BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8265

Length=868
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    357   5e-117   Solanum lycopersicum
ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               358   6e-117   
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    355   2e-116   Solanum tuberosum [potatoes]
ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    355   3e-116   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    355   5e-116   Nicotiana sylvestris
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    351   2e-114   Theobroma cacao [chocolate]
ref|XP_010108654.1|  Histidine decarboxylase                            348   1e-113   Morus notabilis
ref|NP_001047064.2|  Os02g0541300                                       337   7e-113   
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               345   1e-112   
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                345   2e-112   Erythranthe guttata [common monkey flower]
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     346   2e-112   Eucalyptus grandis [rose gum]
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               345   3e-112   Nelumbo nucifera [Indian lotus]
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          345   3e-112   Sorghum bicolor [broomcorn]
emb|CDP11372.1|  unnamed protein product                                341   7e-112   Coffea canephora [robusta coffee]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            344   8e-112   
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               343   2e-111   Nelumbo nucifera [Indian lotus]
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            342   3e-111   Setaria italica
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            342   4e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86197.1|  hypothetical protein OsI_07573                          342   6e-111   Oryza sativa Indica Group [Indian rice]
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   341   9e-111   Citrus sinensis [apfelsine]
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    340   1e-110   Citrus sinensis [apfelsine]
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  340   1e-110   Elaeis guineensis
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  340   1e-110   Brachypodium distachyon [annual false brome]
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    340   1e-110   Fragaria vesca subsp. vesca
ref|XP_012066036.1|  PREDICTED: serine decarboxylase                    340   1e-110   Jatropha curcas
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  340   2e-110   Brachypodium distachyon [annual false brome]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             340   2e-110   Citrus clementina [clementine]
ref|XP_002306690.1|  serine decarboxylase family protein                339   3e-110   Populus trichocarpa [western balsam poplar]
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               338   6e-110   Populus euphratica
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               339   6e-110   Populus euphratica
ref|XP_002533017.1|  group II plp decarboxylase, putative               338   9e-110   Ricinus communis
gb|KJB16469.1|  hypothetical protein B456_002G231300                    338   1e-109   Gossypium raimondii
gb|KJB16470.1|  hypothetical protein B456_002G231300                    338   1e-109   Gossypium raimondii
gb|KJB16468.1|  hypothetical protein B456_002G231300                    338   1e-109   Gossypium raimondii
dbj|BAE07183.1|  putative serine decarboxylase                          338   1e-109   Beta vulgaris [beet]
gb|KHG24953.1|  Histidine decarboxylase                                 338   1e-109   Gossypium arboreum [tree cotton]
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    338   2e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             337   2e-109   Prunus persica
gb|EPS66281.1|  serine decarboxylase                                    335   2e-109   Genlisea aurea
emb|CBI18554.3|  unnamed protein product                                336   2e-109   Vitis vinifera
ref|XP_002302186.1|  serine decarboxylase family protein                337   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               337   3e-109   Tarenaya hassleriana [spider flower]
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             339   3e-109   
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             337   3e-109   Eutrema salsugineum [saltwater cress]
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             337   4e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    337   5e-109   Vitis vinifera
ref|XP_004140972.1|  PREDICTED: serine decarboxylase isoform X2         336   6e-109   Cucumis sativus [cucumbers]
ref|XP_011656638.1|  PREDICTED: serine decarboxylase isoform X1         337   6e-109   Cucumis sativus [cucumbers]
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             336   6e-109   
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            336   7e-109   Prunus mume [ume]
gb|AFK28264.1|  putative serine decarboxylase                           327   7e-109   Helianthus paradoxus
gb|KJB59412.1|  hypothetical protein B456_009G253400                    335   2e-108   Gossypium raimondii
gb|AFK28277.1|  putative serine decarboxylase                           327   2e-108   Helianthus petiolaris
emb|CAN70523.1|  hypothetical protein VITISV_034634                     335   2e-108   Vitis vinifera
gb|KHG04394.1|  Histidine decarboxylase                                 335   2e-108   Gossypium arboreum [tree cotton]
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      335   3e-108   Cucumis melo [Oriental melon]
gb|KJB59411.1|  hypothetical protein B456_009G253400                    334   3e-108   Gossypium raimondii
gb|KJB59410.1|  hypothetical protein B456_009G253400                    334   3e-108   Gossypium raimondii
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      334   4e-108   
gb|AFK28270.1|  putative serine decarboxylase                           325   4e-108   Helianthus deserticola
gb|AFK28256.1|  putative serine decarboxylase                           325   4e-108   Helianthus annuus
gb|AFK28253.1|  putative serine decarboxylase                           325   4e-108   Helianthus argophyllus
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  333   7e-108   Phoenix dactylifera
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            333   7e-108   
ref|NP_175036.1|  serine decarboxylase 1                                333   8e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AFK28281.1|  putative serine decarboxylase                           325   1e-107   Helianthus debilis [cucumberleaf sunflower]
gb|AFK28261.1|  putative serine decarboxylase                           324   1e-107   Helianthus annuus
gb|AFK28271.1|  putative serine decarboxylase                           324   1e-107   Helianthus anomalus
gb|AFK28260.1|  putative serine decarboxylase                           324   2e-107   Helianthus annuus
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    330   2e-107   
gb|AFK28262.1|  putative serine decarboxylase                           324   2e-107   Helianthus annuus
gb|AFK28257.1|  putative serine decarboxylase                           324   2e-107   Helianthus annuus
emb|CDY41717.1|  BnaA09g15450D                                          332   2e-107   Brassica napus [oilseed rape]
gb|AFK28273.1|  putative serine decarboxylase                           324   2e-107   Helianthus anomalus
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               332   2e-107   Brassica rapa
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               333   2e-107   Brassica rapa
gb|AFK28254.1|  putative serine decarboxylase                           323   3e-107   Helianthus argophyllus
gb|AFK28287.1|  putative serine decarboxylase                           323   3e-107   Helianthus bolanderi
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               332   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               332   3e-107   Camelina sativa [gold-of-pleasure]
gb|AFK28279.1|  putative serine decarboxylase                           323   4e-107   Helianthus petiolaris
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    332   4e-107   Tarenaya hassleriana [spider flower]
gb|AFK28267.1|  putative serine decarboxylase                           323   4e-107   Helianthus deserticola
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            332   6e-107   Zea mays [maize]
emb|CDX80723.1|  BnaC08g05570D                                          331   6e-107   
dbj|BAA78331.1|  serine decarboxylase                                   331   7e-107   Brassica napus [oilseed rape]
gb|AFK28272.1|  putative serine decarboxylase                           322   7e-107   Helianthus anomalus
ref|XP_002893962.1|  EMB1075                                            330   7e-107   
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             333   9e-107   
gb|AFK28291.1|  putative serine decarboxylase                           322   9e-107   Helianthus niveus
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    331   1e-106   Camelina sativa [gold-of-pleasure]
gb|AFK28269.1|  putative serine decarboxylase                           322   1e-106   Helianthus deserticola
emb|CDY48944.1|  BnaA08g04700D                                          330   2e-106   Brassica napus [oilseed rape]
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               329   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               329   3e-106   
emb|CDY59264.1|  BnaC09g51700D                                          328   7e-106   Brassica napus [oilseed rape]
ref|XP_006854520.1|  PREDICTED: serine decarboxylase 1                  328   9e-106   Amborella trichopoda
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            328   9e-106   Malus domestica [apple tree]
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               327   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    327   2e-105   Brassica rapa
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 327   3e-105   Malus domestica [apple tree]
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               327   3e-105   Arabis alpina [alpine rockcress]
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             326   3e-105   Prunus persica
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             326   5e-105   Phaseolus vulgaris [French bean]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    326   5e-105   Cicer arietinum [garbanzo]
emb|CDY30753.1|  BnaC05g51500D                                          326   6e-105   Brassica napus [oilseed rape]
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            325   6e-105   Prunus mume [ume]
gb|AFK39410.1|  unknown                                                 320   1e-104   Medicago truncatula
ref|XP_003593129.1|  Histidine decarboxylase                            325   2e-104   Medicago truncatula
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             324   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             325   2e-104   Nelumbo nucifera [Indian lotus]
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    322   8e-104   Glycine max [soybeans]
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    322   1e-103   Glycine max [soybeans]
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    323   1e-103   
gb|KHN39188.1|  Histidine decarboxylase                                 322   2e-103   Glycine soja [wild soybean]
gb|ACJ85197.1|  unknown                                                 320   1e-102   Medicago truncatula
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 319   5e-102   Glycine max [soybeans]
ref|NP_001241244.1|  uncharacterized protein LOC100795577               318   5e-102   Glycine max [soybeans]
gb|KHN26720.1|  Histidine decarboxylase                                 318   6e-102   Glycine soja [wild soybean]
gb|AFA36595.1|  putative serine decarboxylase                           306   1e-100   Lolium perenne [perennial ryegrass]
gb|AFK28252.1|  putative serine decarboxylase                           304   5e-100   Helianthus agrestis
ref|XP_001761266.1|  predicted protein                                  307   6e-98    
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             300   5e-95    
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             299   2e-94    
ref|XP_001754291.1|  predicted protein                                  297   2e-94    
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               297   4e-94    
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               297   4e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT14427.1|  Histidine decarboxylase                                 293   7e-92    
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             288   3e-90    Brachypodium distachyon [annual false brome]
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               280   4e-87    Solanum lycopersicum
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            280   4e-87    Solanum tuberosum [potatoes]
ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            278   3e-86    Nicotiana sylvestris
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    278   3e-86    
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    278   3e-86    
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    277   4e-86    Nicotiana sylvestris
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            276   1e-85    Solanum lycopersicum
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    276   1e-85    Sesamum indicum [beniseed]
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    276   1e-85    Sesamum indicum [beniseed]
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            275   2e-85    Nicotiana tomentosiformis
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            275   2e-85    Nicotiana tomentosiformis
gb|AES76141.2|  serine decarboxylase                                    268   3e-85    Medicago truncatula
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    275   3e-85    Solanum tuberosum [potatoes]
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    275   4e-85    Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    275   4e-85    
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            274   7e-85    Solanum tuberosum [potatoes]
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            273   9e-85    Solanum lycopersicum
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            274   1e-84    
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            273   1e-84    Solanum tuberosum [potatoes]
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 273   2e-84    Solanum lycopersicum
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            273   2e-84    Solanum tuberosum [potatoes]
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            272   3e-84    
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                272   4e-84    Solanum lycopersicum
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            271   6e-84    Solanum tuberosum [potatoes]
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               271   6e-84    
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            271   8e-84    Solanum lycopersicum
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            270   2e-83    Solanum tuberosum [potatoes]
gb|KEH26769.1|  serine decarboxylase                                    261   3e-83    Medicago truncatula
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            266   3e-82    Solanum lycopersicum
gb|KHN16991.1|  Histidine decarboxylase                                 265   4e-82    Glycine soja [wild soybean]
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            267   6e-82    
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            266   6e-82    Glycine max [soybeans]
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            265   7e-82    
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               265   1e-81    Sesamum indicum [beniseed]
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            264   2e-81    
ref|XP_003619923.1|  L-tyrosine decarboxylase                           262   3e-81    
gb|EMS49846.1|  Histidine decarboxylase                                 261   3e-81    Triticum urartu
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            264   3e-81    Solanum tuberosum [potatoes]
ref|XP_003607341.1|  Embryo defective 1075-like protein                 259   2e-79    
ref|XP_003592126.1|  Histidine decarboxylase                            259   2e-79    
gb|EAY77466.1|  hypothetical protein OsI_32510                          259   3e-79    Oryza sativa Indica Group [Indian rice]
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            259   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            258   8e-79    Oryza brachyantha
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                253   6e-78    Erythranthe guttata [common monkey flower]
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     254   2e-77    Nicotiana tabacum [American tobacco]
ref|NP_001242861.1|  uncharacterized protein LOC100792053               254   2e-77    
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            254   2e-77    Nicotiana sylvestris
gb|AHG12639.1|  histidine decarboxylase                                 254   3e-77    Nicotiana tabacum [American tobacco]
gb|ACU18860.1|  unknown                                                 243   3e-77    Glycine max [soybeans]
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            253   6e-77    Nicotiana sylvestris
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    252   8e-77    
ref|XP_002953989.1|  serine decarboxylase                               253   1e-76    Volvox carteri f. nagariensis
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            251   2e-76    Cicer arietinum [garbanzo]
gb|AES89541.2|  serine decarboxylase                                    244   2e-76    Medicago truncatula
ref|XP_003607344.1|  Serine decarboxylase                               243   2e-76    
ref|XP_001689659.1|  serine decarboxylase                               248   6e-76    Chlamydomonas reinhardtii
ref|XP_011401256.1|  Histidine decarboxylase                            251   1e-75    Auxenochlorella protothecoides
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    248   1e-75    Nicotiana tomentosiformis
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    248   3e-75    
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              248   5e-75    Chlorella variabilis
ref|XP_003592128.1|  Embryo defective 1075-like protein                 247   1e-74    
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            246   1e-74    
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            246   2e-74    Nicotiana tomentosiformis
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                245   5e-74    Erythranthe guttata [common monkey flower]
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                244   8e-74    Erythranthe guttata [common monkey flower]
gb|KDD76585.1|  hypothetical protein H632_c172p0                        244   3e-73    Helicosporidium sp. ATCC 50920
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            243   3e-73    
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               243   3e-73    
gb|EMS65243.1|  Histidine decarboxylase                                 240   5e-73    Triticum urartu
gb|EYU40386.1|  hypothetical protein MIMGU_mgv1a026369mg                238   6e-73    Erythranthe guttata [common monkey flower]
gb|KEH43660.1|  serine decarboxylase                                    244   1e-72    Medicago truncatula
gb|KCW44086.1|  hypothetical protein EUGRSUZ_L02502                     232   2e-71    Eucalyptus grandis [rose gum]
ref|XP_006362640.1|  PREDICTED: histidine decarboxylase-like            235   2e-71    
gb|AES62380.2|  serine decarboxylase                                    238   2e-71    Medicago truncatula
ref|XP_003592129.1|  Serine decarboxylase                               238   3e-71    
gb|EEC76705.1|  hypothetical protein OsI_14710                          236   4e-71    Oryza sativa Indica Group [Indian rice]
gb|KIZ00141.1|  histidine decarboxylase                                 238   6e-71    Monoraphidium neglectum
gb|EEE60437.1|  hypothetical protein OsJ_13648                          231   4e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            234   5e-70    Solanum lycopersicum
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            233   3e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            232   6e-69    Oryza brachyantha
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            231   8e-69    Solanum lycopersicum
ref|XP_003592132.1|  FAR1-related protein                               242   9e-69    
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          233   9e-69    Sorghum bicolor [broomcorn]
ref|NP_001234136.2|  histidine decarboxylase                            231   1e-68    Solanum lycopersicum
ref|XP_005646136.1|  serine decarboxylase                               229   1e-68    Coccomyxa subellipsoidea C-169
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 230   2e-68    Solanum lycopersicum
gb|AEW07461.1|  hypothetical protein 0_2106_01                          221   3e-68    Pinus radiata
gb|AFG54679.1|  hypothetical protein 0_2106_01                          219   1e-67    Pinus taeda
sp|P54772.1|DCHS_SOLLC  RecName: Full=Histidine decarboxylase; Sh...    225   1e-66    Solanum lycopersicum
ref|XP_009609584.1|  PREDICTED: histidine decarboxylase-like            219   7e-66    
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             223   2e-65    Phaseolus vulgaris [French bean]
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             223   6e-65    Phaseolus vulgaris [French bean]
ref|XP_002178784.1|  predicted protein                                  208   1e-60    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002292250.1|  histidine decarboxylase                            207   3e-60    Thalassiosira pseudonana CCMP1335
gb|KJE90702.1|  serine decarboxylase                                    210   8e-59    Capsaspora owczarzaki ATCC 30864
ref|XP_004364837.2|  serine decarboxylase                               210   1e-58    Capsaspora owczarzaki ATCC 30864
ref|XP_002679079.1|  predicted protein                                  204   2e-58    Naegleria gruberi strain NEG-M
ref|WP_026730962.1|  histidine decarboxylase                            174   8e-48    
ref|XP_003593127.1|  Histidine decarboxylase                            162   8e-46    
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         174   6e-45    Oryza sativa Japonica Group [Japonica rice]
ref|WP_015112001.1|  Histidine decarboxylase                            167   9e-45    Nostoc sp. PCC 7107
ref|WP_017312078.1|  histidine decarboxylase                            166   3e-44    Fischerella sp. PCC 9339
ref|WP_016859640.1|  histidine decarboxylase                            165   6e-44    Fischerella muscicola
ref|WP_016870188.1|  histidine decarboxylase                            163   2e-43    Fischerella muscicola
ref|WP_026721610.1|  histidine decarboxylase                            163   3e-43    Fischerella sp. PCC 9431
ref|WP_009455225.1|  histidine decarboxylase                            162   5e-43    Fischerella thermalis
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940             160   2e-42    Guillardia theta CCMP2712
ref|WP_012408195.1|  histidine decarboxylase                            160   2e-42    Nostoc punctiforme
ref|WP_040468965.1|  histidine decarboxylase                            152   2e-41    
ref|WP_045055559.1|  histidine decarboxylase                            156   8e-41    Aliterella atlantica
ref|WP_004156018.1|  histidine decarboxylase                            153   1e-39    Microscilla marina
ref|NP_001176002.1|  Os10g0105700                                       148   2e-39    
ref|WP_026731780.1|  histidine decarboxylase                            151   4e-39    
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                  151   6e-39    
ref|WP_014680621.1|  histidine decarboxylase                            150   8e-39    Solitalea canadensis
ref|WP_025665600.1|  histidine decarboxylase                            150   2e-38    Aquimarina megaterium
ref|WP_034238501.1|  histidine decarboxylase                            150   2e-38    Aquimarina atlantica
gb|EZH75803.1|  histidine decarboxylase                                 149   2e-38    Aquimarina atlantica
ref|WP_034760693.1|  histidine decarboxylase                            149   2e-38    Chryseobacterium sp. OV259
dbj|BAH97114.1|  amino acid decarboxylase                               148   2e-38    Naegleria fowleri [brain-eating amoeba]
ref|WP_017497877.1|  histidine decarboxylase                            150   2e-38    Flavobacterium sp. WG21
ref|WP_038505799.1|  histidine decarboxylase                            149   3e-38    Cellulophaga lytica
ref|WP_034646581.1|  histidine decarboxylase                            149   3e-38    Cellulophaga
ref|WP_013621330.1|  histidine decarboxylase                            149   3e-38    Cellulophaga lytica
gb|EYU24758.1|  hypothetical protein MIMGU_mgv1a026373mg                146   6e-38    Erythranthe guttata [common monkey flower]
ref|WP_035090976.1|  histidine decarboxylase                            148   1e-37    Aquimarina macrocephali
ref|WP_024740708.1|  histidine decarboxylase                            148   1e-37    Tenacibaculum maritimum
ref|WP_003516909.1|  histidine decarboxylase                            147   2e-37    Hungateiclostridium thermocellum
ref|WP_003514849.1|  histidine decarboxylase                            147   3e-37    Hungateiclostridium thermocellum
gb|KFF73912.1|  histidine decarboxylase                                 147   3e-37    Chryseobacterium sp. P1-3
ref|WP_020457998.1|  histidine decarboxylase                            147   3e-37    Hungateiclostridium thermocellum
ref|WP_023062889.1|  histidine decarboxylase                            147   3e-37    Hungateiclostridium thermocellum
ref|WP_042506313.1|  histidine decarboxylase                            146   5e-37    Algibacter lectus
ref|WP_007138876.1|  histidine decarboxylase                            145   1e-36    Flavobacterium frigoris
ref|WP_013663956.1|  histidine decarboxylase                            144   2e-36    Sphingobacterium sp. 21
ref|WP_014680343.1|  histidine decarboxylase                            143   7e-36    Solitalea canadensis
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          143   1e-35    Oryza sativa Japonica Group [Japonica rice]
ref|WP_028889574.1|  histidine decarboxylase                            142   1e-35    Tenacibaculum ovolyticum
gb|KHN17002.1|  Histidine decarboxylase                                 144   1e-35    Glycine soja [wild soybean]
ref|WP_040295065.1|  hypothetical protein                               141   2e-35    
ref|WP_025146293.1|  histidine decarboxylase                            142   2e-35    Pedobacter jeongneungensis
ref|WP_027411177.1|  histidine decarboxylase                            142   2e-35    Aquimarina muelleri
ref|WP_029274788.1|  histidine decarboxylase                            141   2e-35    Pedobacter borealis
gb|AFY36874.1|  Histidine decarboxylase                                 144   2e-35    Leptolyngbya sp. PCC 7376
ref|WP_043706361.1|  histidine decarboxylase                            141   2e-35    
gb|EIJ41099.1|  PLP-dependent enzyme, glutamate decarboxylase           141   2e-35    Beggiatoa alba B18LD
ref|WP_037437993.1|  histidine decarboxylase                            141   3e-35    Pedobacter antarcticus
ref|WP_042499973.1|  histidine decarboxylase                            140   4e-35    Algibacter lectus
ref|WP_041885112.1|  histidine decarboxylase                            141   4e-35    Pedobacter lusitanus
gb|KCW71157.1|  hypothetical protein EUGRSUZ_F04254                     132   4e-35    
ref|WP_041764715.1|  hypothetical protein                               140   6e-35    
ref|WP_045967955.1|  histidine decarboxylase                            140   9e-35    
ref|WP_026632650.1|  histidine decarboxylase                            140   1e-34    
ref|WP_039472909.1|  histidine decarboxylase                            139   1e-34    
ref|WP_038006112.1|  histidine decarboxylase                            137   9e-34    
ref|WP_038528108.1|  histidine decarboxylase                            137   1e-33    
gb|EMT14424.1|  Histidine decarboxylase                                 137   1e-33    
ref|WP_039116802.1|  histidine decarboxylase                            137   1e-33    
ref|WP_014201338.1|  histidine decarboxylase                            136   2e-33    
ref|XP_009600053.1|  PREDICTED: histidine decarboxylase-like            133   2e-33    
ref|WP_041881750.1|  histidine decarboxylase                            136   2e-33    
ref|WP_036288070.1|  histidine decarboxylase                            136   2e-33    
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                  137   2e-33    
ref|WP_038239506.1|  histidine decarboxylase                            135   4e-33    
ref|WP_011142216.1|  histidine decarboxylase                            134   1e-32    
ref|WP_038267770.1|  histidine decarboxylase                            134   2e-32    
ref|WP_036146264.1|  histidine decarboxylase                            133   2e-32    
ref|WP_015192440.1|  Histidine decarboxylase                            134   3e-32    
gb|AGT16577.1|  histidine decarboxylase-like protein                    132   4e-32    
ref|WP_026362388.1|  histidine decarboxylase                            132   4e-32    
gb|EIJ36795.1|  Pyridoxal-dependent decarboxylase                       132   9e-32    
ref|WP_013995757.1|  histidine decarboxylase                            130   3e-31    
ref|WP_028892147.1|  histidine decarboxylase                            130   3e-31    
ref|XP_008620940.1|  histidine decarboxylase                            130   6e-31    
ref|WP_017055794.1|  histidine decarboxylase                            129   6e-31    
ref|WP_040574889.1|  hypothetical protein                               128   1e-30    
ref|WP_019504461.1|  hypothetical protein                               130   1e-30    
ref|WP_010913856.1|  histidine decarboxylase                            128   1e-30    
ref|WP_018151708.1|  hypothetical protein                               128   2e-30    
gb|KGR35339.1|  histidine decarboxylase                                 128   2e-30    
ref|WP_005427952.1|  histidine decarboxylase                            128   2e-30    
ref|WP_045378494.1|  histidine decarboxylase                            128   2e-30    
gb|KDO21825.1|  hypothetical protein SPRG_12642                         127   3e-30    
ref|WP_010181748.1|  histidine decarboxylase                            127   4e-30    
ref|WP_012127831.1|  histidine decarboxylase                            127   4e-30    
ref|WP_040841268.1|  hypothetical protein                               126   5e-30    
ref|WP_038890337.1|  histidine decarboxylase                            127   6e-30    
ref|WP_045452728.1|  histidine decarboxylase                            127   6e-30    
ref|WP_045368827.1|  histidine decarboxylase                            126   6e-30    
ref|WP_005533429.1|  histidine decarboxylase                            126   7e-30    
ref|WP_045398307.1|  histidine decarboxylase                            126   9e-30    
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                  125   9e-30    
ref|WP_020977926.1|  histidine decarboxylase                            126   9e-30    
ref|WP_010647516.1|  histidine decarboxylase                            126   1e-29    
ref|WP_011154645.1|  histidine decarboxylase                            126   1e-29    
ref|WP_046120161.1|  pyridoxal-dependent decarboxylase                  125   1e-29    
ref|WP_009963501.1|  histidine decarboxylase                            125   2e-29    
ref|WP_016529303.1|  histidine decarboxylase                            125   2e-29    
ref|WP_010473064.1|  histidine decarboxylase                            126   2e-29    
ref|WP_012166190.1|  histidine decarboxylase                            125   3e-29    
gb|EYU30499.1|  hypothetical protein MIMGU_mgv1a018143mg                122   3e-29    
ref|WP_038863593.1|  histidine decarboxylase                            124   4e-29    
ref|WP_013661870.1|  histidine decarboxylase                            124   5e-29    
gb|KDW84254.1|  hypothetical protein AC70_4802                          119   6e-29    
dbj|GAJ47127.1|  histidine decarboxylase                                122   7e-29    
ref|WP_009841733.1|  histidine decarboxylase                            123   1e-28    
ref|WP_043144304.1|  histidine decarboxylase                            122   2e-28    
ref|WP_034524496.1|  histidine decarboxylase                            122   2e-28    
ref|WP_042467211.1|  histidine decarboxylase                            122   2e-28    
gb|ABO92295.1|  histidine decarboxylase                                 122   2e-28    
ref|WP_033002296.1|  histidine decarboxylase                            122   2e-28    
ref|WP_034281999.1|  histidine decarboxylase                            122   2e-28    
gb|EQC02399.1|  histidine decarboxylase                                 122   2e-28    
gb|EHI50832.1|  histidine decarboxylase                                 122   3e-28    
ref|WP_010521317.1|  histidine decarboxylase                            121   4e-28    
ref|WP_038170807.1|  histidine decarboxylase                            122   4e-28    
emb|CAN84646.1|  histidine decarboxylase                                121   4e-28    
ref|WP_042585292.1|  histidine decarboxylase                            120   9e-28    
gb|KIP17071.1|  histidine decarboxylase                                 120   1e-27    
ref|WP_004863422.1|  histidine decarboxylase                            119   2e-27    
ref|WP_042556656.1|  histidine decarboxylase                            119   4e-27    
ref|YP_001340499.1|  histidine decarboxylase                            119   4e-27    
ref|WP_004737502.1|  histidine decarboxylase                            119   4e-27    
ref|WP_036985757.1|  histidine decarboxylase                            118   5e-27    
ref|WP_022551512.1|  Histidine decarboxylase                            118   5e-27    
gb|KJF87341.1|  histidine decarboxylase                                 115   6e-27    
ref|WP_043639836.1|  histidine decarboxylase                            117   8e-27    
ref|WP_026037108.1|  histidine decarboxylase                            117   9e-27    
ref|WP_043592636.1|  histidine decarboxylase                            117   9e-27    
ref|WP_034119545.1|  histidine decarboxylase                            117   9e-27    
ref|WP_005788362.1|  histidine decarboxylase                            117   1e-26    
ref|WP_039045861.1|  histidine decarboxylase                            117   2e-26    
ref|WP_025468757.1|  histidine decarboxylase                            114   2e-26    
gb|EMU06553.1|  histidine decarboxylase                                 114   2e-26    
ref|WP_010864579.1|  histidine decarboxylase                            117   2e-26    
ref|WP_031316740.1|  histidine decarboxylase                            116   2e-26    
ref|WP_033003777.1|  histidine decarboxylase                            116   3e-26    
ref|WP_011533709.1|  histidine decarboxylase                            116   4e-26    
dbj|GAD76103.1|  hypothetical protein VAZ01S_036_00470                  116   4e-26    
ref|WP_022610851.1|  Histidine decarboxylase                            115   5e-26    
ref|WP_004401828.1|  histidine decarboxylase                            115   5e-26    
ref|WP_022589616.1|  Histidine decarboxylase                            115   5e-26    
ref|WP_005301029.1|  histidine decarboxylase                            115   6e-26    
ref|WP_002058887.1|  histidine decarboxylase                            115   7e-26    
ref|WP_045962181.1|  histidine decarboxylase                            115   7e-26    
ref|WP_005138337.1|  histidine decarboxylase                            115   8e-26    
ref|WP_032037888.1|  histidine decarboxylase                            115   9e-26    
dbj|BAE94285.1|  histidine decarboxylase                                114   1e-25    
gb|AAA25071.1|  histidine decarboxylase                                 114   1e-25    
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase              114   1e-25    
gb|EFA28401.1|  histidine decarboxylase                                 110   1e-25    
ref|WP_005131724.1|  histidine decarboxylase                            114   2e-25    
ref|WP_011859800.1|  histidine decarboxylase                            112   3e-25    
ref|WP_000603877.1|  histidine decarboxylase                            113   3e-25    
ref|WP_032004531.1|  histidine decarboxylase                            113   4e-25    
ref|WP_041602526.1|  histidine decarboxylase                            113   4e-25    
emb|CBV42710.1|  histidine decarboxylase                                113   4e-25    
gb|ABR25820.1|  histidine decarboxylase                                 107   4e-25    
ref|WP_000927250.1|  histidine decarboxylase                            113   4e-25    
ref|WP_031995260.1|  histidine decarboxylase                            113   4e-25    
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase              113   4e-25    
ref|WP_005692801.1|  histidine decarboxylase                            112   4e-25    
ref|WP_031955420.1|  histidine decarboxylase                            112   4e-25    
ref|WP_033847713.1|  histidine decarboxylase                            112   4e-25    
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase              112   4e-25    
ref|WP_000603872.1|  histidine decarboxylase                            112   4e-25    
ref|WP_016653750.1|  histidine decarboxylase                            112   4e-25    
ref|WP_032001354.1|  histidine decarboxylase                            112   5e-25    
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase              112   5e-25    
ref|WP_000603882.1|  histidine decarboxylase                            112   5e-25    
ref|WP_024433575.1|  histidine decarboxylase                            112   5e-25    
ref|WP_000603871.1|  histidine decarboxylase                            112   5e-25    
ref|WP_000603880.1|  histidine decarboxylase                            112   5e-25    
ref|WP_005109677.1|  histidine decarboxylase                            112   5e-25    
ref|WP_004746555.1|  histidine decarboxylase                            112   5e-25    
ref|WP_024436628.1|  histidine decarboxylase                            112   5e-25    
ref|WP_000603876.1|  histidine decarboxylase                            112   5e-25    
ref|WP_030424673.1|  histidine decarboxylase                            112   5e-25    
ref|WP_032045777.1|  histidine decarboxylase                            112   5e-25    
ref|WP_004840538.1|  histidine decarboxylase                            112   5e-25    
ref|WP_031978061.1|  histidine decarboxylase                            112   5e-25    
ref|WP_000603865.1|  histidine decarboxylase                            112   5e-25    
ref|WP_031965236.1|  histidine decarboxylase                            112   5e-25    
ref|WP_045902414.1|  histidine decarboxylase                            112   5e-25    
ref|WP_039759067.1|  histidine decarboxylase                            112   5e-25    
ref|WP_032060642.1|  histidine decarboxylase                            112   5e-25    
ref|WP_000603869.1|  histidine decarboxylase                            112   5e-25    
ref|WP_044101067.1|  histidine decarboxylase                            112   5e-25    
ref|WP_031993225.1|  histidine decarboxylase                            112   5e-25    
ref|WP_023896388.1|  Histidine decarboxylase                            112   5e-25    
ref|WP_032058746.1|  histidine decarboxylase                            112   5e-25    
ref|WP_032027924.1|  histidine decarboxylase                            112   5e-25    
ref|WP_017815795.1|  histidine decarboxylase                            112   5e-25    
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase              112   5e-25    
ref|WP_038349211.1|  histidine decarboxylase                            112   6e-25    
ref|WP_002126558.1|  histidine decarboxylase                            112   6e-25    
ref|WP_032009129.1|  histidine decarboxylase                            112   6e-25    
ref|WP_000603861.1|  histidine decarboxylase                            112   6e-25    
ref|WP_000603863.1|  histidine decarboxylase                            112   6e-25    
ref|WP_000603864.1|  histidine decarboxylase                            112   6e-25    
ref|WP_000603881.1|  histidine decarboxylase                            112   6e-25    
ref|WP_002132193.1|  histidine decarboxylase                            112   6e-25    
ref|WP_002046800.1|  histidine decarboxylase                            112   7e-25    
ref|WP_031948968.1|  histidine decarboxylase                            112   7e-25    
ref|WP_005073362.1|  histidine decarboxylase                            112   7e-25    
ref|WP_039098800.1|  histidine decarboxylase                            112   7e-25    
ref|WP_029661164.1|  hypothetical protein                               112   7e-25    
ref|WP_032017576.1|  histidine decarboxylase                            112   7e-25    
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase              112   8e-25    
ref|WP_021511013.1|  histidine decarboxylase                            112   8e-25    
ref|WP_032063040.1|  histidine decarboxylase                            112   8e-25    
ref|WP_005128217.1|  histidine decarboxylase                            112   8e-25    
ref|WP_000603866.1|  histidine decarboxylase                            112   8e-25    
gb|ESG76598.1|  histidine decarboxylase                                 112   9e-25    
ref|WP_001750840.1|  histidine decarboxylase                            112   9e-25    
ref|WP_032035746.1|  histidine decarboxylase                            112   9e-25    
ref|WP_032058148.1|  histidine decarboxylase                            112   9e-25    
ref|WP_023248740.1|  histidine decarboxylase                            112   9e-25    
ref|WP_017725496.1|  histidine decarboxylase                            112   9e-25    
ref|WP_000603875.1|  histidine decarboxylase                            112   1e-24    
ref|WP_000603868.1|  histidine decarboxylase                            112   1e-24    
ref|WP_043188769.1|  histidine decarboxylase                            112   1e-24    
ref|WP_000603867.1|  histidine decarboxylase                            112   1e-24    
ref|WP_000603862.1|  histidine decarboxylase                            112   1e-24    
ref|WP_025152530.1|  histidine decarboxylase                            112   1e-24    
emb|CCJ09762.1|  putative histidine decarboxylase-like                  104   1e-24    
ref|WP_000603873.1|  histidine decarboxylase                            112   1e-24    
ref|WP_024474395.1|  histidine decarboxylase                            111   1e-24    
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase              111   1e-24    
ref|WP_026948110.1|  hypothetical protein                               111   1e-24    
ref|WP_032874071.1|  histidine decarboxylase                            111   1e-24    
ref|WP_033851982.1|  histidine decarboxylase                            111   1e-24    
ref|WP_032068226.1|  histidine decarboxylase                            111   1e-24    
ref|WP_032866759.1|  histidine decarboxylase                            111   1e-24    
ref|WP_005196164.1|  histidine decarboxylase                            111   1e-24    
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein            111   1e-24    
ref|WP_024439211.1|  histidine decarboxylase                            111   1e-24    
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...    111   1e-24    
ref|WP_000603884.1|  histidine decarboxylase                            111   1e-24    
ref|WP_020302734.1|  histidine decarboxylase                            111   1e-24    
ref|WP_000603883.1|  histidine decarboxylase                            111   1e-24    
ref|WP_019817102.1|  histidine decarboxylase                            111   1e-24    
ref|WP_009507303.1|  histidine decarboxylase                            111   1e-24    
ref|WP_000603885.1|  histidine decarboxylase                            111   1e-24    
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase              111   1e-24    
ref|WP_031961008.1|  histidine decarboxylase                            111   1e-24    
ref|WP_000603878.1|  histidine decarboxylase                            111   1e-24    
gb|AII01327.1|  histidine decarboxylase                                 111   2e-24    
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...    111   2e-24    
gb|ERB65931.1|  hypothetical protein N779_07570                         109   2e-24    
gb|KGF60681.1|  histidine decarboxylase                                 110   2e-24    
gb|AAO65983.1|  putative pyridoxal 5' phosphate-dependent histidi...    110   2e-24    
ref|WP_031976591.1|  histidine decarboxylase                            110   2e-24    
dbj|BAE94284.1|  histidine decarboxylase                                110   2e-24    
ref|WP_031380129.1|  histidine decarboxylase                            110   2e-24    
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase              110   2e-24    
ref|WP_031964057.1|  histidine decarboxylase                            110   3e-24    
ref|WP_045132719.1|  histidine decarboxylase                            110   3e-24    
ref|WP_032043772.1|  histidine decarboxylase                            110   3e-24    
ref|WP_036558522.1|  histidine decarboxylase                            110   3e-24    
ref|WP_032055342.1|  MULTISPECIES: histidine decarboxylase              110   3e-24    
ref|WP_045153999.1|  histidine decarboxylase                            110   3e-24    
ref|WP_036788792.1|  MULTISPECIES: histidine decarboxylase              110   3e-24    
ref|WP_032000503.1|  histidine decarboxylase                            110   4e-24    
ref|WP_004639823.1|  histidine decarboxylase                            110   4e-24    
ref|WP_000603870.1|  histidine decarboxylase                            110   4e-24    
ref|WP_000603879.1|  histidine decarboxylase                            110   5e-24    
ref|WP_000603874.1|  histidine decarboxylase                            109   5e-24    
ref|WP_045790969.1|  histidine decarboxylase                            110   5e-24    
ref|WP_045131090.1|  histidine decarboxylase                            109   8e-24    



