNQKY  613

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH R+I  L+ +Q+  +GL S + A  S+ FL+ALP+LTI  H FCKGR+E
Sbjct  614  ESGAAFWPHVHRRVIIGLILAQLLLMGLFSMREAEKSSLFLVALPILTIWVHKFCKGRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
             AF K+PLQ+A +KDTLE+A EP L+LKAYL+DAYVHPVF       +  +    E    
Sbjct  674  SAFVKFPLQDAMVKDTLEKATEPNLDLKAYLKDAYVHPVF--KSSSIEQTLLIDDEENNT  731

Query  373  LVPTKRQSRRNTPAPSKVSGGSS  305
            LVPTKR S R +  PS+ +  + 
Sbjct  732  LVPTKRTSHRGSKLPSEDNSETD  754



>ref|XP_010434983.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score =   240 bits (612),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 158/207 (76%), Gaps = 3/207 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG A++VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYATVSPILLPFILVFFGLAYVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHIHCKCRYQ  676

Query  553  PAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG  377
            PAF  YPL QEA +KDTLER REP LNLK +L+DAY HP F+ G++ + +   EK   + 
Sbjct  677  PAFVTYPLQQEAMIKDTLERTREPNLNLKEFLRDAYAHPEFRVGENYDQEMGLEKARSDK  736

Query  376  --ILVPTKRQSRRNTPAPSKVSGGSSP  302
               LV TKR S RNT  PSK S  +SP
Sbjct  737  SPDLVATKRGSWRNTSLPSKHSYTNSP  763



>ref|XP_004962175.1| PREDICTED: uncharacterized protein RSN1-like [Setaria italica]
Length=767

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F   EP++QLYFLLGLVYAVVTP+L+PFIIVFF  A+LV+RHQIINVYNQ+Y
Sbjct  555  AMDPGSLDFYNYEPRLQLYFLLGLVYAVVTPMLLPFIIVFFSLAYLVFRHQIINVYNQQY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+I FH  CKGR+E
Sbjct  615  ESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLERA +PTLNL+ YL+ AYVHPVF++ D  +   + E+ +    
Sbjct  675  PAFVKFPLQDAMVKDTLERAHDPTLNLRDYLKGAYVHPVFQKNDIYQLVAIDEEEKNP--  732

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPD  299
            LV TKRQ R  TP  SK +  S  +
Sbjct  733  LVVTKRQPRMTTPGGSKFNSSSGTN  757



>ref|XP_006355875.1| PREDICTED: uncharacterized protein C354.08c-like [Solanum tuberosum]
Length=751

 Score =   239 bits (609),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D GS+ F+  EP+IQLYFLLGLVY+VVTPIL+PFIIVFF F+++V+RHQIINVY+Q+Y
Sbjct  555  ATDPGSLNFSVSEPRIQLYFLLGLVYSVVTPILLPFIIVFFAFSYMVFRHQIINVYDQKY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A+FWP VH RI+  LV SQ+  LGLLSTK+ + S P +IALPVLTI FH+FCKGRYE
Sbjct  615  ESGASFWPDVHRRILTGLVISQLLLLGLLSTKNISKSTPVMIALPVLTIWFHIFCKGRYE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF K+PLQ+A +KDTLERA EPTLNLKAYL+DAYVHPVF
Sbjct  675  SAFVKFPLQDAMVKDTLERATEPTLNLKAYLKDAYVHPVF  714



>ref|XP_010449936.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score =   239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 157/206 (76%), Gaps = 3/206 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            A D G+IGFNTGEPQIQLYFLLGLVYA V+PIL+PFI+VFFG A++VYRHQ+INVYNQ+Y
Sbjct  557  ATDPGTIGFNTGEPQIQLYFLLGLVYATVSPILLPFILVFFGLAYVVYRHQVINVYNQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESA  FWP VH R++ AL+ SQ+  +GLLSTKHA+ S P L+ LP+LTI FH+ CK RY+
Sbjct  617  ESAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHIHCKCRYQ  676

Query  553  PAFTKYPL-QEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG  377
            PAF  YPL QEA +KDTLER REP LNL+A+L+DAY HP F+ G+  + +   EK   + 
Sbjct  677  PAFVTYPLQQEAMIKDTLERTREPNLNLRAFLRDAYAHPEFRVGESSDQEMDLEKARSDK  736

