BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8260

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598530.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like        132   7e-32   
ref|XP_009760118.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    130   3e-31   Nicotiana sylvestris
ref|XP_009760117.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    130   9e-31   Nicotiana sylvestris
ref|XP_009767961.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like        130   2e-30   Nicotiana sylvestris
ref|XP_009622639.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    128   3e-30   
ref|XP_006343225.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    129   5e-30   Solanum tuberosum [potatoes]
ref|XP_009622638.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    127   9e-30   Nicotiana tomentosiformis
ref|XP_010317439.1|  PREDICTED: uncharacterized protein LOC101250...    125   9e-29   Solanum lycopersicum
ref|XP_010317438.1|  PREDICTED: uncharacterized protein LOC101250...    125   9e-29   
ref|XP_006377394.1|  zinc finger family protein                         122   1e-27   
ref|XP_011043420.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    121   2e-27   Populus euphratica
ref|XP_011043419.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    121   2e-27   Populus euphratica
ref|XP_011043418.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    121   2e-27   Populus euphratica
ref|XP_007025565.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    117   4e-26   
ref|XP_008225130.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    114   3e-25   
ref|XP_008225128.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    114   5e-25   
ref|XP_007211370.1|  hypothetical protein PRUPE_ppa002526mg             114   6e-25   
ref|XP_002305122.2|  zinc finger family protein                         105   2e-24   
ref|XP_010686421.1|  PREDICTED: uncharacterized protein LOC104900...    111   9e-24   
ref|XP_010686420.1|  PREDICTED: uncharacterized protein LOC104900...    111   1e-23   
ref|XP_006361026.1|  PREDICTED: uncharacterized protein LOC102581...    110   1e-23   Solanum tuberosum [potatoes]
ref|XP_011460576.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    110   1e-23   Fragaria vesca subsp. vesca
ref|XP_004293802.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    110   1e-23   Fragaria vesca subsp. vesca
ref|XP_011460575.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    110   1e-23   Fragaria vesca subsp. vesca
emb|CDO99511.1|  unnamed protein product                                110   2e-23   Coffea canephora [robusta coffee]
gb|KJB57510.1|  hypothetical protein B456_009G167600                    109   3e-23   Gossypium raimondii
ref|XP_011096339.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    108   4e-23   
ref|XP_006449384.1|  hypothetical protein CICLE_v10014553mg             108   7e-23   
ref|XP_012091649.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    108   7e-23   
ref|XP_012091648.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    108   7e-23   Jatropha curcas
ref|XP_012091647.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    108   8e-23   Jatropha curcas
ref|XP_006467756.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    108   8e-23   Citrus sinensis [apfelsine]
gb|KDO77654.1|  hypothetical protein CISIN_1g003507mg                   108   9e-23   Citrus sinensis [apfelsine]
ref|XP_006467754.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...    108   9e-23   Citrus sinensis [apfelsine]
ref|XP_009352887.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1             107   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_006361027.1|  PREDICTED: uncharacterized protein LOC102581...    105   3e-22   
ref|XP_008383703.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like        105   5e-22   
gb|KJB68637.1|  hypothetical protein B456_010G256500                    104   1e-21   Gossypium raimondii
gb|KJB68635.1|  hypothetical protein B456_010G256500                    104   2e-21   Gossypium raimondii
gb|KJB68638.1|  hypothetical protein B456_010G256500                    104   2e-21   Gossypium raimondii
gb|KJB68639.1|  hypothetical protein B456_010G256500                    103   2e-21   Gossypium raimondii
ref|XP_010272379.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...    104   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010272377.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-21   Nelumbo nucifera [Indian lotus]