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   357 bits (916),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  277  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L GAG
Sbjct  336  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVR+WQLACERNM+HVVVMPSVTV+KLD FLDEL++ARS
Sbjct  396  ISAMLNELSSTVVFERPKDEEFVRKWQLACERNMAHVVVMPSVTVDKLDNFLDELVEARS  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +WY+  + KPPCLA D+G  NCCC  H
Sbjct  456  IWYKDEDVKPPCLASDIGSKNCCCPQH  482



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   358 bits (919),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL HINAL
Sbjct  281  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLQHINAL  339

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  340  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  399

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE NM+HVVVMPSVTVEKLD FL+E+IQ RS
Sbjct  400  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGNMAHVVVMPSVTVEKLDFFLNEIIQGRS  459

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+ GN  PPCLA D+G +NC C LHK
Sbjct  460  IWYKDGNVHPPCLAADIGSNNCSCALHK  487



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  278  FYIHCDGALFGLMMPFVKRT-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  336

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L GAG
Sbjct  337  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAG  396

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVR+WQLACERNM+HVVVMPSVTV+KLD FLDEL++ARS
Sbjct  397  ISAMLNELSSTVVFERPKDEEFVRKWQLACERNMAHVVVMPSVTVDKLDNFLDELVEARS  456

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+  + KPPCLA D+G  NCCC  H+
Sbjct  457  IWYKDEDVKPPCLASDIGSKNCCCPHHR  484



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  277  FYIHCDGALFGLMMPFVKRAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLW TLNRKGYKGFQKEVQKCLRNAHYLKD+L GAG
Sbjct  336  SRNVEYLASRDATIMGSRNGHAPLFLWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVR+WQLACERNMSHVVVMPSVTVEKLD FLDEL++ARS
Sbjct  396  ISAMLNELSSTVVFERPKDEEFVRKWQLACERNMSHVVVMPSVTVEKLDDFLDELVKARS  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+  N KPPCLA D+G  NCCC  H+
Sbjct  456  IWYKDENVKPPCLAADIGSQNCCCPQHR  483



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   355 bits (910),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  277  FYIHCDGALFGLMMPFVKRAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLW TLNRKGYKGFQKEVQKCLRNAHYLKD+L GAG
Sbjct  336  SRNVEYLASRDATIMGSRNGHAPLFLWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELSSTVVFERPKDEEFVR+WQLACERNMSHVVVMPSVTVEKLD FLDEL++ARS
Sbjct  396  ISGMLNELSSTVVFERPKDEEFVRKWQLACERNMSHVVVMPSVTVEKLDDFLDELVKARS  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CNN  211
            +WY+  N  PPCLA D+G  NCCC  H+ CN+
Sbjct  456  IWYKDENVNPPCLAADIGSRNCCCPQHRGCNS  487



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  285  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  343

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LRGAG
Sbjct  344  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAG  403

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE N++HVVVMP+VT+EKLD FLDEL++ RS
Sbjct  404  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGNIAHVVVMPNVTIEKLDLFLDELVEKRS  463

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+  + +PPC+A DVG  NC C LHK
Sbjct  464  TWYQEEHDQPPCIAADVGKENCACALHK  491



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+        +  K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  278  FYIHCDGA-LFGLMMPFVKLAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  336

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LRGAG
Sbjct  337  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAG  396

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DEEF+RRWQLAC+ NM+HVVVMP+VT+EKLD FL+ELI+ RS
Sbjct  397  ISAMLNELSSTVVFERPLDEEFIRRWQLACQGNMAHVVVMPNVTIEKLDVFLNELIEERS  456

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY+  N +PPCLA ++G  NC C LH
Sbjct  457  AWYQDENVQPPCLAAEIGAENCACKLH  483



>ref|NP_001047064.2| Os02g0541300 [Oryza sativa Japonica Group]
 dbj|BAF08978.2| Os02g0541300, partial [Oryza sativa Japonica Group]
Length=207

 Score =   337 bits (863),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN LS
Sbjct  1    YIHCDGALFGLMIPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLS  59

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
            SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI
Sbjct  60   SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGI  119

Query  483  SAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSV  304
             AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSVT++KLD FL+EL + R+ 
Sbjct  120  GAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRAT  179

Query  303  WYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            WY+ G+ +PPCLA+DVG  NC C +HK
Sbjct  180  WYQDGSCQPPCLAKDVGEENCLCSIHK  206



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   345 bits (886),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR+DHINAL
Sbjct  271  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMDHINAL  329

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AG
Sbjct  330  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAG  389

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP +EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS
Sbjct  390  ISAMLNELSSTVVFERPSEEEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRS  449

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY  G  +PPCLA D+G  NCCC LHK
Sbjct  450  TWYRDGTVQPPCLAVDIGAENCCCALHK  477



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCG+Q+TRL HINAL
Sbjct  281  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGIQITRLRHINAL  339

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  340  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  399

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVR WQLACE NM+H+VVMP+VTVEKLD FL+EL + R+
Sbjct  400  ISAMLNELSSTVVFERPRDEEFVRMWQLACEGNMAHIVVMPNVTVEKLDYFLNELAKGRA  459

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+ G  +PPCLA DVG+ NC C +HK
Sbjct  460  IWYKDGKEQPPCLAVDVGIENCSCAVHK  487



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR+DHINAL
Sbjct  311  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMDHINAL  369

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AG
Sbjct  370  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAG  429

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP +EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS
Sbjct  430  ISAMLNELSSTVVFERPSEEEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRS  489

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY  G  +PPCLA D+G  NCCC LHK
Sbjct  490  TWYRDGTVQPPCLAVDIGAENCCCALHK  517



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN L
Sbjct  277  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINTL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AG
Sbjct  336  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRAAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEFVRRWQLAC+ N++HVVVMP++T+EKLD FL+ELIQ R 
Sbjct  396  IGAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNITIEKLDNFLNELIQKRL  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G S+PPC+A DVG  NC CVLHK
Sbjct  456  TWFQDGKSQPPCIAADVGKENCACVLHK  483



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   345 bits (885),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  288  FYIHCDGALFGLMIPFVKKAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  346

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  347  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  406

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            + AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSV ++KLD FL+EL++ R+
Sbjct  407  VGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRA  466

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G S+PPC+A DVGV NC C LHK
Sbjct  467  TWYQDGISQPPCIARDVGVENCLCGLHK  494



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   341 bits (874),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NAL
Sbjct  190  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  248

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  249  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRQAG  308

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVR+WQLAC+ NM+HVVVMP+VT+EKL+ FLD LI+ RS
Sbjct  309  ISAMLNELSSTVVFERPRDEEFVRQWQLACQGNMAHVVVMPNVTIEKLEGFLDALIEGRS  368

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+    KPPCLA ++G  NC C LHK
Sbjct  369  IWYKDDKGKPPCLAAEIGSGNCSCPLHK  396



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  288  FYIHCDGALFGLMIPFVKKAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  346

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  347  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  406

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSV ++KLD FL+EL++ R+
Sbjct  407  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRA  466

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G S+PPC+A DVGV +C C LHK
Sbjct  467  TWYQDGISQPPCIARDVGVESCLCGLHK  494



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  277  FYIHCDGALFGLMIPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AG
Sbjct  336  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRSAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEFVRRWQLAC+ +++HVVVMP++TVEKLD FL+ELI  RS
Sbjct  396  IGAMLNELSSTVVFERPQDEEFVRRWQLACQGSIAHVVVMPNITVEKLDDFLNELIGKRS  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G S+PPC+A DVG  NC CV+HK
Sbjct  456  TWFQDGKSQPPCIAADVGKENCACVMHK  483



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN L
Sbjct  283  FYIHCDGALFGLMIPFVKKA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINVL  341

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  342  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYVGFQKEVQKCLRNAHYLKDRLKEAG  401

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSV ++KLD FL EL++ R+
Sbjct  402  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLTELVEKRA  461

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G SKPPCLA D+GV NC C LHK
Sbjct  462  TWYQDGISKPPCLARDLGVENCLCGLHK  489



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN L
Sbjct  275  FYIHCDGALFGLMIPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRL  333

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  334  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  393

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSVT++KLD FL+EL + R+
Sbjct  394  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRA  453

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G+ +PPCLA+DVG  NC C +HK
Sbjct  454  TWYQDGSCQPPCLAKDVGEENCLCSIHK  481



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   342 bits (876),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN L
Sbjct  277  FYIHCDGALFGLMIPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINRL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  336  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSVT++KLD FL+EL + R+
Sbjct  396  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRA  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G+ +PPCLA+DVG  NC C +HK
Sbjct  456  TWYQDGSCQPPCLAKDVGEENCLCSIHK  483



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   341 bits (874),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  270  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  328

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  329  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAG  388

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI+ RS
Sbjct  389  ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRS  448

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WYE G  +PPC+A D+G  NC C  HK
Sbjct  449  TWYEDGKRQPPCIAADIGSENCVCAAHK  476



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  270  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  328

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  329  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAG  388

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI+ RS
Sbjct  389  ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRS  448

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WYE G  +PPC+A D+G  NC C  HK
Sbjct  449  TWYEDGKRQPPCIAADIGSENCVCAAHK  476



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HI  L
Sbjct  268  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHIKVL  326