Query  376  --ILVPTKRQSRRNTPAPSKVSGGSS  305
               LV TKR S RNT  PSK S  +S
Sbjct  737  SPDLVATKRGSWRNTSLPSKHSYTNS  762



>ref|XP_008238126.1| PREDICTED: uncharacterized protein RSN1 [Prunus mume]
Length=799

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 151/212 (71%), Gaps = 10/212 (5%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F    P +QLYFLLG+VYAVVTPIL+PFI+VFF  A+LVYRHQIINVYNQ Y
Sbjct  556  AMDPGSVDFPETLPSLQLYFLLGIVYAVVTPILLPFILVFFALAYLVYRHQIINVYNQHY  615

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VH RII +LV SQ+  +GLLSTK AA S PFL+ LP+LT+SFH +CK R+E
Sbjct  616  ESAAAFWPQVHSRIIASLVISQLLLMGLLSTKKAANSTPFLVVLPILTLSFHKYCKYRFE  675

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF +YPL+EA  KDT+ER  EP LNLK+YL DAY+HP+F+  ++ E  E+         
Sbjct  676  PAFREYPLEEAMAKDTMERTAEPDLNLKSYLADAYLHPIFRSFEEQELVEVRI-------  728

Query  373  LVPTKRQSRRNTPAPSKVSGGSSPDVILEKEP  278
                K Q+   TP  S++S  S P  + +  P
Sbjct  729  ---DKHQTHAATPITSELSSPSPPHYVHQTPP  757



>ref|XP_002886475.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62734.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+LV+RHQIINVY+Q+Y
Sbjct  557  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLVFRHQIINVYDQKY  616

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP VHGRII AL+ SQI  LGL+STK    S PFL+ L ++T  FH FCKGRYE
Sbjct  617  ESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAIVTFGFHRFCKGRYE  676

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF   PLQEA +KDTLERA+EP LNLK +LQ+AY+HPVF
Sbjct  677  SAFVINPLQEAMIKDTLERAKEPNLNLKGFLQNAYIHPVF  716



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G + F+  EP+IQLYFLLGLVYA VTPIL+PFII+FF FA++V+RHQIINVY+Q+Y
Sbjct  555  AMDPGCLNFSISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP+VH R+I  L+ SQ+  +GLL+TK  + S PFLI LPVLT  FH FC GR+E
Sbjct  615  ESGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF ++PLQEA +KDTLERA EP LNLK YLQDAY+HPVF
Sbjct  675  SAFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVF  714



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G + F+  EP+IQLYFLLGLVYA VTPIL+PFII+FF FA++V+RHQIINVY+Q+Y
Sbjct  565  AMDPGCLNFSISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKY  624

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP+VH R+I  L+ SQ+  +GLL+TK  + S PFLI LPVLT  FH FC GR+E
Sbjct  625  ESGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRFE  684

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
             AF ++PLQEA +KDTLERA EP LNLK YLQDAY+HPVF
Sbjct  685  SAFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVF  724



>emb|CDY32032.1| BnaA03g60360D [Brassica napus]
Length=796

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQ+Y
Sbjct  558  AMDPGQIDFYVNEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQKY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRII AL+ SQ+  +GL+STK  A S PFL+ LP+LT  FH FCK RYE
Sbjct  618  ESAAAYWPDVHGRIISALIISQLLLIGLMSTKGKAQSTPFLVVLPILTFCFHRFCKDRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
              F   PLQEA +KD++ERAREP LNLK +L++AY+HPVFK+ + ++D       + +  
Sbjct  678  SVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDDLHEELIEDSDDE  737

Query  376  --ILVPTKRQSR  347
              ++VPTK QS+
Sbjct  738  NCVVVPTKHQSQ  749



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 149/197 (76%), Gaps = 4/197 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F + EP+IQLYFLLG VY V+TPI +PF+++FFG +++V+RHQIINVY QEY
Sbjct  555  AMDPGSLEFASSEPRIQLYFLLGFVYYVITPIFLPFLLIFFGLSYVVFRHQIINVYTQEY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAAFWP V  R+I A++ SQ+  +GL+STKH + + P L+ LP+LTI FH++CK R+E
Sbjct  615  ESAAAFWPDVIRRVIIAMIISQLLLMGLMSTKHGSLTVPILV-LPLLTIWFHIYCKSRFE  673

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLERA EP LNL+AYLQDAYVHP F     ++ +      E    
Sbjct  674  PAFIKFPLQDAMVKDTLERATEPHLNLRAYLQDAYVHPDF---HSEDVEHPMIIEEENNT  730