gb|KHG29652.1|  Zinc finger CCCH domain-containing 27 -like protein     103   4e-21   Gossypium arboreum [tree cotton]
ref|XP_009397197.1|  PREDICTED: zinc finger CCCH domain-containin...    102   8e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011096340.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  99.8    3e-20   
ref|XP_011628978.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1             100   4e-20   
gb|ERM93742.1|  hypothetical protein AMTR_s00004p00261980               100   4e-20   Amborella trichopoda
gb|EPS61456.1|  hypothetical protein M569_13342                       92.8    5e-20   Genlisea aurea
ref|XP_010655449.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  99.8    6e-20   Vitis vinifera
ref|XP_003593623.1|  Zinc finger CCCH domain-containing protein       99.0    1e-19   Medicago truncatula
gb|KEH36560.1|  zinc finger C-x8-C-x5-C-x3-H type protein             99.0    1e-19   Medicago truncatula
ref|XP_008439823.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  98.6    1e-19   Cucumis melo [Oriental melon]
ref|XP_008356058.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like      98.2    2e-19   
ref|XP_008371700.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like      98.2    2e-19   
ref|XP_010057376.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1           97.1    4e-19   Eucalyptus grandis [rose gum]
gb|KCW74544.1|  hypothetical protein EUGRSUZ_E03255                   96.7    6e-19   Eucalyptus grandis [rose gum]
gb|KHG12575.1|  Zinc finger CCCH domain-containing 27 -like protein   96.7    6e-19   Gossypium arboreum [tree cotton]
gb|KGN49245.1|  hypothetical protein Csa_6G518020                     95.9    1e-18   Cucumis sativus [cucumbers]
ref|XP_004134948.2|  PREDICTED: uncharacterized protein LOC101203293  95.5    2e-18   Cucumis sativus [cucumbers]
ref|XP_010928945.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    2e-18   Elaeis guineensis
ref|XP_009342631.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like      95.5    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008777661.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    2e-18   Phoenix dactylifera
gb|KJB57509.1|  hypothetical protein B456_009G167600                  94.4    3e-18   Gossypium raimondii
ref|XP_010655448.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  94.4    4e-18   
ref|XP_008789751.1|  PREDICTED: zinc finger CCCH domain-containin...  93.6    8e-18   
ref|XP_008789750.1|  PREDICTED: zinc finger CCCH domain-containin...  93.6    8e-18   Phoenix dactylifera
ref|XP_004485810.1|  PREDICTED: uncharacterized protein DDB_G0283...  93.2    9e-18   
ref|XP_004485809.1|  PREDICTED: uncharacterized protein DDB_G0283...  93.2    9e-18   Cicer arietinum [garbanzo]
ref|XP_004485808.1|  PREDICTED: uncharacterized protein DDB_G0283...  93.2    1e-17   Cicer arietinum [garbanzo]
gb|AEW08394.1|  hypothetical protein 2_8201_01                        85.9    1e-17   Pinus radiata
ref|XP_003547155.2|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like      92.8    1e-17   
gb|KHN18955.1|  Zinc finger CCCH domain-containing protein 27         92.8    1e-17   Glycine soja [wild soybean]
ref|XP_012087634.1|  PREDICTED: zinc finger CCCH domain-containin...  91.7    4e-17   Jatropha curcas
ref|XP_009143827.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1           89.7    1e-16   Brassica rapa
emb|CDY17206.1|  BnaA05g09820D                                        89.0    2e-16   Brassica napus [oilseed rape]
emb|CAN59796.1|  hypothetical protein VITISV_001904                   89.0    2e-16   Vitis vinifera
ref|XP_006410533.1|  hypothetical protein EUTSA_v10016429mg           88.2    3e-16   
ref|XP_007048330.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  89.0    3e-16   
ref|XP_007048331.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  89.0    3e-16   
ref|XP_010111195.1|  Zinc finger CCCH domain-containing protein 27    88.6    3e-16   
ref|XP_006594577.1|  PREDICTED: uncharacterized protein YFR016C-l...  88.6    4e-16   Glycine max [soybeans]
gb|KHN08501.1|  Zinc finger CCCH domain-containing protein 27         88.2    4e-16   Glycine soja [wild soybean]
gb|KJB18751.1|  hypothetical protein B456_003G068000                  87.8    6e-16   Gossypium raimondii
ref|XP_010540460.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  87.4    7e-16   Tarenaya hassleriana [spider flower]