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRD+TIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  327  SSNVEYLASRDSTIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKAAG  386

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            + AMLNELSSTVVFERPKDEEFVRRWQLACE N++H+VVMP+VT+EKLD FL+ELIQ RS
Sbjct  387  VGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHIVVMPNVTIEKLDTFLNELIQKRS  446

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WYEGG    PCLA D+G  NC C LH+
Sbjct  447  SWYEGGKIPSPCLAADIGDENCLCSLHQ  474



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  263  FYIHCDGALFGLMIPFVKKA-AKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  321

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L  AG
Sbjct  322  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLNAAG  381

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSVT++KLD FL EL++ R+
Sbjct  382  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLRELVEKRA  441

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G  +PPC+A DVG  +C C LHK
Sbjct  442  VWYKDGICQPPCIARDVGEKSCFCSLHK  469



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+        +  K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN L
Sbjct  270  FYIHCDGA-LFGLMMPFVKLAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINVL  328

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  329  SNNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAG  388

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ N++HVVVMPSV+V+KLD FL+EL++ RS
Sbjct  389  ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPSVSVDKLDDFLNELVEKRS  448

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G  +PPC+A DVG  NC C  HK
Sbjct  449  TWYKDGKVQPPCIAADVGSENCVCGRHK  476



>ref|XP_012066036.1| PREDICTED: serine decarboxylase [Jatropha curcas]
 ref|XP_012066037.1| PREDICTED: serine decarboxylase [Jatropha curcas]
 gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HIN L
Sbjct  278  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINVL  336

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AG
Sbjct  337  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRDAG  396

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ +++HVVVMP+VT+EKLD FL+ELI+ RS
Sbjct  397  ISAMLNELSSTVVFERPRDEEFVRRWQLACQGSIAHVVVMPNVTIEKLDNFLNELIEKRS  456

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G  + PC+A DVG  NC C LHK
Sbjct  457  TWYQDGQLQSPCIATDVGSENCACALHK  484



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+        +  K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINAL
Sbjct  262  FYIHCDGA-LFGLMMPFVKLAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINAL  320

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            +SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AG
Sbjct  321  ASNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLRNAG  380

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLACE N+SHVVVMPSVT+ KLD FL+EL++ R 
Sbjct  381  ISAMLNELSSTVVFERPKDEEFVRRWQLACEGNISHVVVMPSVTINKLDSFLNELVEKRV  440

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G  + PC+A DVG  NC C +HK
Sbjct  441  TWYQEGICQSPCIAGDVGQHNCLCTMHK  468



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  270  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  328

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  329  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAG  388

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI  RS
Sbjct  389  ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIDNRS  448

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WYE G  +PPC+A D+G  NC C  HK
Sbjct  449  TWYEDGKRQPPCIAADIGSENCVCAAHK  476



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI+ L
Sbjct  267  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIDVL  325

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  326  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAG  385

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DEEFVRRWQLAC+ N++HVVVMPSVT+EKLD FL+EL++ RS
Sbjct  386  ISAMLNELSSTVVFERPLDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDDFLNELVEKRS  445

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY  G  +PPC+A DVG  NC C LHK
Sbjct  446  IWYRDGGVQPPCIAADVGCENCACALHK  473



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   338 bits (867),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  257  FYIHCDGALFGLMLPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  315

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNA+YLKD+LR AG
Sbjct  316  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAG  375

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DE+FVRRWQLAC+ N++HVVVMPSVT+EKLD F++EL++ RS
Sbjct  376  ISAMLNELSSTVVFERPIDEDFVRRWQLACQGNIAHVVVMPSVTIEKLDDFVNELVEKRS  435

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+   ++PPC+A DVG  NC C LHK
Sbjct  436  TWYQDEKARPPCIAADVGSQNCSCDLHK  463



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   339 bits (869),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI+ L
Sbjct  267  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIDVL  325

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  326  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAG  385

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DEEFVRRWQLAC+ N++HVVVMPSVT+EKLD FL+EL++ RS
Sbjct  386  ISAMLNELSSTVVFERPLDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDDFLNELVEKRS  445

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY  G  +PPC+A DVG  NC C LHK
Sbjct  446  TWYRDGGVQPPCIAADVGCENCACALHK  473



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   338 bits (867),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  265  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  323

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQK+VQKCLRNAHYLK +LR AG
Sbjct  324  SKNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKDVQKCLRNAHYLKGRLRDAG  383

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVV ERPKDEEFVRRWQLAC+ N++HVVVMPSVT+EKLD FLDEL++ RS
Sbjct  384  ISAMLNELSSTVVLERPKDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDNFLDELVKKRS  443

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY+ G  + PC+A DVG  NC C LH
Sbjct  444  TWYQDGQVQSPCIAADVGSENCACALH  470



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  272  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AG
Sbjct  331  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS
Sbjct  391  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRS  450

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN +PPC+A ++G +NC C LHK
Sbjct  451  TWYQ-GNVQPPCIAAEIGKANCVCALHK  477



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AG
Sbjct  333  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN +PPC+A ++G +NC C LHK
Sbjct  453  TWYQ-GNVQPPCIAAEIGKANCVCALHK  479



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  273  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  331

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AG
Sbjct  332  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAG  391

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS
Sbjct  392  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRS  451

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN +PPC+A ++G +NC C LHK
Sbjct  452  TWYQ-GNVQPPCIAAEIGKANCVCALHK  478



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  281  FYIHCDGALFGLMLPFVKKAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINTL  339

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR  G
Sbjct  340  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVG  399

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DEEF+RRWQLAC+ N++HVVVMP++T++KL+ FLDEL++ RS
Sbjct  400  ISAMLNELSSTVVFERPLDEEFIRRWQLACQGNIAHVVVMPNITIDKLESFLDELVEKRS  459

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G +KPPC+A D+G  NC C +HK
Sbjct  460  TWFKDGTNKPPCVASDIGQENCVCPMHK  487



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 180/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  273  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  331

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AG
Sbjct  332  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAG  391

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE N++HVVVMP+VT+EKLD FL+EL++ RS
Sbjct  392  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGNIAHVVVMPNVTIEKLDFFLNELVEKRS  451

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN +PPC+A ++G +NC C LHK
Sbjct  452  TWYQ-GNVQPPCIAAEIGKANCVCALHK  478



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  281  FYIHCDGALFGLMLPFVKKAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINTL  339

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR  G
Sbjct  340  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVG  399

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DEEF+RRWQLAC+ N++HVVVMP++T++KL+ FLDEL++ RS
Sbjct  400  ISAMLNELSSTVVFERPLDEEFIRRWQLACQGNIAHVVVMPNITIDKLESFLDELVEKRS  459

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+  G +KPPC+A D+G  NC C +HK
Sbjct  460  TWFRDGTNKPPCVASDIGQENCVCPMHK  487



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYKGFQKEVQKCLRNAHYLKDRLRDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSV ++KLD FL+EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVNIDKLDDFLNELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY     +PPC+A DVG  NC C  HK
Sbjct  453  TWYNDEKVQPPCIAADVGTENCACGQHK  480



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINAL
Sbjct  221  FYIHCDGALFGLMMPFVKKA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLRHINAL  279

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGF+KEVQKCLRNAHYL  +LR AG
Sbjct  280  SRDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFRKEVQKCLRNAHYLNHRLREAG  339

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLACE +M+HVVVMP+VTV KLD FLDELI++RS
Sbjct  340  ISAMLNELSSTVVFERPRDEEFVRRWQLACEGSMAHVVVMPNVTVGKLDQFLDELIESRS  399

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G  +PPCLA D+G  NC C LHK
Sbjct  400  VWYEDG-VEPPCLAADIGTENCSCPLHK  426



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINAL
Sbjct  232  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINAL  290

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  291  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAG  350

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP D+EFVRRWQLAC+ N++HVVVMP+VT+EKLD FLDELI+ R+
Sbjct  351  ISAMLNELSSTVVFERPVDDEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRN  410

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+     +PPC+A D+G  NC C LHK
Sbjct  411  TWFLDKKVQPPCVAADIGSENCLCDLHK  438



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  257  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  315

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNA+YLKD+LR AG
Sbjct  316  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAG  375

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP DE+FVRRWQLAC+ N++HVVVMPSVT+EKLD F++EL++ RS
Sbjct  376  ISAMLNELSSTVVFERPIDEDFVRRWQLACQGNIAHVVVMPSVTIEKLDDFVNELVEKRS  435

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A D+G  NC C LHK
Sbjct  436  TWYQDEKVRPPCIAADIGSQNCSCDLHK  463



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   337 bits (865),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 178/208 (86%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI AL
Sbjct  284  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKAL  342

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  343  SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRKAG  402

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSVT+EKLD FLDEL++ RS
Sbjct  403  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDYFLDELVEQRS  462

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G S+  C+A DVGV NC C  HK
Sbjct  463  VWYKDG-SQALCIASDVGVENCICPAHK  489



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HIN L
Sbjct  338  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVL  396

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  397  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAG  456

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ N++HVVVMP+VT++KLD FL+ELI  RS
Sbjct  457  ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIDNRS  516

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WYE G  +PPC+A D+G  NC C  HK
Sbjct  517  TWYEDGKRQPPCIAADIGSENCVCAAHK  544



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   337 bits (865),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 179/208 (86%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  284  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  342

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  343  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  402

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RS
Sbjct  403  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVEHRS  462

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G S+PPCLA+DVG +NC C  HK
Sbjct  463  VWYEDG-SQPPCLAKDVGTNNCICPTHK  489



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   337 bits (864),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HIN L
Sbjct  272  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINVL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKC+RNAHYLKD+L+ AG
Sbjct  331  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCVRNAHYLKDRLKEAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKD+EFVRRWQLACE N++HVVVMP+V ++KLD FL+EL Q RS
Sbjct  391  IGAMLNELSSTVVFERPKDDEFVRRWQLACEGNIAHVVVMPNVNIDKLDSFLEELFQKRS  450

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G   PPC+A D+G  NC CVLHK
Sbjct  451  CWYQDGKMPPPCIAADIGQDNCFCVLHK  478



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINAL
Sbjct  276  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINAL  334

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  335  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAG  394

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP D+EFVRRWQLAC+ N++HVVVMP+VT+EKLD FLDELI+ R+
Sbjct  395  ISAMLNELSSTVVFERPVDDEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRN  454

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+     +PPC+A D+G  NC C LHK
Sbjct  455  TWFLDKKVQPPCVAADIGSENCLCDLHK  482



>ref|XP_004140972.1| PREDICTED: serine decarboxylase isoform X2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   336 bits (862),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L   G
Sbjct  333  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEF+RRWQLACE N++HVVVMPSV+ EKLD FL +L++ RS
Sbjct  393  ISAMLNELSSTVVFERPRDEEFIRRWQLACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+G N +PPC+A ++G  +C C LH+
Sbjct  453  TWYDGENVQPPCVAAELGNESCACKLHR  480



>ref|XP_011656638.1| PREDICTED: serine decarboxylase isoform X1 [Cucumis sativus]
 ref|XP_011656639.1| PREDICTED: serine decarboxylase isoform X1 [Cucumis sativus]
Length=486

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  279  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L   G
Sbjct  338  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEF+RRWQLACE N++HVVVMPSV+ EKLD FL +L++ RS
Sbjct  398  ISAMLNELSSTVVFERPRDEEFIRRWQLACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRS  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+G N +PPC+A ++G  +C C LH+
Sbjct  458  TWYDGENVQPPCVAAELGNESCACKLHR  485



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   336 bits (862),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR  HIN L
Sbjct  272  FYIHCDGALFGLMMPFVKRA-PKVTFTKPIGSVSVSGHKFVGCPMPCGVQITRSKHINVL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  331  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELSSTVVFERPKDEEFVR+WQLACE N++HVVVMP+VT++KLD FL+EL++ RS
Sbjct  391  ISVMLNELSSTVVFERPKDEEFVRQWQLACEGNIAHVVVMPNVTIDKLDSFLNELLRHRS  450

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN  PPC+A D+G  NCCC LH+
Sbjct  451  CWYQEGNISPPCIAADIGEENCCCALHR  478



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYKGFQKEVQKCLRNAHYLKDRLRDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSV ++KLD FL+EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVNIDKLDDFLNELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A DVG  NC C  H+
Sbjct  453  TWYKDEKVQPPCIAVDVGTENCACGQHQ  480



>gb|AFK28264.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28265.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28266.1| putative serine decarboxylase, partial [Helianthus paradoxus]
Length=239

 Score =   327 bits (839),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 176/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L GAG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTGAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NAL
Sbjct  259  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNAL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AG
Sbjct  318  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DE+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS
Sbjct  378  IGAMLNELSSTVVFERPRDEDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRS  437

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A D+G  NC C LHK
Sbjct  438  TWYQ--EKQPPCIAADIGKENCACPLHK  463



>gb|AFK28277.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   327 bits (837),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 175/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ RS
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRS  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINAL
Sbjct  267  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINAL  325

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  326  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAG  385

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP D+EFVRRWQLAC+ N++HVVVMP+VT+EKLD FLD LI+ R+
Sbjct  386  ISAMLNELSSTVVFERPXDDEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDXLIEKRN  445

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+     +PPC+A D+G  NC C LHK
Sbjct  446  TWFLDKKVQPPCVAADIGSENCLCDLHK  473



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NAL
Sbjct  272  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNAL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AG
Sbjct  331  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DE+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS
Sbjct  391  IGAMLNELSSTVVFERPRDEDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRS  450

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A D+G  NC C LHK
Sbjct  451  TWYQ--EQQPPCIAADIGKENCACPLHK  476



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  279  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  338  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEF+RRWQLACE +++HVVVMPSV+ EKLD FL EL++ RS
Sbjct  398  ISAMLNELSSTVVFERPRDEEFIRRWQLACEGSIAHVVVMPSVSQEKLDDFLAELVEKRS  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+  N +PPC+A ++G  +C C LH+
Sbjct  458  TWYDDENVQPPCVAAELGNESCACKLHR  485



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NAL
Sbjct  271  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNAL  329

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AG
Sbjct  330  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAG  389

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DE+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS
Sbjct  390  IGAMLNELSSTVVFERPRDEDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRS  449

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A D+G  NC C LHK
Sbjct  450  TWYQ--EKQPPCIAADIGKENCACPLHK  475



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++H+NAL
Sbjct  272  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHVNAL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GF KEVQKCLRNAHYLKD+LR AG
Sbjct  331  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DE+FVRRWQLACE N++HVVVMPSV++EKLD FL+EL++ RS
Sbjct  391  IGAMLNELSSTVVFERPRDEDFVRRWQLACEGNIAHVVVMPSVSIEKLDVFLNELVKNRS  450

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A D+G  NC C LHK
Sbjct  451  TWYQ--EKQPPCIAADIGKENCACPLHK  476



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQLTRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  333  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEF+RRWQLACE +++HVVVMPSV+ EKLD FL EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPRDEEFIRRWQLACEGSIAHVVVMPSVSQEKLDDFLAELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+  N +PPC+A ++G  +C C LH+
Sbjct  453  TWYDDENVQPPCVAAELGNESCACKLHR  480



>gb|AFK28270.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 175/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28256.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 175/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28253.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28255.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28258.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28259.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28263.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28268.1| putative serine decarboxylase, partial [Helianthus deserticola]
 gb|AFK28274.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28275.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28276.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28278.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28280.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28284.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28285.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28286.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28288.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28289.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28290.1| putative serine decarboxylase, partial [Helianthus neglectus]
Length=239

 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 175/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HI  L
Sbjct  268  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHIKVL  326

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  327  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKAAG  386

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +SAMLNELSSTVVFERPKD EFVRRWQLACE N++HVVVMP+VTVEKLD FL+ELIQ RS
Sbjct  387  VSAMLNELSSTVVFERPKDGEFVRRWQLACEGNIAHVVVMPNVTVEKLDTFLNELIQNRS  446

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
              YE GN   PC+A D+G  NC C LH+
Sbjct  447  SCYEDGNIPFPCIAADIGDENCLCSLHQ  474



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   333 bits (854),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 178/209 (85%), Gaps = 2/209 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  259  FYIHCDGALFGLMMPFVKKA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AG
Sbjct  318  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLREAG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE +++HVVVMP+VT++KLD FL+EL + R+
Sbjct  378  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGSIAHVVVMPNVTIDKLDYFLNELREKRA  437

Query  306  VWYE-GGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GG  + PC+A DVG  +C C LHK
Sbjct  438  TWYQDGGMCQAPCIARDVGQDSCLCSLHK  466



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   333 bits (855),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  277  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  336  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R 
Sbjct  396  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRL  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WYE G S+PPCLA +VG +NC C  HK
Sbjct  456  IWYEDG-SQPPCLASEVGTNNCICPAHK  482



>gb|AFK28281.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28282.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28283.1| putative serine decarboxylase, partial [Helianthus debilis]
Length=239

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R 
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRG  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28261.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 176/209 (84%), Gaps = 10/209 (5%)
 Frame = -2

Query  846  FYIHCDGA---PLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHI  676
            FYIHCDGA   P+  +         K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HI
Sbjct  38   FYIHCDGALFGPMMPFAP-------KVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHI  90

Query  675  NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLR  496
            NALS NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L 
Sbjct  91   NALSRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLT  150

Query  495  GAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQ  316
             AGI AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HV VMP++T++KLD F++ELI+
Sbjct  151  SAGIGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVAVMPNITIDKLDDFVNELIE  210

Query  315  ARSVWYEGGNSKPPCLAEDVGVSNCCCVL  229
             R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  211  KRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28271.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R 
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRV  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28260.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA           V     FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALFGLMMPFAPRV----SFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY  G  KPPC+A D+G +NC C L
Sbjct  214  VWYRDGKRKPPCVASDIGRANCLCEL  239



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL++INAL
Sbjct  200  FYIHCDGALFGLMIPFVKKAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYINAL  258

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  259  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  318

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDE FVRRWQLACE N+ HVVVMPSV ++KLD FL+EL++ R+
Sbjct  319  IGAMLNELSSTVVFERPKDEVFVRRWQLACEGNICHVVVMPSVNIDKLDYFLNELVEKRA  378

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G S+PPC+A  VG  NC C  HK
Sbjct  379  TWYQDGISQPPCIARVVGFENCLCGRHK  406



>gb|AFK28262.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRD TIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDTTIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28257.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++E I+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNEFIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  262  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  320

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  321  SNNVEYLASRDATIMGSRNGHAPLFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAG  380

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RS
Sbjct  381  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRS  440

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G S+PPCL +DVG+ NC C  HK
Sbjct  441  VWYEDG-SQPPCLVKDVGIKNCICPAHK  467



>gb|AFK28273.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI  R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIGKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  272  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  331  SNNVEYLASRDATIMGSRNGHAPLFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RS
Sbjct  391  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENRS  450

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G S+PPCL +DVG+ NC C  HK
Sbjct  451  VWYEDG-SQPPCLVKDVGIKNCICPAHK  477



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  285  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  343

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  344  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  403

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPK+EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R 
Sbjct  404  ISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRL  463

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G SKPPCL +DVG++NC C  HK
Sbjct  464  VWYEDG-SKPPCLVKDVGINNCICPAHK  490



>gb|AFK28254.1| putative serine decarboxylase, partial [Helianthus argophyllus]
Length=239

 Score =   323 bits (829),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N EYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNXEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28287.1| putative serine decarboxylase, partial [Helianthus bolanderi]
Length=239

 Score =   323 bits (829),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 175/206 (85%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVV+P++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVVPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  276  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  334

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  335  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  394

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD F+ +L++ RS
Sbjct  395  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRS  454

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G ++PPCL  +VG +NC C  HK
Sbjct  455  VWYEDG-TQPPCLVSEVGTNNCLCPAHK  481



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  280  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  338

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  339  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  398

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD F+ +L++ RS
Sbjct  399  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRS  458

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G ++PPCL  +VG +NC C  HK
Sbjct  459  VWYEDG-TQPPCLVSEVGTNNCICPAHK  485



>gb|AFK28279.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 174/205 (85%), Gaps = 4/205 (2%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINALS
Sbjct  39   YIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINALS  94

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
             NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI
Sbjct  95   RNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGI  154

Query  483  SAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSV  304
             AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+V
Sbjct  155  GAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRAV  214

Query  303  WYEGGNSKPPCLAEDVGVSNCCCVL  229
            WY+ G  KPPC+A D+G +NC C L
Sbjct  215  WYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  293  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  351

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTL++KGYKGFQKEVQKCLRNAHYLKD+LRGAG
Sbjct  352  SRNVEYLASRDATIMGSRNGHAPLFLWYTLSQKGYKGFQKEVQKCLRNAHYLKDRLRGAG  411

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSV++ KLD FL+EL++ RS
Sbjct  412  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVSIGKLDSFLNELVEQRS  471

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+   S+PPC+A DVG  NC C  HK
Sbjct  472  LWYK-DESQPPCVASDVGTENCICPTHK  498



>gb|AFK28267.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++K D F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKSDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   332 bits (850),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q   FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL++INAL
Sbjct  283  FYIHCDGALFGLMIPFVKKAPQ-VTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYINAL  341

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG
Sbjct  342  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAG  401

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDE FVRRWQLACE N+ HVVVMPSV ++KLD FL+EL++ R+
Sbjct  402  IGAMLNELSSTVVFERPKDEVFVRRWQLACEGNICHVVVMPSVNIDKLDYFLNELVEKRA  461

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G S+PPC+A  VG  NC C  HK
Sbjct  462  TWYQDGISQPPCIARVVGFENCLCGRHK  489



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  284  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  342

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  343  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  402

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPK+EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R 
Sbjct  403  ISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRL  462

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G S+PPCL +DVG++NC C  HK
Sbjct  463  VWYEDG-SQPPCLVKDVGINNCICPAHK  489



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   331 bits (849),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  285  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  343

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  344  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  403

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPK+EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R 
Sbjct  404  ISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRL  463

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G S+PPCL +DVG++NC C  HK
Sbjct  464  VWYEDG-SQPPCLVKDVGINNCICPAHK  490



>gb|AFK28272.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   322 bits (826),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQTTRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I A LNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGATLNELSSTVVFERPQDEEFTRKWQLACQGNITHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  257  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  315

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AG
Sbjct  316  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCEAG  375

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ RS
Sbjct  376  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRS  435

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G S+PPCLA +VG +NC C  HK
Sbjct  436  VWYEDG-SQPPCLASEVGTNNCICPTHK  462



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   333 bits (853),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  337  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  395

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLR AG
Sbjct  396  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLREAG  455

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R 
Sbjct  456  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDDFLKDLVKHRL  515

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G ++PPCLA +VG +NC C  HK
Sbjct  516  VWYEDG-TQPPCLASEVGTNNCICPAHK  542



>gb|AFK28291.1| putative serine decarboxylase, partial [Helianthus niveus]
Length=239

 Score =   322 bits (826),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I A LNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T+++LD F++ELI+ R+
Sbjct  154  IGATLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDRLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPPC+A D+G +NC C L
Sbjct  214  VWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  285  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  343

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  344  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  403

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R 
Sbjct  404  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRL  463

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G ++PPCL  +VG +NC C  HK
Sbjct  464  VWYEDG-TQPPCLVSEVGTNNCICPAHK  490



>gb|AFK28269.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 174/206 (84%), Gaps = 4/206 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVL  229
            VWY+ G  KPP +A D+G +NC C L
Sbjct  214  VWYKDGKRKPPRVASDIGQANCLCEL  239



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  285  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  343