Query  373  LVPTKRQSRRNTPAPSK  323
            LVPT R SRR+TP  SK
Sbjct  731  LVPTIRTSRRSTPGESK  747



>ref|XP_009123383.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=762

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQIINVYNQ+Y
Sbjct  558  AMDPGQIDFYVNEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVYNQKY  617

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRI+ AL+ SQ+  +GL+STK  A S PFL+ LP+LT  FH FCK RYE
Sbjct  618  ESAAAYWPDVHGRIVSALIISQLLLIGLMSTKGKAQSTPFLVVLPILTFCFHRFCKDRYE  677

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
              F   PLQEA +KD++ERAREP LNLK +L++AY+HPVFK+ + ++D       + +  
Sbjct  678  SVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDDLHEELIEDSDDE  737

Query  376  --ILVPTKRQSR  347
              ++VPTK QS+
Sbjct  738  NCVVVPTKHQSQ  749



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score =   238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 150/205 (73%), Gaps = 10/205 (5%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD G I F   EP+IQLYFLLGLVYA VTP+L+PFII FFGFA+L++RHQ       EY
Sbjct  555  AMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQ-------EY  607

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ESAAA+WP VHGRII AL+ SQI  +GL+S+K  A S PFL+ LP+LTI FH FCKGRYE
Sbjct  608  ESAAAYWPDVHGRIISALIISQILLIGLMSSKGKAQSTPFLVVLPILTIGFHRFCKGRYE  667

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEG-  377
             AF   PLQEA +KDTLERA+EP LNLK +LQ+AY+HPVFK+ + ++D       + +  
Sbjct  668  SAFVINPLQEAMIKDTLERAKEPNLNLKVFLQNAYIHPVFKDEEYEDDRFEESTEDSDNE  727

Query  376  --ILVPTKRQSRRNTPAPSKVSGGS  308
              ++V TKR+SRR T A +   GGS
Sbjct  728  NCVVVQTKRRSRRTTEASNNAIGGS  752



>ref|XP_010664612.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Vitis vinifera]
Length=624

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AM+ GS+ F    P +QLYFLLG+VYAVVTPIL+PFI+VFF FA+ +YRHQ+INVYNQ+Y
Sbjct  408  AMNPGSVDFPETIPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYFIYRHQVINVYNQQY  467

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES AAFWP VH RII +L+ SQ+  +GLLSTK AA S P LIALP+LT++FH +CK R+E
Sbjct  468  ESGAAFWPHVHSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILTLTFHKYCKNRFE  527

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVF  434
            PAF KYPL+EA  KDT+ER  EP LN+KAYL DAY+HP+F
Sbjct  528  PAFRKYPLEEAMAKDTMERTTEPNLNIKAYLADAYLHPIF  567



>gb|AFW78070.1| hypothetical protein ZEAMMB73_829601 [Zea mays]
Length=748

 Score =   236 bits (603),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 148/196 (76%), Gaps = 2/196 (1%)
 Frame = -1

Query  913  AMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPILIPFIIVFFGFAFLVYRHQIINVYNQEY  734
            AMD GS+ F   EP++QLYFLLGLVYAVVTP+L+PFIIVFF  A+LV+RHQIINVY Q Y
Sbjct  555  AMDPGSLDFYNCEPRLQLYFLLGLVYAVVTPMLLPFIIVFFSLAYLVFRHQIINVYTQHY  614

Query  733  ESAAAFWPAVHGRIIFALVFSQISTLGLLSTKHAATSAPFLIALPVLTISFHLFCKGRYE  554
            ES A FWP VH R+I AL+ SQI  LGLLST+ A  S   L+ LPVL+I FH  CKGR+E
Sbjct  615  ESGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRFE  674

Query  553  PAFTKYPLQEAKMKDTLERAREPTLNLKAYLQDAYVHPVFkegdddeddemseklemEGI  374
            PAF K+PLQ+A +KDTLERA +PTLNL+ YL+ AYVHPVF++ D  +   + E+ +    
Sbjct  675  PAFVKFPLQDAMVKDTLERAHDPTLNLREYLKGAYVHPVFQKNDIYKVIAVDEEEKNP--  732

Query  373  LVPTKRQSRRNTPAPS  326
            +V TKRQSR N PA S
Sbjct  733  MVVTKRQSRMNAPAGS  748



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2118266961610