gb|KJB18742.1|  hypothetical protein B456_003G068000                  87.4    8e-16   Gossypium raimondii
gb|KJB18743.1|  hypothetical protein B456_003G068000                  87.4    8e-16   Gossypium raimondii
ref|XP_010509824.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  86.3    1e-15   Camelina sativa [gold-of-pleasure]
gb|KJB29889.1|  hypothetical protein B456_005G122500                  87.0    1e-15   Gossypium raimondii
gb|KJB29890.1|  hypothetical protein B456_005G122500                  87.0    1e-15   Gossypium raimondii
ref|XP_010469420.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  86.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002527649.1|  hypothetical protein RCOM_1278130                87.0    1e-15   
ref|XP_010030848.1|  PREDICTED: uncharacterized protein LOC104420...  86.3    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010030843.1|  PREDICTED: uncharacterized protein LOC104420...  86.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010469419.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  86.3    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010509823.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  85.9    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010030832.1|  PREDICTED: uncharacterized protein LOC104420...  86.7    2e-15   Eucalyptus grandis [rose gum]
ref|XP_007148139.1|  hypothetical protein PHAVU_006G183400g           86.3    2e-15   Phaseolus vulgaris [French bean]
ref|XP_006293824.1|  hypothetical protein CARUB_v10022810mg           85.9    2e-15   
ref|XP_010090865.1|  Zinc finger CCCH domain-containing protein 38    86.3    2e-15   
ref|XP_009795159.1|  PREDICTED: uncharacterized protein LOC104241896  86.3    2e-15   Nicotiana sylvestris
ref|XP_009593595.1|  PREDICTED: bromodomain-containing protein 4-...  86.3    2e-15   Nicotiana tomentosiformis
ref|XP_006293825.1|  hypothetical protein CARUB_v10022810mg           85.5    2e-15   
ref|XP_002881309.1|  frigida-essential 1                              85.1    3e-15   Arabidopsis lyrata subsp. lyrata
gb|KFK24426.1|  hypothetical protein AALP_AAs55026U000500             85.1    3e-15   Arabis alpina [alpine rockcress]
gb|KDO65703.1|  hypothetical protein CISIN_1g000480mg                 85.5    3e-15   Citrus sinensis [apfelsine]
ref|XP_004301108.1|  PREDICTED: serine/arginine repetitive matrix...  85.9    4e-15   Fragaria vesca subsp. vesca
ref|XP_011464300.1|  PREDICTED: serine/arginine repetitive matrix...  85.9    4e-15   Fragaria vesca subsp. vesca
gb|ABK25348.1|  unknown                                               84.3    4e-15   Picea sitchensis
gb|KDO65701.1|  hypothetical protein CISIN_1g000480mg                 85.5    4e-15   Citrus sinensis [apfelsine]
gb|KDO65697.1|  hypothetical protein CISIN_1g000480mg                 85.5    4e-15   Citrus sinensis [apfelsine]
gb|KDO65700.1|  hypothetical protein CISIN_1g000480mg                 85.5    4e-15   Citrus sinensis [apfelsine]
ref|XP_006440779.1|  hypothetical protein CICLE_v10018493mg           85.5    4e-15   
ref|XP_006440778.1|  hypothetical protein CICLE_v10018493mg           85.5    4e-15   
emb|CDY27932.1|  BnaCnng05170D                                        84.7    4e-15   Brassica napus [oilseed rape]
gb|KDO65696.1|  hypothetical protein CISIN_1g000480mg                 85.5    4e-15   Citrus sinensis [apfelsine]
ref|XP_006440777.1|  hypothetical protein CICLE_v10018493mg           85.5    4e-15   
gb|KDO65695.1|  hypothetical protein CISIN_1g000480mg                 85.5    5e-15   Citrus sinensis [apfelsine]
ref|XP_010042580.1|  PREDICTED: zinc finger CCCH domain-containin...  81.3    5e-15   Eucalyptus grandis [rose gum]
ref|XP_011628568.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    5e-15   Amborella trichopoda
gb|EEC74757.1|  hypothetical protein OsI_10522                        82.8    5e-15   Oryza sativa Indica Group [Indian rice]
gb|ERN19938.1|  hypothetical protein AMTR_s00071p00110320             84.7    6e-15   Amborella trichopoda
ref|XP_011657760.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    6e-15   Cucumis sativus [cucumbers]
ref|XP_002278177.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    6e-15   Vitis vinifera
ref|XP_010245822.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    6e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006477692.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    6e-15   