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  344  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAG  403

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPK+EEFVRRWQLAC+ +++HVVVMPSVTVEKLD FL +L++ R 
Sbjct  404  ISAMLNELSSTVVFERPKEEEFVRRWQLACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRL  463

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWYE G  KPPCL +DVG++NC C  HK
Sbjct  464  VWYEDG-CKPPCLVKDVGINNCICPAHK  490



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR AG
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSV +EKLD FL EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVNIEKLDDFLSELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A DVG  NC C  HK
Sbjct  453  TWYD-EKVQPPCIAADVGTENCSCGQHK  479



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR AG
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSV +EKLD FL EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVNIEKLDDFLSELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPC+A DVG  NC C  HK
Sbjct  453  TWYD-EKVQPPCIAADVGTENCSCGQHK  479



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   328 bits (841),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 175/209 (84%), Gaps = 1/209 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQ-KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
            FYIHCDGA         +     K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  
Sbjct  262  FYIHCDGALFGLMMPFVKRASAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKV  321

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            LS+NVEYLASRDATIMGSRNGHAP+FLWYTL+RKGYKGFQKEVQKCLRNAHYLKD+LR A
Sbjct  322  LSNNVEYLASRDATIMGSRNGHAPLFLWYTLSRKGYKGFQKEVQKCLRNAHYLKDRLREA  381

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GISAMLNELSSTVVFERP+DEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L++ R
Sbjct  382  GISAMLNELSSTVVFERPRDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDHFLKDLVENR  441

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            SVWYE   S+ PCL +DVG+ NC C  HK
Sbjct  442  SVWYEEYGSQLPCLVKDVGIKNCICPAHK  470



>ref|XP_006854520.1| PREDICTED: serine decarboxylase 1 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   328 bits (842),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 172/207 (83%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRLDHINAL
Sbjct  282  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLDHINAL  340

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLKD LR  G
Sbjct  341  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDCLRSEG  400

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERP+DEEFVRRWQLAC+ N++H VVMP++T+EKLD F+ EL   RS
Sbjct  401  ISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHAVVMPNITIEKLDDFVKELTAKRS  460

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             W++ G ++ PC+A+++G  NC C  H
Sbjct  461  TWFKDGKAQAPCIADEIGAENCACARH  487



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+        +  K  FKKPIGSVSVSGHK VGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGA-LFGLMMPFVKLAPKVSFKKPIGSVSVSGHKLVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR A 
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYTGFQKEVQKCLRNAHYLKGRLRDAR  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVR+WQLAC+ N++HVVVMPSV++EKLD FL+EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRKWQLACQGNIAHVVVMPSVSIEKLDNFLNELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+  N +PPCLA DVG  NC C  HK
Sbjct  453  TWYD-ENVQPPCLAADVGTENCSCRQHK  479



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 175/208 (84%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+        +  K  FKKPIGSVSVSGHK VGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGA-LFGLMMPFVKLAPKVSFKKPIGSVSVSGHKLVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK  LR AG
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYTGFQKEVQKCLRNAHYLKGHLRDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVR+WQLAC+ N++HVVVMPSV++EKLD FL+EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRKWQLACQGNIAHVVVMPSVSIEKLDNFLNELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    +PPCLA DVG  NC C  HK
Sbjct  453  TWYD-EKVQPPCLAADVGTENCSCRQHK  479



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 175/208 (84%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  267  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  325

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  326  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  385

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+  ++HVVVMPSVT+EKLD FL +L++ RS
Sbjct  386  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGEIAHVVVMPSVTIEKLDHFLKDLVEHRS  445

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +W + G S+ PCLA+DVG +NC C  HK
Sbjct  446  IWCKDG-SQTPCLAKDVGTNNCVCPAHK  472



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 173/208 (83%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  274  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLN+KGY GFQKEVQKCLRNAHYLK +LR AG
Sbjct  333  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ N++HVVVMPSV +EKLD FL+EL++ RS
Sbjct  393  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVNIEKLDDFLNELVEKRS  452

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+    + PC+A DVG  NC C  HK
Sbjct  453  TWYD-EKVQAPCIAADVGTENCSCGQHK  479



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 174/208 (84%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR++HI  L
Sbjct  284  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVL  342

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+L  +G
Sbjct  343  SNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCESG  402

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT+EKLD FL +L+Q RS
Sbjct  403  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDSFLKDLVQHRS  462

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY  G S+PPCL  +VG  NC C  HK
Sbjct  463  VWYADG-SQPPCLVSEVGTHNCICPAHK  489



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 173/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HIN L
Sbjct  251  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINCL  309

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GFQKEVQKCL+NAHYLKD+LR AG
Sbjct  310  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYGGFQKEVQKCLKNAHYLKDRLREAG  369

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP++EEFVR+WQLAC+ N++HV+VMP++T+EKLD FL EL+Q R+
Sbjct  370  IGAMLNELSSTVVFERPQEEEFVRKWQLACQGNIAHVIVMPNITIEKLDDFLSELLQHRA  429

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G  + PC+A DVG  NC C  HK
Sbjct  430  KWFQDGKLQAPCIASDVGTENCLCASHK  457



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRLD++NAL
Sbjct  277  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLDYVNAL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  336  SRDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+RRWQLAC+ N++HVVVMP++T+EKLD FL+EL++ R+
Sbjct  396  IGAMLNELSSTVVFERPHDEEFIRRWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRT  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G  +P C++ DVG  NC C LHK
Sbjct  456  TWFQDGKDQPYCISADVGEKNCLCALHK  483



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  279  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  338  SQNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+RRWQLAC+ N++HVVVMP+VT++KLD FL+EL + R+
Sbjct  398  IGAMLNELSSTVVFERPHDEEFIRRWQLACKGNIAHVVVMPNVTIQKLDDFLNELKEKRA  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+E G  +P C+A DVG ++C C LHK
Sbjct  458  AWFEDGKYQPYCIASDVGENHCLCALHK  485



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   326 bits (835),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGSVSVSGHKFVGCPMPCGVQ+TR+ HI  L
Sbjct  267  FYIHCDGALFGLMMPFVKRA-PKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVL  325

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AG
Sbjct  326  SSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAG  385

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELSSTVVFERPKDEEFVRRWQLAC+ +++HVVVMPSVT++KLD FL +L++ RS
Sbjct  386  ISAMLNELSSTVVFERPKDEEFVRRWQLACQGDIAHVVVMPSVTIKKLDHFLKDLVEHRS  445

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +W + G S+ PCLA+DVG +NC C  HK
Sbjct  446  IWCKDG-SQTPCLAKDVGTNNCVCPAHK  472



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HIN L
Sbjct  251  FYIHCDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINCL  309

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY GFQKEVQKCL NAHYLKD+LR AG
Sbjct  310  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYGGFQKEVQKCLENAHYLKDRLREAG  369

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP++EEFVR+WQLAC+ N++HV+VMP++T+EKLD FL EL+Q R+
Sbjct  370  IGAMLNELSSTVVFERPQEEEFVRKWQLACQGNIAHVIVMPNITIEKLDDFLSELLQHRA  429

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G  + PC+A DVG  NC C  HK
Sbjct  430  KWFQDGKLQAPCIASDVGTENCLCASHK  457



>gb|AFK39410.1| unknown [Medicago truncatula]
Length=320

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  114  FYIHVDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  172

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVE LASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  173  SRNVECLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAG  232

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  233  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRA  292

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+E G  +P C+A DVG ++C C  HK
Sbjct  293  TWFEDGTFQPYCIASDVGENSCLCAQHK  320



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 173/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  280  FYIHVDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  338

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  339  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAG  398

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  399  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRA  458

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+E G  +P C+A DVG ++C C  HK
Sbjct  459  TWFEDGTFQPYCIASDVGENSCLCAQHK  486



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA              K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINAL
Sbjct  266  FYIHCDGALFGLMLPFVTRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLKHINAL  324

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            +SNVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GF+KEVQKCLRNAHYL+D+L  AG
Sbjct  325  ASNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFRKEVQKCLRNAHYLRDRLMAAG  384

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            + AMLN LSSTVVFERPKDE FVRRWQLACE N++HVVVMPSVT+EKLD FLDEL+  RS
Sbjct  385  VGAMLNPLSSTVVFERPKDEGFVRRWQLACEGNIAHVVVMPSVTIEKLDDFLDELVAGRS  444

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY   +   PC+A ++G  NC C +HK
Sbjct  445  AWYRDRSRPSPCIAAEIGQENCHCSMHK  472



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 172/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGS SVSGHKFVGCPMPCGV++TRL+HINAL
Sbjct  279  FYIHCDGALFGLMMPFIKRA-PKVSFKKPIGSASVSGHKFVGCPMPCGVEITRLEHINAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGH PIFLWYTLN+KGYKGFQKEVQKCL NA YLKD+LR AG
Sbjct  338  SRNVEYLASRDATIMGSRNGHTPIFLWYTLNQKGYKGFQKEVQKCLSNAFYLKDRLRAAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            + AMLNE SSTVVFERP+DEEFVRRW LAC+ +++HVVVMP+VT+EKLD F+DEL+Q RS
Sbjct  398  VGAMLNEFSSTVVFERPQDEEFVRRWHLACQGDIAHVVVMPNVTIEKLDVFVDELMQKRS  457

Query  306  VWYEGGNS-KPPCLAEDVGVSNCCCVLHK  223
             W+  G   +PPC+A DVG  NC C+LHK
Sbjct  458  AWFRNGRILQPPCIAADVGNENCACILHK  486



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NAL
Sbjct  252  FYIHCDGALFGLMLPFVKRA-PKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  310

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  311  SRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAG  370

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DE FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  371  IGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRA  430

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VW+  GN +P C+A DVG  NC C LH+
Sbjct  431  VWFRDGNCQPYCIASDVGQENCLCALHR  458



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NAL
Sbjct  262  FYIHCDGALFGLMLPFVKRA-PKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  320

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  321  SRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAG  380

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DE FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  381  IGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRA  440

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VW+  GN +P C+A DVG  NC C LH+
Sbjct  441  VWFRDGNCQPYCIASDVGQENCLCALHR  468



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NAL
Sbjct  279  FYIHCDGALFGLMLPFVKRA-PKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  338  SRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DE FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  398  IGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRA  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VW+  GN +P C+A DVG  NC C LH+
Sbjct  458  VWFRDGNCQPYCIASDVGQENCLCALHR  485



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NAL
Sbjct  279  FYIHCDGALFGLMLPFVKRA-PKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  338  SRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DE FV +WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  398  IGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHVVVMPNVTIEKLDDFLNELVQKRA  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VW+  GN +P C+A DVG  NC C LH+
Sbjct  458  VWFRDGNCQPYCIASDVGQENCLCALHR  485



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  280  FYIHVDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  338

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVE LASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  339  SRNVECLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAG  398

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  399  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRA  458

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+E G  +P C+A DVG ++C C  HK
Sbjct  459  TWFEDGTFQPYCIASDVGENSCLCAQHK  486



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+        +  K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+++NAL
Sbjct  279  FYIHCDGA-LFGLMMPFVKLAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYVNAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            + +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AG
Sbjct  338  ARDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP++T+EKLD FL+EL+  R+
Sbjct  398  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNITIEKLDDFLNELLDKRA  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G  +P C++ DVG  NC C LHK
Sbjct  458  TWFQDGKDQPYCISSDVGEKNCLCALHK  485



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 173/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKP+GSVSVSGHKFVGCPMPCGVQ+TRL+++NAL
Sbjct  277  FYIHCDGALFGLMMPFVKRA-PKVTFKKPVGSVSVSGHKFVGCPMPCGVQITRLEYVNAL  335

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            + +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AG
Sbjct  336  ARDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAG  395

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP++T+EKLD FL+EL++ R+
Sbjct  396  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRA  455

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G  +P C++ DVG  NC C LHK
Sbjct  456  TWFQDGKDQPYCISSDVGEKNCLCALHK  483



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   318 bits (816),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 173/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKP+GSVSVSGHKFVGCPMPCGVQ+TRL+++NAL
Sbjct  279  FYIHCDGALFGLMMPFVKRA-PKVTFKKPVGSVSVSGHKFVGCPMPCGVQITRLEYVNAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            + +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AG
Sbjct  338  ARDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP++T+EKLD FL+EL++ R+
Sbjct  398  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNITIEKLDDFLNELLEKRA  457

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G  +P C++ DVG  NC C LHK
Sbjct  458  TWFQDGKDQPYCISSDVGEKNCLCALHK  485



>gb|AFA36595.1| putative serine decarboxylase, partial [Lolium perenne]
Length=245

 Score =   306 bits (785),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL HINAL
Sbjct  65   FYIHCDGALFGLMIPFVKKA-AKVTFKKPIGSVSVSGHKFVGCPMPCGVQVTRLKHINAL  123

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SSNVEYLASRDATIMGSRNGHAPIFLWYTLN+KGY+GFQKEVQKCLRNAHYLKD+L  AG
Sbjct  124  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNQKGYRGFQKEVQKCLRNAHYLKDRLNAAG  183

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERPKDEEFVRRWQLACE N++HVVVMPSV ++KLD FL EL++ R+
Sbjct  184  IGAMLNELSSTVVFERPKDEEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLRELVEKRA  243

Query  306  VW  301
            VW
Sbjct  244  VW  245



>gb|AFK28252.1| putative serine decarboxylase, partial [Helianthus agrestis]
Length=223

 Score =   304 bits (779),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 163/190 (86%), Gaps = 4/190 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       +      K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HINAL
Sbjct  38   FYIHCDGALF----GLMMPFAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINAL  93

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AG
Sbjct  94   SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAG  153

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP+DEEF R+WQLAC+ N++HVVVMP++T++KLD F++ELI+ R+
Sbjct  154  IGAMLNELSSTVVFERPQDEEFTRKWQLACQGNIAHVVVMPNITIDKLDDFVNELIEKRA  213

Query  306  VWYEGGNSKP  277
            VWY+ G  KP
Sbjct  214  VWYKDGKHKP  223



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    K  FKKPIGSVSVSGHKF+GCPMPCGVQ TR+ HIN+L
Sbjct  214  FYIHVDGALFGLMMPFVKKA-PKVTFKKPIGSVSVSGHKFIGCPMPCGVQFTRMKHINSL  272

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQK+VQ+CLRNAHYLK++LR A 
Sbjct  273  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKDVQRCLRNAHYLKERLREAK  332

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I  MLNELSSTVVFERP DE F+ +WQLAC+  ++H VVMPSVTVEKLD F++ELI+ R 
Sbjct  333  IGVMLNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVEKLDNFVEELIEVRK  392

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CNNNP  205
              +  GN K PC+ E+VGV NC C LH+     P
Sbjct  393  RSFPEGNVKIPCIVEEVGVQNCACSLHRGAGTIP  426



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCG+Q+TR++HIN L
Sbjct  263  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGIQITRIEHINTL  321

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GF+KEV+KCL NAHYL   LR +G
Sbjct  322  SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESG  381

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
              AMLNELSSTVVFERP+DE FVR+WQLAC+  ++H VVMPSVTV+KL  FL ELI++RS
Sbjct  382  FGAMLNELSSTVVFERPQDEAFVRKWQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRS  441

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  214
              +  G    PC+AE++G  NC CV H  C+
Sbjct  442  RLFPDGKIVAPCVAEELGAKNCACVKHSSCS  472



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 166/211 (79%), Gaps = 1/211 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCG+Q+TR++HIN L
Sbjct  263  FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGIQITRIEHINTL  321

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAP+FLWYTLNRKGY+GF+KEV+KCL NAHYL   LR +G
Sbjct  322  SRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESG  381

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
              AMLNELSSTVVFERP+DE FVR+WQLAC+  ++H VVMPSVTV+KL  FL ELI++RS
Sbjct  382  FGAMLNELSSTVVFERPQDEAFVRKWQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRS  441

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  214
              +  G    PC+A+++G  NC CV H  C+
Sbjct  442  RLFPDGKIVAPCVADELGAKNCACVKHSSCS  472



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 164/208 (79%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA              K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR+ HIN L
Sbjct  202  FYIHVDGALFGLMMPFVRRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMKHINVL  260

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQ+CLRNA+YLK++LR A 
Sbjct  261  SRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQRCLRNAYYLKERLREAN  320

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +  +LNELSSTVVFERP DE F+ +WQLAC+  ++H VVMPSVTVEKLD F++ELI+ R+
Sbjct  321  VGVLLNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVEKLDDFVEELIEVRN  380

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
              +  G+   PC+ E+VG  NC C +H+
Sbjct  381  RAFPDGDVVVPCIVEEVGPENCACSVHR  408



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         +   Q   FKKPIGSVSVSGHKF+GCPMPCGVQ+ R  HINAL
Sbjct  242  FYIHCDAALFGLMLPFLDKATQ-VTFKKPIGSVSVSGHKFLGCPMPCGVQIVRKKHINAL  300

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N+EY+AS+DATI GSRNGH PIFLWY LNRKGY G QK+VQ C+RNA YLK +L+  G
Sbjct  301  SRNIEYIASKDATITGSRNGHTPIFLWYALNRKGYHGLQKDVQMCMRNADYLKGRLKEFG  360

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +S MLN+LS+TVVFERP+DEEF+RRWQLACE N++HV+VMP VT+EKLD FL+EL++ R 
Sbjct  361  VSVMLNKLSNTVVFERPQDEEFIRRWQLACEGNIAHVIVMPHVTIEKLDTFLNELVEKRL  420

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             W++ G ++PPC+A ++G  NC C LH
Sbjct  421  TWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 163/207 (79%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         +   Q   FKKPIGSVSVSGHKF+GCPMPCGVQ+ R  HINAL
Sbjct  242  FYIHCDAALFGLMLPFLDKATQ-VTFKKPIGSVSVSGHKFLGCPMPCGVQIVRKKHINAL  300

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N+EY+AS+DATI GSRNGH PIFLWY LNRKGY G QK+VQ C+RNA YLK +L+  G
Sbjct  301  SRNIEYIASKDATITGSRNGHTPIFLWYALNRKGYHGLQKDVQMCMRNADYLKGRLKEFG  360

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +S MLN+LS+TVVFERP+DEEF+RRWQLACE N++HV+VMP VT+EKLD FL+EL++ R 
Sbjct  361  VSVMLNKLSNTVVFERPQDEEFIRRWQLACEGNIAHVIVMPHVTIEKLDTFLNELVEKRL  420

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             W++ G ++PPC+A ++G  NC C LH
Sbjct  421  TWFKDGGNQPPCVASELGKENCACPLH  447



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 169/207 (82%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKF+GCP+PCGV +TRL+H+  L
Sbjct  276  FYIHCDGALAGLMMPFIKQA-PKVTFKKPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVL  334

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+++EYL+SRDATIMGSRNGHAP+FLWYTLN+KGY+G +KEVQKCLRNAH+L ++LR AG
Sbjct  335  STDIEYLSSRDATIMGSRNGHAPMFLWYTLNKKGYRGIRKEVQKCLRNAHHLANRLREAG  394

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +SA LNELSSTVVFERP DE FV +WQLACE +++HVVVMP+V+VEKL+ F++ELI  R 
Sbjct  395  VSAYLNELSSTVVFERPHDEAFVHKWQLACEGSIAHVVVMPNVSVEKLNNFVEELIGERP  454

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             W+EGG  + PC+A+D+G  NC C +H
Sbjct  455  RWHEGGGFRVPCVAKDIGQENCLCGVH  481



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 168/215 (78%), Gaps = 1/215 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F+KPIGSVS+SGHKF+GCP+PCGV +TRL H+  L
Sbjct  269  FYIHCDGALAGLMMPFIKQA-PKVTFEKPIGSVSISGHKFMGCPVPCGVVITRLAHVKVL  327

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+++EYL+SRD TIMGSRNGHAPIFLWYTLN+KGY+GF+KEV+KCLRNAHYL ++LR  G
Sbjct  328  STDIEYLSSRDTTIMGSRNGHAPIFLWYTLNKKGYRGFRKEVRKCLRNAHYLANRLREEG  387

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +SA LN LSSTVVFERP+D  FV +WQLACE +++HVVVMP+V+VEKLD F++EL+  RS
Sbjct  388  VSASLNMLSSTVVFERPRDVAFVHKWQLACEGSIAHVVVMPNVSVEKLDGFVEELVANRS  447

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CNNNPE  202
             WY+G     PC+A+D+G  NC C LH   + N E
Sbjct  448  CWYDGKGHDIPCVAKDIGQDNCLCSLHNTKHKNVE  482



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  261  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  318  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  378  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRK  437

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  438  VWYQNGKTDPPCVGEDIGAQNCACSYHK  465



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  260  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  316

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  317  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVERCLDNAKYLKDRLQQAG  376

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  377  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELMQQRK  436

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  437  VWYQNGKTNPPCVGEDIGAQNCACSYHK  464



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN L
Sbjct  255  FYIHCDAA---LNGLIIPFIKNMISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG APIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  312  SRKVEYIASVDATISGSRNGLAPIFLWYSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T E LD F+++L+Q R 
Sbjct  372  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITREILDSFINDLLQQRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN  PPC+AED+G  NC C  HK
Sbjct  432  KWYKDGNVTPPCVAEDIGAQNCACSYHK  459



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  254  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  310

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+  G
Sbjct  311  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEG  370

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  371  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRK  430

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  431  VWYQNGKTYPPCVGEDIGAQNCACSYHK  458



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  261  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+  G
Sbjct  318  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  378  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRK  437

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  438  VWYQNGKTYPPCVGEDIGAQNCACSYHK  465



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN L
Sbjct  255  FYIHCDAA---LNGLIIPFIKNMISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG APIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  312  SRKVEYIASVDATISGSRNGLAPIFLWYSLSSKGQIGLQKDVKRCLDNAKYLKDRLQQAG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +S MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T E LD F+++L+Q R 
Sbjct  372  VSVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITREILDSFINDLLQQRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN  PPC+AED+G  NC C  HK
Sbjct  432  KWYKDGNVTPPCVAEDIGAQNCACSYHK  459



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  261  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG   IFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  318  STNVEYIASVDATISGSRNGLTLIFLWYSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  378  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFMSELVQQRK  437

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            VWY+ G + PPC+ ED+G  NC C  HK
Sbjct  438  VWYQNGKTNPPCVGEDIGAQNCACSYHK  465



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 160/207 (77%), Gaps = 5/207 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       +   + QKF FKKPIGSVS+SGHKF+GCPMPCGV +TR  +I+ +
Sbjct  256  FYIHCDAA---ISGFVVPFLKQKFTFKKPIGSVSISGHKFLGCPMPCGVLITRRRYIDLI  312

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N+EY+AS D TI GSRNGH+P+F+WY LN KG++G +++VQKCLRNA YL+ +L+ AG
Sbjct  313  SRNIEYIASFDTTIAGSRNGHSPVFMWYVLNLKGWRGLEQDVQKCLRNARYLRHRLKKAG  372

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS+MLNE+S TVVFERP D EFVR WQL C  NM+HVVVMP VTVE L+ FL +LI+ R+
Sbjct  373  ISSMLNEMSITVVFERPPDNEFVRHWQLQCLENMAHVVVMPHVTVEMLERFLSDLIRKRN  432

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY  G  +PPCLAED+G+ NC C +H
Sbjct  433  TWY--GKVQPPCLAEDIGICNCACPVH  457



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 160/207 (77%), Gaps = 3/207 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         + V QKF FKKPIGSVS+SGHKF+GCPMPCGV +TR  +I+ +
Sbjct  256  FYIHCDAAISGFVVPFLKQV-QKFTFKKPIGSVSISGHKFLGCPMPCGVLITRRRYIDLI  314

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N+EY+AS D TI GSRNGH+P+F+WY LN KG++G +++VQKCLRNA YL+ +L+ AG
Sbjct  315  SRNIEYIASFDTTIAGSRNGHSPVFMWYVLNLKGWRGLEQDVQKCLRNARYLRHRLKKAG  374

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS+MLNE+S TVVFERP D EFVR WQL C  NM+HVVVMP VTVE L+ FL +LI+ R+
Sbjct  375  ISSMLNEMSITVVFERPPDNEFVRHWQLQCLENMAHVVVMPHVTVEMLERFLSDLIRKRN  434

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY  G  +PPCLAED+G+ NC C +H
Sbjct  435  TWY--GKVQPPCLAEDIGICNCACPVH  459



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN L
Sbjct  250  FYIHCDAA---LNGLIIPFIKNMISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNL  306

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG APIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  307  SRKVEYIASVDATISGSRNGLAPIFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAG  366

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T + LD F+++L+Q R 
Sbjct  367  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITRDILDSFINDLLQQRK  426

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN  PPC+A+D+G  NC C  HK
Sbjct  427  KWYKDGNVTPPCVAQDIGAQNCACSYHK  454



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCG+Q+TR  +IN L
Sbjct  250  FYIHCDAA---LNGLIIPFIKNMISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYINNL  306

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG APIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  307  SRKVEYIASVDATISGSRNGLAPIFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAG  366

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T + LD F+++L+Q R 
Sbjct  367  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITRDILDSFINDLLQQRK  426

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ GN  PPC+A+D+G  NC C  HK
Sbjct  427  KWYKDGNVTPPCVAQDIGAQNCACSYHK  454



>gb|AES76141.2| serine decarboxylase [Medicago truncatula]
Length=261

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 155/208 (75%), Gaps = 14/208 (7%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    K  FKKPIGSVSVSGHKFVGCPMPCG+  T L      
Sbjct  68   FYIHVDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGMWNTLL------  120

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
                  L  R  +IMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNA+Y KD+L  AG
Sbjct  121  ------LGMR-LSIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAYYFKDRLIEAG  173

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  174  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRA  233

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+E G  +P C+A DVG ++C C  HK
Sbjct  234  TWFEDGTFQPYCIASDVGENSCLCAQHK  261



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  260  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  316

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V+KCL NA YLKD+L+ AG
Sbjct  317  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAG  376

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  377  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  436

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  437  QWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  260  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  316

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V+KCL NA YLKD+L+ AG
Sbjct  317  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAG  376

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  377  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  436

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  437  QWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  260  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  316

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V+KCL NA YLKD+L+ AG
Sbjct  317  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAG  376

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  377  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  436

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  437  QWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   274 bits (700),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  260  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  316

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V+KCL NA YLKD+L  AG
Sbjct  317  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLLQAG  376

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  377  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  436

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+A+D+G  NC C  HK
Sbjct  437  QWYKDGKAEAPCVADDIGAQNCACSYHK  464



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  250  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  306

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD L+ AG
Sbjct  307  STNVEYIASVDATISGSRNGLTPIFLWYSLSTKGQIGLQKDVKRCLDNAKYLKDGLQQAG  366

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNE+S  VV ERP D EFVRRWQL+C ++M+HVVVMP +T E LD F+ EL+Q R 
Sbjct  367  ISVMLNEISIIVVLERPHDHEFVRRWQLSCVKDMAHVVVMPGITREMLDNFISELVQQRK  426

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+GG ++ PC+A+D+G  NC C  HK
Sbjct  427  HWYQGGKAEAPCVADDIGTQNCACSYHK  454



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  273  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  329

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V+KCL NA YLKD+L+  G
Sbjct  330  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQEG  389

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  390  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  449

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+A+D+G  NC C  HK
Sbjct  450  QWYKDGKAEAPCVADDIGAQNCACSYHK  477



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  257  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  313

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  314  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAG  373

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  374  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  433

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  434  QWYKDGKAEAPCVGEDIGAQNCACSYHK  461



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  255  FYIHCDAA---LNGLIIPFIKNMITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG  PIFLWY+L+ KG  GFQK+V++C  NA YLKD+L+ AG
Sbjct  312  SRRVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGFQKDVKRCFDNAKYLKDRLQQAG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T E LD F+++L+Q R 
Sbjct  372  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITRETLDGFINDLLQQRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G   PPC+A D+G  NC C  HK
Sbjct  432  KWYQDGRISPPCVASDIGAQNCTCSYHK  459



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  255  FYIHCDAA---LNGLIIPFIKNMITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG  PIFLWY+L+ KG  GFQK+V++C  NA YLKD+L+ AG
Sbjct  312  SRRVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGFQKDVKRCFDNAKYLKDRLQQAG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T E LD F+ +L+Q R 
Sbjct  372  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITRETLDGFITDLLQQRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G   PPC+A D+G  NC C  HK
Sbjct  432  KWYQDGRISPPCVASDIGAQNCTCSYHK  459



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   ++    FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  246  FYIHCDAA---LCGLIVPFINNMISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  302

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  303  SRNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAG  362

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+++L+Q R 
Sbjct  363  ISVMLNELSIIVVLERPRDHEFVRRWQLSCMKDMAHVIVMPGITRETLDNFVNDLVQQRK  422

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+ G    PC+A+D+G  NC C  HK
Sbjct  423  LWYQHGRVTTPCIADDIGAQNCSCSYHK  450



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   272 bits (695),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  255  FYIHCDAA---LNGLIIPFIKNMITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG  PIFLWY+++ KG  GFQK+V++C  NA YLKD+L+ AG
Sbjct  312  SRRVEYIASVDATISGSRNGLTPIFLWYSISAKGQIGFQKDVKRCFDNAKYLKDRLQQAG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T E LD F+++L+Q R 
Sbjct  372  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITRETLDGFINDLLQQRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G   PPC+A D+G  NC C  HK
Sbjct  432  KWYQDGRISPPCVANDIGAQNCACSYHK  459



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  260  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  316

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+  G
Sbjct  317  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKRCLDNAKYLKDRLQKEG  376

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  377  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFISELVQQRK  436

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G ++ PC+ ED+G  NC C  HK
Sbjct  437  QWYKDGKAEAPCVGEDIGAQNCACSYHK  464



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  261  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLK++L+ AG
Sbjct  318  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQVGLQKDVKRCLDNAKYLKNRLQQAG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  378  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFVSELVQQRK  437

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY  G ++ PC+ ED+G  NC C  HK
Sbjct  438  QWYRDGKAEAPCVGEDIGAQNCACSYHK  465



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A          N+     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  261  FYIHCDAALCGLMTPFINNM---ISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  317

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLK++L+ AG
Sbjct  318  STNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQVGLQKDVKRCLDNAKYLKNRLQQAG  377

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VMP +T E LD F+ EL+Q R 
Sbjct  378  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVKDMAHVIVMPGITREMLDNFVSELVQQRK  437

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY  G ++ PC+ ED+G  NC C  HK
Sbjct  438  QWYRDGKAEAPCVGEDIGAQNCACSYHK  465



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  255  FYIHCDAA---LNGLIIPFIKNMITFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS DATI GSRNG  PIFLWY+L+ KG  GFQK+V++CL NA YLKD+L+ AG
Sbjct  312  SRRVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGFQKDVKRCLDNAIYLKDRLQKAG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS  VV ERP+D EFVRRWQL+C R+M+HV+VMP +T E LD F+ +L+Q R 
Sbjct  372  ISVMLNELSIIVVLERPRDHEFVRRWQLSCVRDMAHVIVMPGITRETLDGFITDLLQQRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G    PC+A D+G  NC C  HK
Sbjct  432  KWYQDGRISAPCVASDIGAQNCACSYHK  459



>gb|KEH26769.1| serine decarboxylase [Medicago truncatula]
Length=192

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 147/186 (79%), Gaps = 13/186 (7%)
 Frame = -2

Query  780  KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  601
            K  FKKPIGSVSVSGHKFVGCPMPCG+  T L            L  R  +IMGSRNGHA
Sbjct  20   KVTFKKPIGSVSVSGHKFVGCPMPCGMWNTLL------------LGMR-LSIMGSRNGHA  66

Query  600  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  421
            PIFLWYTLNRKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF
Sbjct  67   PIFLWYTLNRKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEF  126

Query  420  VRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  241
            +R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C
Sbjct  127  IRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSC  186

Query  240  CCVLHK  223
             C  HK
Sbjct  187  LCAQHK  192



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         +NV     FKKPIGSV++SGHKF+GCP+PCGVQ+TR  HI  L
Sbjct  247  FYIHCDAALNGLIVPFTKNV---ISFKKPIGSVTISGHKFIGCPIPCGVQITRKSHIGYL  303

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEY+AS DATI GSRNG  PI LWY+L+ KG  G Q++V++CL NA YL+D+L+ A 
Sbjct  304  SRNVEYIASMDATISGSRNGLTPILLWYSLSSKGQIGIQQDVKRCLNNARYLRDRLKQAN  363

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS+ VV ERP D EF R WQL+C ++++HV+VMPS+T E LD F  +L+Q R 
Sbjct  364  ISVMLNELSTIVVLERPHDHEFTRHWQLSCVKDIAHVIVMPSITRETLDDFFIDLVQKRK  423

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +WY+ G+ KPPC+A+D+G  NC C LH
Sbjct  424  MWYQDGSVKPPCVADDIGAQNCACALH  450



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 154/209 (74%), Gaps = 2/209 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA              K  FKKPIGS+++SGHKF+GCP PCGV +TRL++IN L
Sbjct  206  FYIHCDGALFGMMMPFLIQA-PKVTFKKPIGSITISGHKFLGCPFPCGVLITRLEYINTL  264

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            + NVEY+ASRD TI GSR+GHAPIFLWY L  +G  G Q EVQKC+ +A YL+ +LR A 
Sbjct  265  AKNVEYIASRDVTITGSRSGHAPIFLWYALKERGSVGLQNEVQKCIISARYLQHRLREAK  324

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNE S+TVVFERP+D++F R+W LAC++N++H VVM  VTVE LD F++E IQ R 
Sbjct  325  IGAMLNEFSNTVVFERPQDDDFARKWSLACKKNIAHGVVMQHVTVEMLDSFVNEFIQERQ  384

Query  306  VWYE-GGNSKPPCLAEDVGVSNCCCVLHK  223
            +W++  G   P CLA D+GV NC C+LH+
Sbjct  385  IWFQDDGKRNPLCLANDIGVGNCACILHE  413



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 159/227 (70%), Gaps = 3/227 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         +NV     FKKPIGSV++SGHKF+GCP+PCGVQ+TR  HI  L
Sbjct  247  FYIHCDAALNGLIVPFIKNV---ISFKKPIGSVTISGHKFLGCPIPCGVQITRKSHIAYL  303

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEY+AS DATI GSRNG  PI LWY+L+ KG  G QK+V++CL NA YLKD+L+ A 
Sbjct  304  SRNVEYIASMDATISGSRNGLTPILLWYSLSSKGQIGIQKDVKRCLNNARYLKDRLQQAN  363

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS+ VV ERP D EF R WQL+C R+++HV+VMPS+T E LD F  +L+Q R 
Sbjct  364  ISVMLNELSTIVVLERPHDHEFTRHWQLSCVRHIAHVIVMPSITRETLDDFFIDLVQKRK  423

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CNNNPEGRSFILGLCLPV  166
            +WY+ G+ KPPC+A+D+G  NC C  H   ++     + ++ +  P 
Sbjct  424  MWYQDGSVKPPCVADDIGAQNCSCAFHNDSDSEMANDNVMVDVAAPT  470



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 152/207 (73%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         E    +  F+KPIGSV++SGHKF+GCP+PCG+ +TRL +INAL
Sbjct  251  FYIHCDGALFGMMLPFVEQA-PRITFEKPIGSVAISGHKFLGCPIPCGIVITRLRYINAL  309

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VEY+ SRD TI GSR GHAPIFLWY + RKG  G Q EV+KC+ NAHYL+ +LR AG
Sbjct  310  SRDVEYIGSRDVTITGSRCGHAPIFLWYAIKRKGLIGLQNEVRKCIMNAHYLQSRLRNAG  369

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLN  SSTVVF+RP DEEF RRW LAC+ N++HVVVM  VT+E LD F+ E +Q RS
Sbjct  370  IGAMLNRFSSTVVFKRPLDEEFTRRWNLACKGNIAHVVVMQHVTIEMLDSFVAEFLQKRS  429

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +W+E    +  C+A+D+G  NC C +H
Sbjct  430  IWFEDEQFQHVCIAKDIGSGNCGCSMH  456



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 156/209 (75%), Gaps = 2/209 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         +N   K  FKKPIGSVSVSGHKF+GCPMPCG+Q+ R  H++ L
Sbjct  210  FYIHCDAALCGLILPFLKNA-PKITFKKPIGSVSVSGHKFLGCPMPCGIQIARKKHVDIL  268

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N+EY+AS DATI GSR GHAPIFLWY+L++K +   Q + ++C++NA YLKD LR +G
Sbjct  269  SRNIEYIASIDATISGSRGGHAPIFLWYSLSKKCHTTLQDDAKRCIQNARYLKDSLRNSG  328

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S TVVFERP ++EF+ +WQL+CER+M+HVVVMP VT + LD F+ E  + R 
Sbjct  329  ISAMLNEHSITVVFERPLEQEFIHKWQLSCERDMTHVVVMPGVTTQMLDNFVSEFAKKRL  388

Query  306  VWYEGGNS-KPPCLAEDVGVSNCCCVLHK  223
            +WY+ GN  +PPCLA D+G+ NC C  HK
Sbjct  389  IWYQDGNKVQPPCLANDIGMHNCVCPHHK  417



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 3/207 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         + V  KF FKKPIGSVS+SGHKF+GCPMPCGV LTR  +I  +
Sbjct  252  FYIHCDAAMSGLVVPFLKQV-TKFTFKKPIGSVSISGHKFLGCPMPCGVLLTRRKYIKLI  310

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S N+EY+A+ D+TI GSRNGH+PIF+WY LN KG+KG +++V+KCL+NA YL+  L+ AG
Sbjct  311  SRNIEYIATCDSTIAGSRNGHSPIFMWYVLNIKGWKGLKQDVEKCLKNARYLRHHLKKAG  370

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS+MLNE S TVVFERP+D EF+R WQL C  +M+HVVVMP VT+E LD FL +LI+ R+
Sbjct  371  ISSMLNETSVTVVFERPQDSEFIRHWQLQCLGSMAHVVVMPHVTIEMLDRFLYDLIRKRN  430

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +W+  G   PPCLAED+G+ NC C +H
Sbjct  431  IWH--GTLHPPCLAEDMGICNCACPVH  455



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 153/209 (73%), Gaps = 2/209 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA              K  FKKPIGS+++SGHKF+GCP PCGV +TRL++IN L
Sbjct  216  FYIHCDGALFGMMMPFLIQA-PKVTFKKPIGSITISGHKFLGCPFPCGVLITRLEYINTL  274

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            + NVEY+ASRD TI GSR GHAPIFLWY L  +G  G Q EVQKC+ +A YL+ +LR A 
Sbjct  275  AKNVEYIASRDVTITGSRRGHAPIFLWYALKERGSVGLQNEVQKCIISARYLQHRLREAK  334

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNE S+TVVFERP+D++F R+W LAC++N++H VVM  VTVE LD F++E IQ R 
Sbjct  335  IGAMLNEFSNTVVFERPQDDDFARKWSLACKKNIAHGVVMQHVTVEMLDSFVNEFIQERQ  394

Query  306  VWYE-GGNSKPPCLAEDVGVSNCCCVLHK  223
            +W++  G   P CLA D+GV NC C+LH+
Sbjct  395  IWFQDDGKRNPLCLANDIGVGNCACILHE  423



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 151/208 (73%), Gaps = 20/208 (10%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+HIN L
Sbjct  197  FYIHVDGALFGLMMPFVKRA-PKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHINGL  255

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATI                    + GFQKEVQKCLRNA+Y KD+L  AG
Sbjct  256  SRNVEYLASRDATI-------------------DHGGFQKEVQKCLRNAYYFKDRLIEAG  296

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNELSSTVVFERP DEEF+R+WQLAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+
Sbjct  297  IGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAHVVVMPNVTIEKLDDFLNELVQKRA  356

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+E G  +P C+A DVG ++C C  HK
Sbjct  357  TWFEDGTFQPYCIASDVGENSCLCAQHK  384



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA              K  F KPIGSVSVSGHKF+GCP+PCGV +TRL+H+  L
Sbjct  148  FYIHCDGALAGLMMPFIRQA-PKVTFTKPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVL  206

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+++EYL+SRDATIMGSRNGHAP++LWYTLN+KGYKG +KEVQKCLRNAH+L ++L+  G
Sbjct  207  STDIEYLSSRDATIMGSRNGHAPMYLWYTLNKKGYKGIRKEVQKCLRNAHHLANRLKEMG  266

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +SA LNELSSTVVFERP+DE FV +WQLACE +++HVVVMP++ VEKLD F++EL+ AR 
Sbjct  267  VSASLNELSSTVVFERPQDETFVHKWQLACESSIAHVVVMPNIDVEKLDDFVEELV-ARR  325

Query  306  VWYEGGNSKPPCLAED  259
             W+E       C+A++
Sbjct  326  AWHERKVFDILCVAKE  341



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 152/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         +NV     FKKPIGSV++SGHKF+GCP+PCGVQ+TR  HI  L
Sbjct  247  FYIHCDAALSGLIVPFIKNV---ISFKKPIGSVTISGHKFLGCPIPCGVQITRKSHIAYL  303

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEY+AS DATI GSRNG  PI LWY+L+ K   G Q++V++CL NA YLKD+L+ A 
Sbjct  304  SRNVEYIASMDATISGSRNGLTPILLWYSLSSKNQIGIQQDVKRCLYNARYLKDRLQQAN  363

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNELS+ VV ERP D EF R WQL+C R+++HV+VMPS+T E LD F  +L+Q R 
Sbjct  364  ISVMLNELSTIVVLERPLDHEFTRHWQLSCVRDIAHVIVMPSITRETLDDFFIDLVQKRK  423

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +WY+ G+ KPPC+A+D+G  NC C LH
Sbjct  424  MWYQDGSVKPPCVADDIGAQNCACALH  450



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 152/212 (72%), Gaps = 1/212 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+       N   +  FKKPI SV++SGHKF+GCP PCGV +TRL +INAL
Sbjct  241  FYIHCDGA-LFGIMLPFINQALRISFKKPIDSVTISGHKFLGCPSPCGVLITRLKYINAL  299

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VEY+ASRDATI GSR+GHAPI LWY L ++G  G + EV +C+ NA YL ++LR AG
Sbjct  300  SRDVEYIASRDATITGSRSGHAPILLWYALKKRGLIGLENEVHECITNARYLLNQLRDAG  359

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNE S+ VVFERP D+ F RRW LA   N++HVVV+  +T+E LD F+ E IQ RS
Sbjct  360  IGAMLNEFSNIVVFERPFDDHFTRRWNLASNENIAHVVVLKHITIEMLDTFVHEFIQKRS  419

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK*CNN  211
            +W + G+ +PPC+A DVG  NC C +H    N
Sbjct  420  IWSKDGHFQPPCIASDVGSKNCACSIHSLSRN  451



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA       + +       FKKPIGS+++SGHKF+GCP+PCGV LTRL+HIN L
Sbjct  247  FYIHCDGALFGMMLPLLKQA-PSITFKKPIGSITISGHKFLGCPIPCGVLLTRLEHINTL  305

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
              +VE + SRD TI GSR+GHAPIFLWY L ++G  G Q EV KC+ NA YL+ KLR AG
Sbjct  306  CKDVEVIGSRDTTISGSRSGHAPIFLWYALQKRGIIGLQNEVHKCMMNARYLQRKLRDAG  365

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I  MLNE S+TVVFE+P D EF+R+W LA + N++HVVVM  VT+E LD F+DE  + R+
Sbjct  366  IGTMLNEFSNTVVFEKPLDIEFIRKWSLAYQGNIAHVVVMQHVTIEMLDSFVDEFTKKRA  425

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +W++ G  KP CLA+++G  NC C LH
Sbjct  426  IWFQYGLRKPICLADEIGAENCICSLH  452



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 151/207 (73%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A         +    K  FKKPIGS+SVSGHKF+GCPMPCGV +TRL+H   L
Sbjct  253  YYIHCDSALSGMMTPFMKQA-PKVSFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+++EY+ASRD+TI GSRNGHAPIFLWYTL++KGYKG  KEV  C+ NA YL+  L+  G
Sbjct  312  STDIEYIASRDSTITGSRNGHAPIFLWYTLSKKGYKGLLKEVHICMGNARYLEVLLKQVG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISA  N LS+ VVFERPKDE  V RWQLACE N++H+VVMP+VT EKL  F++EL + R+
Sbjct  372  ISASCNTLSNIVVFERPKDERIVCRWQLACEGNLAHIVVMPNVTFEKLTVFVEELAEKRN  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY+      PCLA D+G  NC C LH
Sbjct  432  DWYQDKGFDIPCLAVDIGKENCYCNLH  458



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A         +    K  FKKPIGS+SVSGHKF+GCPMPCGV +TRL+H   L
Sbjct  253  YYIHCDSALSGMMTPFMKQA-PKVSFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVL  311

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+++EY+ASRD+TI GSRNGHAPIFLWYTL++KGYKG  KEV  C+ NA YL+  L+  G
Sbjct  312  STDIEYIASRDSTITGSRNGHAPIFLWYTLSKKGYKGLLKEVHICMGNARYLEVLLKQVG  371

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISA  N LS+ VVFERPKDE  V RWQLACE N++H+VVMP+VT EKL  F++EL + R 
Sbjct  372  ISASCNTLSNIVVFERPKDERIVCRWQLACEGNLAHIVVMPNVTFEKLTVFVEELAEKRK  431

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY+      PCLA D+G  NC C LH
Sbjct  432  DWYQDKGFDIPCLAVDIGKENCYCNLH  458



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 150/207 (72%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCDGA         +    K  FKK IGS+SVSGHKF+GCPMPCGV +TRL+H   L
Sbjct  247  YYIHCDGALSGMMTPFMKQA-PKVSFKKTIGSISVSGHKFMGCPMPCGVVITRLEHAKVL  305

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S++VEY+ASRD+TI GSRNGHAPIFLWYTLN+KGYKG  KEVQ CL NA YL+  L+  G
Sbjct  306  STDVEYIASRDSTITGSRNGHAPIFLWYTLNKKGYKGILKEVQMCLGNARYLEVLLKQVG  365

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISA     S+ VVFERPKDE+FV RWQLACE N++H+VVMP+VT EK+  F++E  + R 
Sbjct  366  ISASCATTSNIVVFERPKDEKFVCRWQLACEGNLAHIVVMPNVTFEKIIVFVEEFAKKRR  425

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             WY+      PCLA D+G  NC C LH
Sbjct  426  DWYQDKGFNIPCLAVDIGKENCYCNLH  452



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 147/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         EN    F FKKPIGSVSVS HK +G  +PCGV ++R  H+   
Sbjct  170  FYIHCDAALSGLVSPFLEN-GPLFSFKKPIGSVSVSAHKLLGSSIPCGVFISRKMHMTDF  228

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+N+EY+A++D TI GSRNGH PIF+WY LN KG  GFQKEV+ CL NA YL+D L+ AG
Sbjct  229  STNIEYIATQDTTISGSRNGHTPIFIWYGLNMKGRIGFQKEVKSCLTNARYLRDGLKEAG  288

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S  VVFERP D EFV  WQL+   NM+HVV+MP VTV+ LD FL +L+Q R 
Sbjct  289  ISAMLNESSIVVVFERPLDREFVDFWQLSFLDNMAHVVLMPHVTVKMLDDFLSDLVQKRE  348

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +WY  G  +P CLAE++GVSNC C +H
Sbjct  349  IWYGSGEVRPVCLAEEIGVSNCACSIH  375



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   +     FKKPIGSV++SGHKF+GCPMPCG+Q+TR  +I+ L
Sbjct  250  FYIHCDAA---LNGLIIPFIKNMISFKKPIGSVTISGHKFLGCPMPCGIQITRKSYISHL  306

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+ +EY+AS DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AG
Sbjct  307  STKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKICNENARYLKGRLHKAG  366

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S  VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q R 
Sbjct  367  ISAMLNESSIIVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQERE  426

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G + PPCLA+D+G  NC C   K
Sbjct  427  KWYQVGTTLPPCLADDIGSQNCLCSYQK  454



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+H+NAL
Sbjct  279  FYIHCDGALFGLMLPFVKRA-PKISFKKPIGSVSVSGHKFVGCPMPCGVQITRLEHVNAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEYLASRDATIMGSRNGHAPIFLWY+LN KGY+GFQKEVQKCLRNAHY KD+L  AG
Sbjct  338  SRNVEYLASRDATIMGSRNGHAPIFLWYSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHV  376
            I AMLNELSSTVVFERP DE FV +WQLAC+ N++HV
Sbjct  398  IGAMLNELSSTVVFERPHDEGFVHKWQLACQGNVAHV  434



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 150/210 (71%), Gaps = 5/210 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVH--QKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            +YIHCD A    Y  I   +   +   FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I+
Sbjct  237  YYIHCDAA---LYGLIIPFIQHAKTITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYIS  293

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             LS+ +EY+AS DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  
Sbjct  294  HLSTKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKICNENARYLKGRLHK  353

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGISAMLNE S  VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q 
Sbjct  354  AGISAMLNESSIIVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQE  413

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            R  WY+ G + PPCLA+D+G  NC C   K
Sbjct  414  REKWYQVGTTLPPCLADDIGSQNCLCSYQK  443



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 150/210 (71%), Gaps = 5/210 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVH--QKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            +YIHCD A    Y  I   +   +   FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I+
Sbjct  237  YYIHCDAA---LYGLIIPFIQHAKTITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYIS  293

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             LS+ +EY+AS DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  
Sbjct  294  HLSTKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKICNENARYLKGRLHK  353

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGISAMLNE S  VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q 
Sbjct  354  AGISAMLNESSIIVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQE  413

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            R  WY+ G + PPCLA+D+G  NC C   K
Sbjct  414  REKWYQVGTTLPPCLADDIGSQNCLCSYQK  443



>gb|ACU18860.1| unknown [Glycine max]
Length=152

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  780  KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  601
            K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHA
Sbjct  10   KVTFKKPIGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHA  69

Query  600  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  421
            PIFLWYTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF
Sbjct  70   PIFLWYTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEF  129

Query  420  VRRWQLACERNMSHV  376
            +R+WQLAC+ N++HV
Sbjct  130  IRKWQLACKGNIAHV  144



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A         ++V +   FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I+ L
Sbjct  237  YYIHCDAALYGLIVPFIQHV-KTITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYISHL  295

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+ +EY+AS DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AG
Sbjct  296  STKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGRLHKAG  355

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S  VVFERP D +F+R WQL+C R+M+HVVVMP +T E +D F ++L+Q R 
Sbjct  356  ISAMLNESSIIVVFERPNDPKFIRHWQLSCTRDMAHVVVMPGITRETIDSFFNDLMQERE  415

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G   PPCLA+D+G  NC C   K
Sbjct  416  KWYQVGTIVPPCLADDIGSQNCLCSKQK  443



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A         ++V +   FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I +L
Sbjct  235  YYIHCDAALYGLIVPFIQHV-KTITFKKPIGSVSISGHKFLGCPMPCGIQITRKGYITSL  293

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+ +EY+AS DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AG
Sbjct  294  STKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGRLHKAG  353

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I+AMLNE S  VVFERP D +F+R WQL+C R+M+HVV+MP +T E +D F  +L+Q R 
Sbjct  354  INAMLNECSIIVVFERPNDPKFIRHWQLSCTRDMAHVVIMPGITRETIDSFFKDLMQERX  413

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G + PPCLA+D+G  NC C   K
Sbjct  414  KWYQVGTTVPPCLADDIGSQNCICSKQK  441



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IHCDGA                 F+KPIGSVSVSGHKFVG P+PCGV +TR  H+ AL
Sbjct  271  FFIHCDGALFGMMMPFLRRDAPMVTFRKPIGSVSVSGHKFVGAPVPCGVVITRFKHVMAL  330

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SS+VEYL SRDATIMGSRNGHAPI+LWYTL RKGY+G +++V++C+RNAH LK  L  AG
Sbjct  331  SSDVEYLNSRDATIMGSRNGHAPIYLWYTLTRKGYEGMRRDVERCMRNAHVLKQMLESAG  390

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I  MLNELS+TVVFERPK+E FVR+WQLACE +++HVVVMP++TVEKL+ F+ + +Q+R+
Sbjct  391  IRTMLNELSNTVVFERPKEEAFVRKWQLACEGDIAHVVVMPNITVEKLEEFVADYVQSRA  450



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +   Q+  FKKPI SV++SGHKF+GCP PCGV +TRL +IN L
Sbjct  238  FYIHCDGALFGIMLPFIKQA-QRISFKKPIDSVTISGHKFLGCPSPCGVVITRLKYINEL  296

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VE +ASRDATI GSR GHAPI LWY L +KG  G + EV +C+ NA YL D+LR AG
Sbjct  297  SRDVEIIASRDATITGSRCGHAPILLWYALKKKGLIGLKNEVHECIINARYLLDQLRDAG  356

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNE S+ VVFE+P D+ F RRW LA + N++HVVV+  VT E LD F+ E IQ RS
Sbjct  357  IGAMLNEFSNIVVFEKPLDDNFTRRWNLATKGNIAHVVVLMHVTKEMLDTFVREFIQKRS  416

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY+ G+ +P C+A  VG +NC C +HK
Sbjct  417  IWYKHGHFQPLCIANHVGSTNCVCSIHK  444



>gb|AES89541.2| serine decarboxylase [Medicago truncatula]
Length=228

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 140/190 (74%), Gaps = 0/190 (0%)
 Frame = -2

Query  780  KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  601
            +  FKKPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHA
Sbjct  38   RISFKKPIDSVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHA  97

Query  600  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  421
            PIFLWY L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F
Sbjct  98   PIFLWYALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHF  157

Query  420  VRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  241
             RRW LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG  NC
Sbjct  158  TRRWNLASNGNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVGSRNC  217

Query  240  CCVLHK*CNN  211
             C +H    N
Sbjct  218  ACSIHSLSRN  227



>ref|XP_003607344.1| Serine decarboxylase [Medicago truncatula]
Length=207

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = -2

Query  780  KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  601
            +  FKKPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHA
Sbjct  17   RISFKKPIDSVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHA  76

Query  600  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEF  421
            PIFLWY L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F
Sbjct  77   PIFLWYALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHF  136

Query  420  VRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  241
             RRW LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG  NC
Sbjct  137  TRRWNLASNGNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVGSRNC  196

Query  240  CCVLH  226
             C +H
Sbjct  197  ACSIH  201



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA                 F+KPIGSVSVSGHKFVG P+PCGV +TR  ++ AL
Sbjct  197  FYIHCDGALFGMMMPFLSRDAPMVTFRKPIGSVSVSGHKFVGAPVPCGVIITRFKYVMAL  256

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SS+VEYL SRDATIMGSRNGHAP++LWYTL RKGY G +++V+KC+RNAH L+  L  AG
Sbjct  257  SSDVEYLNSRDATIMGSRNGHAPVYLWYTLTRKGYDGMRRDVEKCMRNAHVLQQMLESAG  316

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            I  MLNELS+TVVFERPK+E FVR+WQLACE  ++HVVVMP++TVEKL+ F+ + +Q+R
Sbjct  317  IRTMLNELSNTVVFERPKEEAFVRKWQLACEGEIAHVVVMPNITVEKLEEFVADYVQSR  375



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +       FKKPIGSVSVSGHKFVG P+PCGV +TRL HI AL
Sbjct  279  FYIHCDGALFGMMIPFVKRAPM-VTFKKPIGSVSVSGHKFVGAPVPCGVVMTRLKHIQAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S++VEYL SRDATIMGSRNGHAPI++WYT  RKGY+G +K+V++CLRNAH L+  L  AG
Sbjct  338  STDVEYLNSRDATIMGSRNGHAPIYMWYTFTRKGYEGLRKDVERCLRNAHLLRSMLERAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +   LNELSSTVVFERP DE+FVRRWQLAC+ +++HVVVMP++TV KL+ F+ ELI  R+
Sbjct  398  VVTSLNELSSTVVFERPADEDFVRRWQLACQGDIAHVVVMPNITVAKLERFVTELIAVRA  457



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVH--QKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            +YIHCD A    Y  I   +   +   FKK +GSVS+SGHKF+GCPMPCG+Q+TR  +I+
Sbjct  199  YYIHCDAA---LYGLIIPFIQHAKTITFKKSVGSVSISGHKFLGCPMPCGIQMTRKSYIS  255

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
            +LS+ +EY+AS DATI GSRNG API LWY+L  KG  G Q++ + C+ NA YLK +L  
Sbjct  256  SLSTKIEYIASTDATISGSRNGLAPILLWYSLCMKGRTGLQQDAKMCIENARYLKGQLHK  315

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGISAMLNE S  VVFERP D +F+R+WQL+C R+M+H VVMP +T E +D F  +L+  
Sbjct  316  AGISAMLNEFSIIVVFERPNDHKFIRQWQLSCTRDMTHAVVMPCITRETIDNFFKDLMHE  375

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  214
            R  WY  G + PPCLA+D+   NC C  HK C+
Sbjct  376  REKWYRVGTTVPPCLADDIASQNCLCCCHKMCH  408



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVH--QKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            +YIHCD A    Y  I   +   +   FKK +GSVS+SGHKF+GCPMPCG+Q+TR  +I+
Sbjct  239  YYIHCDAA---LYGLIIPFIQHAKTITFKKSVGSVSISGHKFLGCPMPCGIQMTRKSYIS  295

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
            +LS+ +EY+AS DATI GSRNG API LWY+L  KG  G Q++ + C+ NA YLK +L  
Sbjct  296  SLSTKIEYIASTDATISGSRNGLAPILLWYSLCMKGRTGLQQDAKMCIENARYLKGQLHK  355

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGISAMLNE S  VVFERP D +F+R+WQL+C R+M+H VVMP +T E +D F  +L+  
Sbjct  356  AGISAMLNEFSIIVVFERPNDHKFIRQWQLSCTRDMTHAVVMPCITRETIDNFFKDLMHE  415

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLHK*CN  214
            R  WY  G + PPCLA+D+   NC C  HK C+
Sbjct  416  REKWYRVGTTVPPCLADDIASQNCLCCCHKMCH  448



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IHCDGA         +       FKKPIGS+SVSGHKFVG P+PCGV +TRL +I  +
Sbjct  268  FFIHCDGALFGMMIPFVKRAPM-VTFKKPIGSISVSGHKFVGSPVPCGVVMTRLRYIKGV  326

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SS+VEYL SRDATIMGSRNGHAPI++WYT  RKGY+G +K+V+KCLRNAH LK  L  AG
Sbjct  327  SSDVEYLNSRDATIMGSRNGHAPIYMWYTFTRKGYEGLRKDVEKCLRNAHLLKSMLDTAG  386

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +  MLNELSSTVVFERP++E FVR+WQLACE +++HVVVMP++T+ KL+ F+ EL+++R+
Sbjct  387  VRTMLNELSSTVVFERPREESFVRKWQLACEGDIAHVVVMPNITIRKLETFVQELVESRA  446



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 148/209 (71%), Gaps = 5/209 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQ--KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            FYIHCDGA    +  +   + Q  +  FKKPI SV++SGHKF+GCP PCGV +TRL ++N
Sbjct  240  FYIHCDGA---LFGIMLPFIKQAPRISFKKPIDSVTISGHKFLGCPSPCGVLITRLKYMN  296

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
            ALS +V+ +ASRDATI GSR GHAPIFLWY L ++G  G + EV +C+  AHYL + LR 
Sbjct  297  ALSRDVDIIASRDATITGSRCGHAPIFLWYALKKRGLIGLENEVHECIMKAHYLLNLLRD  356

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGI AMLN+ S+ VVFERP D+ F RRW LA  +N +HVVV+  VTVE LD F+ E  + 
Sbjct  357  AGIGAMLNKFSNIVVFERPLDDHFTRRWNLASNKNTAHVVVLKHVTVEMLDSFVREFTEK  416

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            +S+WY+    +PPC+A DVG  NC C +H
Sbjct  417  QSIWYKDEQFQPPCIANDVGSRNCACSIH  445



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +Y+HCD A          +V +K  FKKPIGS+S+SGHKF+GCPMPCG+Q+TR  ++++L
Sbjct  213  YYVHCDAALCGLILPFIRHVSKKITFKKPIGSISISGHKFLGCPMPCGIQITRKSYVSSL  272

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  +EY+ S DATI GSRNG  PIFLWY L+ KG+   Q++ + C+ NA YLKD+L  AG
Sbjct  273  SK-IEYINSTDATISGSRNGLTPIFLWYCLSTKGHVRLQQDSKICIENARYLKDRLLEAG  331

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S TVVFERP D +F+RRW L   R M+HVVVMP +T E +D F ++L+Q R 
Sbjct  332  ISAMLNEFSITVVFERPCDHKFIRRWNLCYLRGMAHVVVMPGITREIIDSFFNDLMQERK  391

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G ++PPCLA+D G  NC C  +K
Sbjct  392  RWFQDGKTRPPCLADDFGTQNCMCSNNK  419



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A         ++V +   FKKPIGSVS+SGHKF+GCPMPCG+Q+TR  +I +L
Sbjct  237  YYIHCDAALYGLIVPFTQHV-KTITFKKPIGSVSISGHKFLGCPMPCGIQITRKSYITSL  295

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+ +EY+AS DATI GSRNG APIFLWY+L  KG  G Q++ + C  NA YLK +L  AG
Sbjct  296  STKIEYIASVDATISGSRNGLAPIFLWYSLCMKGRAGLQQDAKMCNENARYLKGQLHKAG  355

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            IS MLNE S  VVFERP   +F+R WQL+C R+M+HVVVMP +T E +D F  +L+Q R 
Sbjct  356  ISTMLNESSIIVVFERPNVPKFIRHWQLSCTRDMAHVVVMPGITRETIDNFFKDLMQERK  415

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             WY+ G   PPCLA+D+G  NC C   K
Sbjct  416  KWYQVGIIVPPCLADDIGSQNCLCSKQK  443



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 144/208 (69%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         EN   KF FKKPIGSVSVS HK +G  MPCGV +TR  HI   
Sbjct  223  FYIHCDAALYGLISPFLEN-GPKFSFKKPIGSVSVSAHKLLGSSMPCGVFMTRKRHIADF  281

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRK-GYKGFQKEVQKCLRNAHYLKDKLRGA  490
            S N+EY+A+ D TI GSRNGHAPIF+WY+LN K G  G QKEV KCL NA YL+D L+ A
Sbjct  282  SRNIEYIATVDNTISGSRNGHAPIFIWYSLNMKLGRMGLQKEVNKCLMNARYLRDGLKNA  341

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GIS MLNE +  VVFERP D EF+  WQL+ +  M+HV+VMP VTV+ LD FL +L + R
Sbjct  342  GISVMLNESNILVVFERPLDLEFIYHWQLSVDGKMAHVIVMPHVTVKMLDDFLSDLTRKR  401

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             +WY  G  +  CLAED+G+SNC C +H
Sbjct  402  EIWYGSGEVRRLCLAEDIGLSNCACSVH  429



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   244 bits (622),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 142/208 (68%), Gaps = 1/208 (0%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A         EN    F FKKPIGSVSVS HK +G  MPCG+ ++R  H+   
Sbjct  210  FYIHCDAASYGLVSPFLEN-GPLFSFKKPIGSVSVSAHKLLGSSMPCGILISRKMHMTDF  268

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+N+EY+A+ D TI GSRNGH PIF+WY LN KG  G QKEV  CL NA YL+D L  AG
Sbjct  269  STNIEYIATLDTTISGSRNGHTPIFIWYGLNLKGRIGLQKEVNNCLTNAKYLRDGLNKAG  328

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S  VVFERP D EF+  WQL+    M+HVV+MP VT++ LD FL +L++ R 
Sbjct  329  ISAMLNESSIVVVFERPLDREFIDYWQLSFLGKMAHVVLMPHVTMKMLDDFLSDLVRKRE  388

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            +WY  G  +P CLAE++G SNC C +H+
Sbjct  389  IWYGSGEVRPVCLAEEIGASNCACSIHR  416



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA L+       +      F+KPIGSVSVSGHKFVG PMPCGV +TRL ++ AL
Sbjct  279  FYIHCDGA-LFGMMLPFVSATPMVTFRKPIGSVSVSGHKFVGAPMPCGVVMTRLRYVEAL  337

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SS VEYL SRDATIMGSRNGHAPI+LWYTL RKG  G +K+V++CLRNAH LKD L+ AG
Sbjct  338  SSEVEYLNSRDATIMGSRNGHAPIYLWYTLARKGLVGMRKDVERCLRNAHLLKDMLQRAG  397

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            + A LN LSSTVVFERP D  FVRRWQLACE +++HV+VMP++TV KL+ F+ EL+  R+
Sbjct  398  VGASLNPLSSTVVFERPADPAFVRRWQLACEGDIAHVIVMPNITVAKLEKFVKELLACRA  457



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 146/205 (71%), Gaps = 2/205 (1%)
 Frame = -2

Query  849  GFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
             +YIHCD A         E+  +K  FKKPIGS+S+SGHKF+GCPMPCG+Q+TR  ++++
Sbjct  235  NYYIHCDAALCGLILPFMEHA-KKITFKKPIGSISISGHKFLGCPMPCGIQITRKSYVSS  293

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            LS  +EY+AS D TI GSRNG  PIFLWY LN KG+   Q++   C+ NA YLKD+L  A
Sbjct  294  LSK-IEYIASIDTTISGSRNGLTPIFLWYCLNMKGHARLQQDSITCIENARYLKDRLVKA  352

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GISAMLNELS  VVFERP D EF+RRWQL     M+H+VVMP +T E +D F ++L+Q R
Sbjct  353  GISAMLNELSIIVVFERPCDHEFIRRWQLCYLSVMAHIVVMPFITREIIDSFFNDLMQER  412

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCC  235
              W++ G ++PPCLA+D G  NC C
Sbjct  413  KRWFQDGKTRPPCLADDFGTQNCMC  437



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A +  +         KF FKKPIGSVS+SGHKF+GCPMPCGV LTR  +I+ L
Sbjct  246  FYIHCDAA-ISGFVVPFLKQAPKFTFKKPIGSVSISGHKFLGCPMPCGVLLTRKRYIDIL  304

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S+++EY+A+ D TI GSRNGH+PIFLWY LN KG KG +++V+KCL N+ YL+D+L+ AG
Sbjct  305  STSIEYIATVDTTIAGSRNGHSPIFLWYVLNIKGQKGLEEDVEKCLINSRYLRDRLKKAG  364

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I++MLNE+S TVVFERP D EF+R WQL C  NM+HVV+MP VTVE LD FL +L+Q R+
Sbjct  365  INSMLNEMSITVVFERPPDSEFIRHWQLQCLGNMAHVVIMPHVTVEMLDHFLYDLLQKRN  424

Query  306  VWY  298
            +WY
Sbjct  425  IWY  427



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 140/210 (67%), Gaps = 44/210 (21%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQ--KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            FYIHCDGA    +  +   V Q  +  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR     
Sbjct  189  FYIHCDGA---LFGLMMPFVKQAPRVSFKKPIGSVSVSGHKFVGCPMPCGVQITR-----  240

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
                                              KGY+GFQKEVQKCLRNAHYLKD+L+ 
Sbjct  241  ----------------------------------KGYRGFQKEVQKCLRNAHYLKDRLKD  266

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGISAMLNELSSTVVFERPKDEEFVRRWQLACE  +SHVVVMPSV V+KLD FL+EL++ 
Sbjct  267  AGISAMLNELSSTVVFERPKDEEFVRRWQLACEGGISHVVVMPSVNVDKLDTFLNELVEK  326

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
            R  WY+ G  + PC+A DVG  NC C LHK
Sbjct  327  RVTWYQEGKCQSPCIAADVGQENCLCTLHK  356



>gb|EYU40386.1| hypothetical protein MIMGU_mgv1a026369mg, partial [Erythranthe 
guttata]
Length=300

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 139/208 (67%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHI-NA  670
            FYIHCD A         E    K  FKKPI S+SVS HK +G  +PCGV +TR   I N 
Sbjct  92   FYIHCDAALNGLISPFLE-YGPKLSFKKPIRSISVSAHKLLGSSIPCGVLMTRKGRITNN  150

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            LS NVEY+ + D TI GSRNGHAPIF+WY L  KG  G   EV KCL NA YL+D  + A
Sbjct  151  LSENVEYIDTLDTTISGSRNGHAPIFIWYGLKMKGRSGLHTEVNKCLTNAKYLRDGFKNA  210

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GISAMLNE S  VVFERP   EF+  WQL+    M+HVVVMP VTV+ LD FLD+L+Q R
Sbjct  211  GISAMLNESSIVVVFERPLSREFIDYWQLSLLEKMAHVVVMPHVTVKMLDDFLDDLVQNR  270

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             +WY  G  +P CLAE++GVSNC C++H
Sbjct  271  EIWYGNGKVQPLCLAEEIGVSNCACLVH  298



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 5/209 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQ--KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            FYIHCDGA    +  +   + Q  K  FKKPIGSV++SGHKF+GCP PCGV +TRL +++
Sbjct  243  FYIHCDGA---LFGIMLPFIKQALKVSFKKPIGSVTISGHKFLGCPSPCGVVITRLKYMS  299

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
            A+S +V  +ASRDATI GSR GHAPIFLWY L ++G  G + EV +C+  AHYL + LR 
Sbjct  300  AISRDVGIIASRDATITGSRCGHAPIFLWYALKKRGLIGLENEVHECIMKAHYLLNLLRD  359

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGI AMLNE S+ VVFERP D++F R W LAC  N++HVVV+  V+VE LD F+ E I+ 
Sbjct  360  AGIGAMLNEFSNIVVFERPLDDDFNRSWNLACSGNIAHVVVLQHVSVEMLDTFVHEFIEK  419

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            RS+W +    KP C+A DVG  NC C++H
Sbjct  420  RSIWSKDEQFKPLCIANDVGSKNCACLMH  448



>gb|KCW44086.1| hypothetical protein EUGRSUZ_L02502 [Eucalyptus grandis]
Length=239

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  627  IMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVV  448
            I   RNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVV
Sbjct  105  IEAVRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVV  164

Query  447  FERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCL  268
            FERP +EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCL
Sbjct  165  FERPSEEEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCL  224

Query  267  AEDVGVSNCCCVLHK  223
            A D+G  NCCC LHK
Sbjct  225  AVDIGAENCCCALHK  239



>ref|XP_006362640.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=346

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 144/207 (70%), Gaps = 3/207 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A L+       N  +   FKK IGS+SVSGHKF+GC M CGVQ+TR  +I  +
Sbjct  139  FYIHCDAA-LYGLIVPFINHAKIITFKKSIGSISVSGHKFLGCSMLCGVQITRKTYIATI  197

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS D TI GSRNG APIFLWY+L+ KG+ G Q+  + C  NA YLKD+L  AG
Sbjct  198  SKRVEYIASIDNTISGSRNGLAPIFLWYSLSMKGHVGLQQHAKMCYENARYLKDRLHKAG  257

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNELS+ VVFERP D++F+RRWQL+C R+ +HVVVMP  T E +D F  +L+Q R 
Sbjct  258  ISAMLNELSNIVVFERPCDDKFIRRWQLSCTRDTAHVVVMPGTTKEIIDNFFKDLMQERE  317

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             W   G +  PCLA+D+G  NC C  H
Sbjct  318  KW--CGITLAPCLADDIGSQNCLCSYH  342



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 142/207 (69%), Gaps = 8/207 (4%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         E       FKK IGS+++SGHKF+GCP+PCGV LTRL+HIN L
Sbjct  233  FYIHCDGALFGMMLPFLEQA-PSITFKKSIGSITISGHKFLGCPIPCGVLLTRLEHINTL  291

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
              +VE + SRD TI GSR+GHA IF+WY L +KG  G + EV KC+ NA YLK KLR AG
Sbjct  292  CKDVEVIGSRDTTISGSRSGHASIFIWYALQKKGLLGLENEVHKCIMNACYLKRKLRDAG  351

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I  MLNE S+TVVFE+P D EF+R+W LA E +++HVVVM  VTVE LD F+DE I+ R 
Sbjct  352  ICTMLNEYSNTVVFEKPLDCEFIRKWNLAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRL  411

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
                    KP CLA+ +G  NC C+LH
Sbjct  412  -------RKPLCLADKIGAENCTCILH  431



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 142/207 (69%), Gaps = 8/207 (4%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         E       FKK IGS+++SGHKF+GCP+PCGV LTRL+HIN L
Sbjct  257  FYIHCDGALFGMMLPFLEQA-PSITFKKSIGSITISGHKFLGCPIPCGVLLTRLEHINTL  315

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
              +VE + SRD TI GSR+GHA IF+WY L +KG  G + EV KC+ NA YLK KLR AG
Sbjct  316  CKDVEVIGSRDTTISGSRSGHASIFIWYALQKKGLLGLENEVHKCIMNACYLKRKLRDAG  375

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I  MLNE S+TVVFE+P D EF+R+W LA E +++HVVVM  VTVE LD F+DE I+ R 
Sbjct  376  ICTMLNEYSNTVVFEKPLDCEFIRKWNLAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRL  435

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLH  226
                    KP CLA+ +G  NC C+LH
Sbjct  436  -------RKPLCLADKIGAENCTCILH  455



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 146/208 (70%), Gaps = 7/208 (3%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-A  670
            FYIHCD A +       +    K  FKKPIGS+ +SGHKF+GCP+PCGV +TRL  IN  
Sbjct  198  FYIHCDSALVGLMMPFIKQA-PKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHV  256

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            +S+N+EY++S D TI GSRNGHAPIFLWY L R GY G  K V+ CL+NA YL  +LR  
Sbjct  257  MSTNIEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREM  316

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            G+S  LN LS TVVFERPKDE FVR+WQLAC+  ++HVVVMP+V++E+++ FL+E  ++R
Sbjct  317  GVSVFLNALSITVVFERPKDETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSR  376

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
               ++       C+A DVG  NC C LH
Sbjct  377  ITLHQD-----KCVAGDVGQENCLCSLH  399



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +       F+KPIGSVSVSGHKF+G P+PCGV +TR  H+ AL
Sbjct  274  FYIHCDGALFGMMMPFLKQA-PMVTFRKPIGSVSVSGHKFLGAPVPCGVVITRFRHVLAL  332

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            SS+VEYL SRDATIMGSRNGHAP++LWYTL RKGY G  ++V++C+RNAH LK  L  AG
Sbjct  333  SSDVEYLNSRDATIMGSRNGHAPLYLWYTLTRKGYAGIARDVERCMRNAHTLKSMLDQAG  392

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +  MLNELS+TVVFERP++E FVR+WQLACE +++HVVVMP++ + KL+ F+ + I +R+
Sbjct  393  VKTMLNELSNTVVFERPREEAFVRKWQLACEGDIAHVVVMPNIDIAKLEEFVQDYISSRA  452



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 144/208 (69%), Gaps = 7/208 (3%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-A  670
            FYIHCD A +       +    K  FKKPIGS+ +SGHKF+GCP+PCGV +TRL  IN  
Sbjct  125  FYIHCDSALVGLMMPFIKQA-PKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHV  183

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            +S+N+EY++S D TI GSRNGHAPIFLWY L R GY G  K V+ CL+NA YL  +LR  
Sbjct  184  MSTNIEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREM  243

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            G+S  LN LS TVVFERP DE FVR+WQLAC+  ++HVVVMP+V++E+++ FL+E  ++R
Sbjct  244  GVSVFLNALSITVVFERPNDETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSR  303

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
               ++       C+A DV   NC C LH
Sbjct  304  IALHQ-----DKCVAGDVSQENCLCSLH  326



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 142/204 (70%), Gaps = 3/204 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A L+       N  +   FKK IGS+SVSGHKF+GC MPCGVQ+T+  +I  +
Sbjct  237  YYIHCDAA-LYGLIVPFINHAKIITFKKSIGSISVSGHKFLGCSMPCGVQITKRTYITTI  295

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  VEY+AS D TI GSRNG APIFLWY+L+ KG  G QK+ + C  NA YLKD+L  AG
Sbjct  296  SKQVEYIASIDNTISGSRNGLAPIFLWYSLSMKGNAGLQKDAKICYENARYLKDRLHKAG  355

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            ISAMLNE S+ VVFERP D +F+RRWQL+C R+ +HVVVMP  T E +D F  +L+Q R 
Sbjct  356  ISAMLNEFSNIVVFERPCDNKFIRRWQLSCARDTAHVVVMPGTTKEIIDNFFKDLVQERE  415

Query  306  VWYEGGNSKPPCLAEDVGVSNCCC  235
             W   G +  PCLA+D+G  NC C
Sbjct  416  KW--CGITLGPCLADDIGSQNCLC  437



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 144/208 (69%), Gaps = 7/208 (3%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-A  670
            FYIHCD A +       +    K  FKKPIGS+ +SGHKF+GCP+PCGV +TRL  IN  
Sbjct  237  FYIHCDSALVGLMMPFIKQA-PKLTFKKPIGSICISGHKFIGCPIPCGVLITRLMDINHV  295

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            +S+N+EY++S D TI GSRNGHAPIFLWY L R GY G  K V+ CL+NA YL  +LR  
Sbjct  296  MSTNIEYISSNDTTIAGSRNGHAPIFLWYALKRIGYNGLCKTVENCLKNAQYLALRLREM  355

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            G+S  LN LS TVVFERP DE FVR+WQLAC+  ++HVVVMP+V++E+++ FL+E  ++R
Sbjct  356  GVSVFLNALSITVVFERPNDETFVRKWQLACQGKIAHVVVMPNVSLERINMFLEEFTKSR  415

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
               ++       C+A DV   NC C LH
Sbjct  416  IALHQD-----KCVAGDVSQENCLCSLH  438



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 142/208 (68%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN-A  670
            FYIHCDGA         +    K  FKK IGS+SVSGHK +GCP PCGV + RL  IN  
Sbjct  233  FYIHCDGALGGLMLPFIKQ-EPKLTFKKSIGSISVSGHKLLGCPTPCGVVVNRLKDINLV  291

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            +S+N+EY+ASRDATI GSRNGHAPI +WYTL   GY G + +V  C+R A YL+  L+  
Sbjct  292  MSTNIEYVASRDATITGSRNGHAPIIMWYTLKCLGYNGIRMKVTTCIRKAEYLEFLLKKK  351

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            G+S +LN  SSTV+FERPKDE FVR+WQLACE N++HVVVMP+V++  L  F+DEL + R
Sbjct  352  GVSTLLNPGSSTVIFERPKDEVFVRKWQLACEGNLAHVVVMPNVSIRHLFRFVDELAENR  411

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
             +         PC+A D+G  NC C LH
Sbjct  412  YIMLHDKEISTPCVAADIGPGNCMCNLH  439



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 143/208 (69%), Gaps = 2/208 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            +YIHCD A         ++  +K  F KPIGS+SVSGHKF+GCPMPCG+Q+TR  +++ L
Sbjct  235  YYIHCDAALSGLILPFIKHA-KKITFMKPIGSISVSGHKFLGCPMPCGIQITRKTYVSTL  293

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S  +EY+AS D TI GSR G  PIFLWY LN KG+ G Q++   C+ NA YLKDKL  AG
Sbjct  294  SK-IEYIASIDTTISGSRYGLTPIFLWYYLNMKGHAGLQQDSITCIENARYLKDKLVKAG  352

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AMLNE S  VVFERP D +F+ RWQL     ++H+VVMP +T E ++ F +EL+Q R 
Sbjct  353  IGAMLNEFSIIVVFERPCDHKFILRWQLCYLSGLAHIVVMPGITREIINSFFNELMQERK  412

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W++ G +KPPCLA++ G  NC C  +K
Sbjct  413  RWFQDGKTKPPCLADEFGSQNCMCSHNK  440



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   242 bits (618),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 5/209 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQ--KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            FYIHCDGA    +  +   + Q  K  FKKPIGSV++SGHKF+GCP PCGV +TRL +++
Sbjct  259  FYIHCDGA---LFGIMLPFIKQALKVSFKKPIGSVTISGHKFLGCPSPCGVVITRLKYMS  315

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
            A+S +V  +ASRDATI GSR GHAPIFLWY L ++G  G + EV +C+  AHYL + LR 
Sbjct  316  AISRDVGIIASRDATITGSRCGHAPIFLWYALKKRGLIGLENEVHECIMKAHYLLNLLRD  375

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            AGI AMLNE S+ VVFERP D++F R W LAC  N++HVVV+  V+VE LD F+ E I+ 
Sbjct  376  AGIGAMLNEFSNIVVFERPLDDDFNRSWNLACSGNIAHVVVLQHVSVEMLDTFVHEFIEK  435

Query  312  RSVWYEGGNSKPPCLAEDVGVSNCCCVLH  226
            RS+W +    KP C+A DVG  NC C++H
Sbjct  436  RSIWSKDEQFKPLCIANDVGSKNCACLMH  464



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   233 bits (593),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKP-IGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
            FYIHCDGA         +    +  F+KP IGSVSVSGHKF+GCP+PCGV +TR +H   
Sbjct  264  FYIHCDGALAGLIIPFLKQA-PRVTFRKPGIGSVSVSGHKFLGCPVPCGVVITRREHAAV  322

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            LS++V+Y++SRDATI GSRNGHAP+FLW  LN KG +G + +V +CLRNA +L  +LR A
Sbjct  323  LSTDVDYISSRDATITGSRNGHAPLFLWCALNAKGRRGIRDDVHRCLRNARFLARRLRDA  382

Query  489  GISAM-LNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            G+SA  LN LS TVV ERP+DE FVR+WQL+C+  ++HVVVMP+V V+K+  F+++L   
Sbjct  383  GVSAARLNPLSITVVLERPRDEAFVRKWQLSCQGGVAHVVVMPNVGVDKIASFVEDLAAK  442

Query  312  RSVWYEGGNS--KPPCLAEDVGVSNCCC  235
            R +WY  G      PC+A+D+G  NC C
Sbjct  443  RRIWYPHGEGLRVGPCVAKDIGQENCLC  470



>ref|NP_001234136.2| histidine decarboxylase [Solanum lycopersicum]
Length=446

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 143/206 (69%), Gaps = 3/206 (1%)
 Frame = -2

Query  849  GFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
             +YIHCD A         ++  +K  FKKPIGS+S+SGHKF+GCPM CGVQ+TR  +++ 
Sbjct  236  NYYIHCDAALCGLILPFIKHA-KKITFKKPIGSISISGHKFLGCPMSCGVQITRRSYVST  294

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            LS  +EY+ S DATI GSRNG  PIFLWY L++KG+   Q++   C+ NA YLKD+L  A
Sbjct  295  LSK-IEYINSADATISGSRNGFTPIFLWYCLSKKGHARLQQDSITCIENARYLKDRLLEA  353

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GIS MLN+ S TVVFERP D +F+RRW L C R M+HVV+MP +T E +D F  +L+Q R
Sbjct  354  GISVMLNDFSITVVFERPCDHKFIRRWNLCCLRGMAHVVIMPGITRETIDSFFKDLMQER  413

Query  309  SV-WYEGGNSKPPCLAEDVGVSNCCC  235
            +  WY+   + PPCLA+D G  NC C
Sbjct  414  NYKWYQDVKALPPCLADDFGSKNCMC  439



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIH DGA         +    +  F+KPIGSVSVSGHKF+G P+PCGV +TR  ++ AL
Sbjct  174  FYIHVDGALFGMMMPFIKKA-PRVSFRKPIGSVSVSGHKFIGAPVPCGVVITRQKYVAAL  232

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S++VEYL SRDATIMGSRNGHAPI++W+TL RKGY+G +K+V++CLRNA  LK  L  AG
Sbjct  233  SNDVEYLNSRDATIMGSRNGHAPIYMWFTLTRKGYEGMRKDVERCLRNALVLKSMLEQAG  292

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +  MLNELSSTVVFERP++E FVR+WQLACE  ++HVVVMP+V +  L+ F+ +LI +R+
Sbjct  293  VKVMLNELSSTVVFERPREEAFVRKWQLACEGEVAHVVVMPNVHMAILEEFVADLIASRT  352



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 143/209 (68%), Gaps = 2/209 (1%)
 Frame = -2

Query  849  GFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
             +YIHCD A         ++  +K  FKKPIGS+S+SGHKF+GCPMPCG+Q+TR  +++ 
Sbjct  235  NYYIHCDAALCGLILPFIKHA-KKITFKKPIGSISISGHKFLGCPMPCGIQITRKTYVST  293

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
              S +EY+ S DATI GSRNG  PIFLWY L++KG+   Q++   C+ NA YLKD+L  A
Sbjct  294  -HSKIEYINSTDATISGSRNGFTPIFLWYCLSKKGHARLQQDSITCIENARYLKDRLLEA  352

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GIS MLNE S TV+FER  D +F+ RW L   R M+HVVVMP +T E +D F  +L+Q R
Sbjct  353  GISVMLNEFSITVIFERSCDHKFIHRWNLCYLRGMAHVVVMPGITRETIDSFFKDLMQER  412

Query  309  SVWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
              W++ G ++PPCLA++ G  NC C  +K
Sbjct  413  KRWFQDGKTQPPCLADEFGSQNCMCSHNK  441



>gb|AEW07461.1| hypothetical protein 0_2106_01, partial [Pinus radiata]
 gb|AFG54678.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54680.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54681.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54683.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54684.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54685.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54688.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54689.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54690.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54691.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54692.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54693.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54694.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINAL
Sbjct  20   FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRIEHINAL  78

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLK + R AG
Sbjct  79   SRDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKGRFRSAG  138

Query  486  ISAMLNELSSTV  451
            ISAMLNELSSTV
Sbjct  139  ISAMLNELSSTV  150



>gb|AFG54679.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54682.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54686.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54687.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVGCPMPCGVQ+TR++HINAL
Sbjct  20   FYIHCDGALFGLMMPFVKRA-PKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRIEHINAL  78

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S +VEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAHYLK + R  G
Sbjct  79   SRDVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKGRFRSVG  138

Query  486  ISAMLNELSSTV  451
            ISAMLNELSSTV
Sbjct  139  ISAMLNELSSTV  150



>sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 144/206 (70%), Gaps = 4/206 (2%)
 Frame = -2

Query  849  GFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
             +YIHCD A         ++  +K  FKKPIGS+S+SGHKF+GCPM CGVQ+TR  +++ 
Sbjct  204  NYYIHCDRALCGLILPFIKHA-KKITFKKPIGSISISGHKFLGCPMSCGVQITRRSYVST  262

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            LS  +EY+ S DATI GSRNG  PIFLWY L++KG+   Q++   C+ NA YLKD+L  A
Sbjct  263  LSK-IEYINSADATISGSRNGFTPIFLWYCLSKKGHARLQQDSITCIENARYLKDRLLEA  321

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GIS MLN+ S TVVFERP D +F+RRW L C R M+HVV+MP +T E +D F  +L+Q R
Sbjct  322  GISVMLNDFSITVVFERPCDHKFIRRWNLCCLRGMAHVVIMPGITRETIDSFFKDLMQER  381

Query  309  SV-WYEGGNSKPPCLAEDVGVSNCCC  235
            +  WY+   + PPCLA+D+ + NC C
Sbjct  382  NYKWYQDVKALPPCLADDLAL-NCMC  406



>ref|XP_009609584.1| PREDICTED: histidine decarboxylase-like, partial [Nicotiana tomentosiformis]
Length=269

 Score =   219 bits (557),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 124/160 (78%), Gaps = 3/160 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCD A       I   ++    FKKPIGSV++SGHKF+GCPMPCGVQ+TR  +IN L
Sbjct  113  FYIHCDAA---LCGLIVPFINNMISFKKPIGSVTISGHKFLGCPMPCGVQITRKSYINNL  169

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
            S NVEY+AS DATI GSRNG  PIFLWY+L+ KG  G QK+V++CL NA YLKD+L+ AG
Sbjct  170  SRNVEYIASVDATISGSRNGLTPIFLWYSLSAKGQIGLQKDVKRCLDNAIYLKDRLQQAG  229

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVM  367
            IS MLNELS  VV ERP+D EFVRRWQL+C ++M+HV+VM
Sbjct  230  ISVMLNELSIIVVLERPRDHEFVRRWQLSCMKDMAHVIVM  269



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 133/208 (64%), Gaps = 35/208 (17%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVG                  
Sbjct  282  FYIHCDGALFGLMLPFVKRA-PKVSFKKPIGSVSVSGHKFVG------------------  322

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
                            SRNGHAPIFLWY+LN KGY+G QKEVQKCLRNAHY K +L  AG
Sbjct  323  ----------------SRNGHAPIFLWYSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAG  366

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AM+NELSSTVVFERP DEEFV +WQLAC+ N++HVVVMP+VT+EKL  FL+EL+Q R 
Sbjct  367  IGAMVNELSSTVVFERPHDEEFVHKWQLACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQ  426

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+  G  +P C+A  VG  NC C +H+
Sbjct  427  EWFRDGKCQPRCIASAVGHENCLCFIHR  454



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 133/208 (64%), Gaps = 35/208 (17%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  FKKPIGSVSVSGHKFVG                  
Sbjct  322  FYIHCDGALFGLMLPFVKRA-PKVSFKKPIGSVSVSGHKFVG------------------  362

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
                            SRNGHAPIFLWY+LN KGY+G QKEVQKCLRNAHY K +L  AG
Sbjct  363  ----------------SRNGHAPIFLWYSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAG  406

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I AM+NELSSTVVFERP DEEFV +WQLAC+ N++HVVVMP+VT+EKL  FL+EL+Q R 
Sbjct  407  IGAMVNELSSTVVFERPHDEEFVHKWQLACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQ  466

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCVLHK  223
             W+  G  +P C+A  VG  NC C +H+
Sbjct  467  EWFRDGKCQPRCIASAVGHENCLCFIHR  494



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 127/177 (72%), Gaps = 1/177 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         E    +  F+KPI S++VSGHK +GCPMPCGV L+R +H+  L
Sbjct  189  FYIHCDGALFALMMPFVE-FAPEVSFRKPIDSIAVSGHKMLGCPMPCGVALSRKEHVKNL  247

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
              +++YL S D TIMGSRNG A ++LWY+L +KG  G +++V  C+  A YLKD L   G
Sbjct  248  EQHIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIGGIKRDVMHCMETARYLKDALTAKG  307

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQ  316
            ++  LN+LSSTVV ERP D++ V+RWQLACE +++HVVVMP+VT  K+D F++EL+Q
Sbjct  308  LTCRLNDLSSTVVLERPMDDDLVKRWQLACEEDIAHVVVMPNVTRYKIDLFVEELMQ  364



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  867  VGIHIIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTR  688
            +GI    F+IHCDGA L+       +   +  F+KPI S++VSGHK +GCPMPCG+ LTR
Sbjct  182  LGIPRERFHIHCDGA-LFAMMMPFVDWAPEVSFQKPIDSIAVSGHKMLGCPMPCGIALTR  240

Query  687  LDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK  508
             +H+  +   ++YL S D TIMGSRNG A ++LWY+L +KG  G +++V  C+  A YL+
Sbjct  241  KEHVKKVEQKIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIAGIKRDVVHCMETAQYLR  300

Query  507  DKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLD  328
            DK+  AG++  LN+LSSTVV ERP D+ F++RWQLACE +++HVVVMP+VT  K+D F++
Sbjct  301  DKITEAGLTCRLNDLSSTVVLERPMDDAFIKRWQLACEEDIAHVVVMPNVTRFKIDKFVE  360

Query  327  ELIQARSVW  301
            EL++ ++V+
Sbjct  361  ELVECKNVY  369



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 137/205 (67%), Gaps = 4/205 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IHCDGA       + EN      F +PI S+SVSGHKF+GCPMP GV + R D++  +
Sbjct  472  FHIHCDGALSGLMLPLMENATVVADFTRPIDSMSVSGHKFMGCPMPAGVVICRKDNVKKV  531

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
              ++ YL S+D TIMGSRNG AP+F+W T+  KG  GF K+  +CL  A  L  +LR AG
Sbjct  532  EQHIAYLNSKDTTIMGSRNGQAPLFMWNTIQLKGKSGFAKDTHQCLTRAALLNKRLRDAG  591

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +S+MLN +S+TVVFERP +  FV++WQLACE N++H +VMP++T EK+  F+ EL+ +R 
Sbjct  592  VSSMLNPMSNTVVFERPDEHAFVKKWQLACEGNIAHAIVMPNITEEKIVVFVTELLASRK  651

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCV  232
               +G   K  C+A  +G +NC C 
Sbjct  652  A--QGTCDK--CVAMHIGRANCLCT  672



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 137/205 (67%), Gaps = 4/205 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IHCDGA       + EN      F +PI S+SVSGHKF+GCPMP GV + R D++  +
Sbjct  481  FHIHCDGALSGLMLPLMENATVVADFTRPIDSMSVSGHKFMGCPMPAGVVICRKDNVKKV  540

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
              ++ YL S+D TIMGSRNG AP+F+W T+  KG  GF K+  +CL  A  L  +LR AG
Sbjct  541  EQHIAYLNSKDTTIMGSRNGQAPLFMWNTIQLKGKSGFAKDTHQCLTRAALLNKRLRDAG  600

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +S+MLN +S+TVVFERP +  FV++WQLACE N++H +VMP++T EK+  F+ EL+ +R 
Sbjct  601  VSSMLNPMSNTVVFERPDEHAFVKKWQLACEGNIAHAIVMPNITEEKIVVFVTELLASRK  660

Query  306  VWYEGGNSKPPCLAEDVGVSNCCCV  232
               +G   K  C+A  +G +NC C 
Sbjct  661  A--QGTCDK--CVAMHIGRANCLCT  681



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 140/206 (68%), Gaps = 10/206 (5%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IHCDGA         E   +   F KPIGS+SVSGHKF+GCPMPCGV +TR  ++  L
Sbjct  235  FFIHCDGALFALILPFIEEALE-VNFTKPIGSISVSGHKFMGCPMPCGVTITRKRYVETL  293

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
             S+++YL S D TIMGSRNG A ++LW TL +KG +GF  + +KCL NA Y+   L+ AG
Sbjct  294  KSHIDYLNSVDTTIMGSRNGQASLYLWLTLRKKGTEGFASDARKCLENAKYMIKLLKEAG  353

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            +  +LN+ S+T+V ERP DEEFV++WQLACE  ++H +VMP+V+ +K++ F+++ +++R 
Sbjct  354  VGCLLNDHSNTIVLERPMDEEFVKKWQLACEGTVAHCIVMPNVSKQKIEDFVNDYLESRK  413

Query  306  VWYEGGNSKPP--CLAEDVGVSNCCC  235
                   S P   C+A+ +G  +C C
Sbjct  414  -------SHPADLCIAKHIGPVHCLC  432



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 118/179 (66%), Gaps = 2/179 (1%)
 Frame = -2

Query  858  HIIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDH  679
             I  FYIHCD A          N  Q   F KPI S+++SGHKF+G P+ CGV LTR + 
Sbjct  180  QIQDFYIHCDAALSGMMLPFVANAPQ-VNFTKPISSIAISGHKFIGSPLVCGVVLTRKEF  238

Query  678  INALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKL  499
            +N + ++++Y+ S+D TI+GSRNGHAP+FLWY L +K Y+G  KEV+ CL N+ YL + L
Sbjct  239  VNKIETSIDYIGSKDTTILGSRNGHAPLFLWYALKKKDYQGLAKEVEFCLENSQYLFNNL  298

Query  498  RGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  322
            +      MLN  S+TVVF++P   + V++WQLA + + +H+VVM ++   K+D F+ +L
Sbjct  299  QLLNYPCMLNNFSNTVVFKKPP-IQLVKKWQLATQGDWAHMVVMQNINRHKIDTFITDL  356



>ref|XP_003593127.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63378.1| serine decarboxylase [Medicago truncatula]
Length=124

 Score =   162 bits (410),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  558  GFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSH  379
             F+KEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+ N++H
Sbjct  7    SFEKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAH  66

Query  378  VVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  241
            VVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C
Sbjct  67   VVVMPNVTIEKLDDFLNELVQKRATWFEYGTFQPYCIASDVGENSC  112



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   174 bits (440),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 114/180 (63%), Gaps = 19/180 (11%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            FYIHCDGA         +    K  F KPIGS+SVSGHK +GCP PCGV + RL  I+ L
Sbjct  813  FYIHCDGALAGLMLPFIKQA-PKVTFIKPIGSISVSGHKLLGCPTPCGVVINRLKDIDVL  871

Query  666  -SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
             S+N+EY+AS D TI GSRNG +PIFLWY L   GY     EV            +LR  
Sbjct  872  KSTNIEYIASNDVTISGSRNGQSPIFLWYKLKSMGY-----EV------------RLRNV  914

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  310
            GISA +N  S  V+FE+PKDE F+++WQLAC  N++HVVVMP V+ E L  F++EL + R
Sbjct  915  GISAFMNSKSIIVIFEKPKDEMFMQKWQLACAGNVAHVVVMPHVSFEMLGIFVEELAEKR  974



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 122/189 (65%), Gaps = 3/189 (2%)
 Frame = -2

Query  858  HIIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDH  679
             I  +YIHCD A         ++  Q   F+KPI SV++SG KF+G P+PCGV LT+   
Sbjct  188  QIKDYYIHCDAALSGMILPFLDHAPQ-INFQKPIDSVAISG-KFIGSPIPCGVVLTKKKW  245

Query  678  INALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKL  499
            +  + + +EY+ S+D TI+GSRNGH P+ LWY L  KGY+GF +E + C++NA YL  +L
Sbjct  246  VEKVETMIEYIGSKDTTILGSRNGHTPLILWYALKTKGYEGFAQEAKTCIQNAQYLFQQL  305

Query  498  RGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  319
            +      MLN+ S+TVVF++P ++  +++WQLA   N +H++VM ++  +K+D F++EL+
Sbjct  306  QLREYPCMLNKFSNTVVFQKP-NQVLIKKWQLATLDNFAHLIVMQNIDRQKIDTFVNELV  364

Query  318  QARSVWYEG  292
                +  E 
Sbjct  365  LQEGILPES  373



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 123/198 (62%), Gaps = 5/198 (3%)
 Frame = -2

Query  852  IGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            + +YIHCDGA         +   +      PIGS+SVSGHKF+G P+  G+ LTR  ++N
Sbjct  192  VRYYIHCDGALGGMLIPFIKGAPKISFRDYPIGSISVSGHKFIGSPITYGIVLTRQPYVN  251

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             + ++VEY+ S+D TI+GSR+G A + LWY +  + +  FQKEV  CL+NA YL+D+L  
Sbjct  252  KIETSVEYIGSQDTTILGSRSGIAALLLWYAIQTRSHH-FQKEVASCLQNARYLRDRLLE  310

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
                 +LN+ S+TVVF++P   E  R+WQLA E N +HVVVM  ++ +K+D F+  L+  
Sbjct  311  INYHPLLNDFSTTVVFDKPGI-ELCRKWQLATEENFAHVVVMQHISTQKIDLFIQNLLVN  369

Query  312  RSVWYE---GGNSKPPCL  268
            + +  E    GN K  C+
Sbjct  370  KEIENEKVLTGNRKTMCV  387



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 124/202 (61%), Gaps = 5/202 (2%)
 Frame = -2

Query  852  IGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            + FYIHCDGA         +   +      PIGS+SVSGHKF+G P+  G+ LTR  ++N
Sbjct  192  VRFYIHCDGALGGMLLPFIKEAPKISFRDYPIGSISVSGHKFIGSPITYGIVLTRQPYVN  251

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             + ++VEY+ S+D TI+GSR+G   + LWY +  +  + FQKEV  CL+NA YL+D+L  
Sbjct  252  KIETSVEYIGSQDTTILGSRSGITALLLWYAIQTRS-QHFQKEVASCLQNARYLRDRLLE  310

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
                 +LN+ S+TVVF++P   E  R+WQLA E+N++H+VVM  ++ +K+D F+  L+  
Sbjct  311  RNYHPLLNDFSTTVVFDKP-GIELCRKWQLATEQNLAHIVVMQHISTQKIDLFIQNLLVN  369

Query  312  RSVWYEGG---NSKPPCLAEDV  256
            + +  E     N K  C+   V
Sbjct  370  KEIGNEKALTENRKTICVINSV  391



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -2

Query  852  IGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            I FYIHCDGA         +   +      PIGS+SVSGHKF+G P+  G+ LTR  ++ 
Sbjct  192  IRFYIHCDGALGGMLLPFIQEAPKISFRDYPIGSISVSGHKFIGSPITYGIVLTRQPYVK  251

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             + ++VEY+ S+D TI+GSR+G A + LWY +  +  + F +EV  CL+NA YL+D+L  
Sbjct  252  KIETSVEYIGSKDMTILGSRSGLAALLLWYAIQTRN-QQFHREVATCLQNARYLRDRLLE  310

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  319
                 +LN+ S+TVVF++P D E  R+WQLA E N++H+VVM  ++ +K+D F+D L+
Sbjct  311  INYHPLLNDFSTTVVFDKP-DIELCRKWQLATEGNLAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 121/191 (63%), Gaps = 6/191 (3%)
 Frame = -2

Query  852  IGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            + FYIHCDGA         +   +    + PIGS+SVSGHKF+G P+  G+ LTR  ++N
Sbjct  192  VRFYIHCDGALGAMLLPFIKKAPKISFQEYPIGSISVSGHKFIGSPITYGIVLTRQPYVN  251

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             + +++EY+ S+D TI+GSR+G A + LWY + R   + FQKEV  CL+NA YL+D+L  
Sbjct  252  KIETSIEYIGSQDTTILGSRSGIAALLLWYAI-RTRSQHFQKEVASCLQNARYLRDRLLE  310

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
                 +LN+ S TVVF++P   E  R+WQLA E N++HVVVM  ++ +K+D F+  L+  
Sbjct  311  INYHPLLNDFSITVVFDKPGI-ELCRKWQLATEENLAHVVVMQHISSQKIDLFIRNLLVN  369

Query  312  RSVWYEGGNSK  280
            + +    GN K
Sbjct  370  KEI----GNEK  376



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -2

Query  852  IGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHIN  673
            I FYIHCDGA         +   +      PIGS+SVSGHKF+G P+  G+ LTR  ++ 
Sbjct  192  IRFYIHCDGALGGMLLPFIQEAPKISFRDYPIGSISVSGHKFIGSPVTYGIVLTRQPYVK  251

Query  672  ALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRG  493
             + ++VEY+ S+D TI+GSR+G A +FLWY +  +  + F KEV  CL+NA YL+D+L  
Sbjct  252  KIETSVEYIGSKDMTILGSRSGLAALFLWYAIQTRS-QHFHKEVANCLQNARYLRDRLLE  310

Query  492  AGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  319
                 +LN+ S+TVVF++P   E  R+WQLA + N++H+VVM  ++ +K+D F+D L+
Sbjct  311  INYHPLLNDFSTTVVFDKPAI-ELCRKWQLATQGNIAHIVVMQHISTQKIDQFIDNLL  367



>ref|XP_005840580.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
 gb|EKX53600.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
Length=338

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 117/180 (65%), Gaps = 4/180 (2%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IH DGA +     +   ++    FK+ I S+++SGHKF+G P PCGV +T     + +
Sbjct  161  FHIHADGALM---GFVLPYIYNNLSFKRHINSIAISGHKFLGTPFPCGVFVTEKKFRSLI  217

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
             + ++Y+ S D TI+GSRNGHAP+FL + +  K  KGF+++V +CL  A +L ++++  G
Sbjct  218  ENRIDYIDSVDDTILGSRNGHAPLFLKHIITVKQNKGFKEDVFRCLYLAQWLVNRMQSLG  277

Query  486  ISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARS  307
            I A +N+LS TV+F RP  E  V+RWQLA   N+SHVVVMP VT E L+ FL E +   S
Sbjct  278  IDAWMNDLSITVIFPRPA-EIVVKRWQLASNGNLSHVVVMPHVTQEMLEVFLKEYLANPS  336



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 113/180 (63%), Gaps = 3/180 (2%)
 Frame = -2

Query  858  HIIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDH  679
             I  +YIHCD A         +   Q   F+KPI SV++S  KF+G P+PCGV LT+   
Sbjct  188  QIKDYYIHCDAALSGLILPFLDGAPQ-VNFQKPIDSVAISA-KFIGSPLPCGVVLTKKKW  245

Query  678  INALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKL  499
            +  + + +EY+ S+D TI+GSRNGH P+ LWY +  +GY G  KE + C+ NA YL  +L
Sbjct  246  VEKVETEIEYIGSKDTTILGSRNGHTPLILWYAVQTRGYDGLAKEAKTCIHNAQYLFQQL  305

Query  498  RGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELI  319
            +      MLN  S+TVVF++P  +  +++WQLA   N +H++VM ++  EK+D F++EL+
Sbjct  306  QIREYPCMLNNFSNTVVFQKP-SQRLIKKWQLAVFENWAHMIVMQNIVREKIDIFINELL  364



>ref|WP_040468965.1| histidine decarboxylase, partial [Fischerella thermalis]
Length=165

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = -2

Query  762  PIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  583
            PIGS+SVSGHKF+G P+  G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A +FLWY
Sbjct  7    PIGSISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALFLWY  66

Query  582  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  403
             +  +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQL
Sbjct  67   AIQTRS-QHFHKEVANCLQNARYLRDRLLELDYHPLLNDFSTTVVFDKPA-IELCRKWQL  124

Query  402  ACERNMSHVVVMPSVTVEKLDCFLDELI  319
            A + N++H+VVM  ++ +K+D F+D L+
Sbjct  125  ATQGNIAHIVVMQHISTQKIDQFIDNLL  152



>ref|WP_045055559.1| histidine decarboxylase [Chroococcales cyanobacterium CENA595]
 gb|KJH70970.1| histidine decarboxylase [Chroococcales cyanobacterium CENA595]
Length=373

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 113/178 (63%), Gaps = 3/178 (2%)
 Frame = -2

Query  855  IIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHI  676
            I  +YIHCDGA         +   +   F +PI SV++S  KF+G P+PCGV LT+  ++
Sbjct  190  IQNYYIHCDGALSGMMLPFLKGAPE-INFNQPIDSVAISA-KFIGSPLPCGVVLTKKHYV  247

Query  675  NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLR  496
              + + +EY+ S+D TI+GSRNGH+ + LW+ +  +GY GF +E   C+ NA YL  +L+
Sbjct  248  EKVETLIEYIGSKDTTILGSRNGHSSLILWHAIKTRGYSGFAREAATCIENARYLYKQLK  307

Query  495  GAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  322
                  +LNE S+TVVF +P   + ++RWQLA   + +H++VM ++  +K+D FLDEL
Sbjct  308  LRRYPCLLNEFSNTVVFAKPS-LQLIKRWQLAVLEDWAHIIVMQNIDKQKIDSFLDEL  364



>ref|WP_004156018.1| histidine decarboxylase [Microscilla marina]
 gb|EAY28093.1| histidine decarboxylase [Microscilla marina ATCC 23134]
Length=389

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 114/178 (64%), Gaps = 4/178 (2%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIHCDGA   T+ A  E     F FK    S+S+SGHKFVG P+PCGV +T+  + + ++
Sbjct  203  YIHCDGALAGTFGAFIE-PRLPFDFKDGADSISISGHKFVGSPIPCGVIVTKKSNRDRIA  261

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
              + Y+ S D TI GSRNGH+P+FLWY L + G +G +      L  A Y ++KL+ AGI
Sbjct  262  KGISYIGSLDTTITGSRNGHSPLFLWYGLKKMGEEGLRARYLYSLDIARYCENKLKEAGI  321

Query  483  SAMLNELSSTVVFERPKDEEFVR-RWQLACERNMSHVVVMPSVTVEKLDCFLDELIQA  313
            +A  N  + TVV   PK  E ++ +WQLA E +MSH++ MP+VT  ++D F+++++ +
Sbjct  322  TAWRNPEAITVVL--PKTTESIKQKWQLATEGDMSHIICMPNVTRAQIDEFVEDIVNS  377



>ref|NP_001176002.1| Os10g0105700 [Oryza sativa Japonica Group]
 dbj|BAH94730.1| Os10g0105700 [Oryza sativa Japonica Group]
Length=219

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -2

Query  780  KFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHA  601
            K  FKKPIGS+SVSGHKF+GCPMPCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHA
Sbjct  117  KVSFKKPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHA  176

Query  600  PIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK  508
            PIFLWYTL++KGYKG  KEV  C+ NA YL+
Sbjct  177  PIFLWYTLSKKGYKGLLKEVHICMGNARYLE  207



>ref|WP_026731780.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=364

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 117/185 (63%), Gaps = 2/185 (1%)
 Frame = -2

Query  861  IHIIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLD  682
            ++I  F++HCD A         ++  +      PIGS++VSGHKF+G P+  G+ LTR +
Sbjct  182  VNITQFHLHCDAALGGMLLPFIDSAPKISFQDYPIGSIAVSGHKFIGSPIHFGIVLTRRE  241

Query  681  HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDK  502
            ++  +   +EYL + D TI GSR G   +FLWY +  +G K F +EV  CL NA YL+D+
Sbjct  242  YVQKIGKRIEYLGTDDTTITGSRCGLNALFLWYAIATRGQK-FAREVVTCLENAQYLRDR  300

Query  501  LRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  322
            L+  G + +LN+ S TV F++P   +   +WQLA E N++HVVVM  ++ +K++  +D+L
Sbjct  301  LQQIGYNPLLNDFSITVAFKKPP-AKVCDKWQLAIEGNLAHVVVMQHISTQKINELIDDL  359

Query  321  IQARS  307
            +QA++
Sbjct  360  LQAQA  364



>ref|WP_008878268.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans]
 emb|CCV09416.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans 
STM 2683]
Length=366

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 3/175 (2%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKF--XFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINA  670
            Y+H DGA         ENV       FK  I S+S SGHK +G PMPCG+ + R +H+N 
Sbjct  173  YLHVDGALNGMVIPFLENVESGIIPSFKHEIDSISASGHKMIGTPMPCGILVARRNHVNR  232

Query  669  LSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGA  490
            ++S++ YL S D T+MGSRNGHA I +W  +   G  GFQ+E Q CL  A  L  +LR  
Sbjct  233  IASSISYLRSNDTTLMGSRNGHASIAIWERIVELGEDGFQRETQACLARATRLAQRLRQM  292

Query  489  GISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDE  325
            G+  + N+ S T+VF +P D + V+ +QLAC+  ++H +VMP+V  E ++ F+ +
Sbjct  293  GVPVLQNKHSLTLVFPKPND-DIVKMYQLACDGELAHAIVMPNVNDELINRFIHD  346



>ref|WP_014680621.1| histidine decarboxylase [Solitalea canadensis]
 gb|AFD07394.1| PLP-dependent enzyme, glutamate decarboxylase [Solitalea canadensis 
DSM 3403]
Length=376

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 111/183 (61%), Gaps = 4/183 (2%)
 Frame = -2

Query  855  IIGFYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHI  676
            I  +YIHCDGA   T      N    F F     S+++SGHKF+G P+P GV L +  H 
Sbjct  192  IQNYYIHCDGALSGTMSPFL-NPRPAFDFADGADSIAISGHKFIGSPIPSGVLLVKKSHR  250

Query  675  NALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLR  496
            + +  +V Y+ S D TI GSRNGH+P+FLWY +   G +GF+K V   L  A Y +++L+
Sbjct  251  DRIGRSVAYIGSLDTTITGSRNGHSPLFLWYAIKTLGLEGFKKRVDHSLSVAAYAENRLK  310

Query  495  GAGISAMLNELSSTVVFERPKDEEFVR-RWQLACERNMSHVVVMPSVTVEKLDCFLDELI  319
              G+ A  N+ + TVVF +P   E VR +WQLA ER +SH++ MP+VT  ++D  + ++ 
Sbjct  311  SIGLDAWRNQNAITVVFPQP--HEIVRKKWQLASERGLSHIICMPNVTESQIDELILDIE  368

Query  318  QAR  310
            + R
Sbjct  369  KYR  371



>ref|WP_025665600.1| histidine decarboxylase [Aquimarina megaterium]
Length=373

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 106/174 (61%), Gaps = 2/174 (1%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIH D A    +        Q F F+  I S+S+SGHKF+G PMP GV + + D+ + ++
Sbjct  195  YIHADAALAGGFAPFVTPRPQ-FDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIA  253

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
              + Y+ S DATI GSRNGH P+FLWY + + G +GF+K  +  L  A Y ++KL+  GI
Sbjct  254  RRIAYIGSSDATITGSRNGHTPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENKLKDLGI  313

Query  483  SAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  322
             A  N  + T+VF  P   E + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  314  EAWRNPNAITIVFPAPS-TEIIDKWQLATENGQSHIICMPNVSYEQIDSFIADI  366



>ref|WP_034238501.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=373

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 106/174 (61%), Gaps = 2/174 (1%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIH D A    +        Q F F+  I S+S+SGHKF+G PMP GV + + D+ + ++
Sbjct  195  YIHADAALAGGFAPFVTPRPQ-FDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIA  253

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
              + Y+ S DATI GSRNGH P+FLWY + + G +GF+K  +  L  A Y ++KL+  GI
Sbjct  254  RRIAYIGSSDATITGSRNGHTPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENKLKNLGI  313

Query  483  SAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  322
             A  N  + T+VF  P   E + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  314  EAWRNPNAITIVFPAPS-TEIIDKWQLATENGQSHIICMPNVSYEQIDNFIADI  366



>gb|EZH75803.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=377

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 106/174 (61%), Gaps = 2/174 (1%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIH D A    +        Q F F+  I S+S+SGHKF+G PMP GV + + D+ + ++
Sbjct  199  YIHADAALAGGFAPFVTPRPQ-FDFEDGIDSISISGHKFIGSPMPSGVVIVKKDNRDRIA  257

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
              + Y+ S DATI GSRNGH P+FLWY + + G +GF+K  +  L  A Y ++KL+  GI
Sbjct  258  RRIAYIGSSDATITGSRNGHTPLFLWYAIKKLGVEGFKKRTEHSLGVASYTENKLKNLGI  317

Query  483  SAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDEL  322
             A  N  + T+VF  P   E + +WQLA E   SH++ MP+V+ E++D F+ ++
Sbjct  318  EAWRNPNAITIVFPAPS-TEIIDKWQLATENGQSHIICMPNVSYEQIDNFIADI  370



>ref|WP_034760693.1| histidine decarboxylase [Chryseobacterium sp. OV259]
Length=376

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 2/182 (1%)
 Frame = -2

Query  843  YIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINALS  664
            YIHCD A   +Y A  E     F FK    S+S+SGHKF+G P+P GV +T+    + ++
Sbjct  196  YIHCDAALSGSYGAFMEP-RSPFDFKDGADSISISGHKFIGSPIPSGVIITKRTLRDKIA  254

Query  663  SNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGI  484
              V Y+ S D TI GSRNGH+ +FLWY +   G +G +K     +  A Y K KL   GI
Sbjct  255  KGVSYIGSLDTTITGSRNGHSSLFLWYAVKNMGIEGLKKRYLHSMEVAQYCKSKLIELGI  314

Query  483  SAMLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSV  304
             A  NE + TVVF +  D     +WQLA E +++H++ MP+VT E++D F+ +L++ + V
Sbjct  315  EAWTNEGAITVVFPKTSD-AIKEKWQLATEEDLTHLICMPNVTKEQIDEFIKDLVKDKEV  373

Query  303  WY  298
             Y
Sbjct  374  IY  375



>dbj|BAH97114.1| amino acid decarboxylase [Naegleria fowleri]
Length=307

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -2

Query  846  FYIHCDGAPLWTYDAICENVHQKFXFKKPIGSVSVSGHKFVGCPMPCGVQLTRLDHINAL  667
            F+IHCDGA         E   +   F KP+GS+SVSGHKF+GCPMPCGV +TR  ++  L
Sbjct  176  FFIHCDGALFALILPFIEEALE-VNFTKPVGSISVSGHKFMGCPMPCGVTITRKRYVETL  234

Query  666  SSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAG  487
             S+++YL S D TIMGSRNG A ++LW TL +KG +GF K+ +KCL NA Y++  LR AG
Sbjct  235  KSHIDYLNSVDTTIMGSRNGQASLYLWLTLRKKGTEGFAKDARKCLGNAKYMEQLLRDAG  294

Query  486  ISAMLNELSSTVV  448
            +  +LN  S+T+V
Sbjct  295  VGCLLNPHSNTIV  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1936147003653