ref|XP_006477693.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    6e-15   
ref|XP_006477694.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    7e-15   
emb|CBI19970.3|  unnamed protein product                              84.7    7e-15   Vitis vinifera
ref|XP_011657755.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    8e-15   Cucumis sativus [cucumbers]
ref|XP_011657759.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    8e-15   Cucumis sativus [cucumbers]
emb|CAN61511.1|  hypothetical protein VITISV_013331                   84.3    8e-15   Vitis vinifera
ref|XP_008439820.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  84.0    1e-14   Cucumis melo [Oriental melon]
ref|XP_006649632.1|  PREDICTED: nuclear receptor coactivator 6-like   84.0    1e-14   Oryza brachyantha
ref|XP_008439827.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  83.6    1e-14   
gb|EYU23832.1|  hypothetical protein MIMGU_mgv1a003868mg              83.2    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_010105373.1|  Zinc finger CCCH domain-containing protein 55    83.2    1e-14   Morus notabilis
emb|CBI15319.3|  unnamed protein product                              84.0    1e-14   Vitis vinifera
ref|XP_002438162.1|  hypothetical protein SORBIDRAFT_10g008980        80.1    1e-14   
ref|XP_008239998.1|  PREDICTED: serine/arginine repetitive matrix...  84.0    1e-14   Prunus mume [ume]
ref|XP_007208403.1|  hypothetical protein PRUPE_ppa001169mg           83.6    1e-14   Prunus persica
ref|XP_002265512.2|  PREDICTED: uncharacterized protein LOC100246698  84.0    1e-14   Vitis vinifera
dbj|BAJ95044.1|  predicted protein                                    83.2    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010030916.1|  PREDICTED: serine/arginine repetitive matrix...  83.6    2e-14   
ref|XP_008645057.1|  PREDICTED: hypothetical protein isoform X2       83.6    2e-14   Zea mays [maize]
gb|EEE58583.1|  hypothetical protein OsJ_09910                        83.2    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010030912.1|  PREDICTED: serine/arginine repetitive matrix...  83.6    2e-14   Eucalyptus grandis [rose gum]
ref|NP_001169577.1|  hypothetical protein                             83.6    2e-14   Zea mays [maize]
ref|XP_011623976.1|  PREDICTED: uncharacterized protein LOC184357...  83.6    2e-14   Amborella trichopoda
ref|XP_007210311.1|  hypothetical protein PRUPE_ppa002296mg           82.8    2e-14   
ref|NP_001049373.1|  Os03g0214900                                     83.2    2e-14   
ref|XP_011623975.1|  PREDICTED: uncharacterized protein LOC184357...  83.6    2e-14   Amborella trichopoda
ref|XP_010030905.1|  PREDICTED: serine/arginine repetitive matrix...  83.6    2e-14   Eucalyptus grandis [rose gum]
gb|KCW83742.1|  hypothetical protein EUGRSUZ_B00614                   83.2    2e-14   Eucalyptus grandis [rose gum]
dbj|BAD93829.1|  hypothetical protein                                 78.2    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010027683.1|  PREDICTED: zinc finger CCCH domain-containin...  82.8    2e-14   Eucalyptus grandis [rose gum]
ref|XP_009386491.1|  PREDICTED: uncharacterized protein LOC103973599  83.2    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022967.1|  PREDICTED: zinc finger CCCH domain-containin...  82.4    3e-14   Populus euphratica
ref|XP_011022964.1|  PREDICTED: zinc finger CCCH domain-containin...  82.4    3e-14   Populus euphratica
ref|XP_007037601.1|  Uncharacterized protein isoform 1                82.4    4e-14   
ref|XP_006292961.1|  hypothetical protein CARUB_v10019238mg           79.3    4e-14   Capsella rubella
ref|XP_008231642.1|  PREDICTED: zinc finger CCCH domain-containin...  82.4    4e-14   Prunus mume [ume]
gb|AAO72717.1|  unknown protein                                       80.9    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502920.1|  PREDICTED: zinc finger CCCH domain-containin...  82.0    4e-14   Cicer arietinum [garbanzo]
ref|XP_006371890.1|  hypothetical protein POPTR_0018s05310g           81.3    7e-14   
emb|CDX79547.1|  BnaC03g18830D                                        80.9    7e-14   
ref|XP_004488474.1|  PREDICTED: uncharacterized protein LOC101503...  81.6    7e-14   
ref|XP_004488473.1|  PREDICTED: uncharacterized protein LOC101503...  81.6    7e-14   Cicer arietinum [garbanzo]
ref|XP_002307020.2|  hypothetical protein POPTR_0005s06240g           81.3    7e-14   
ref|XP_006354749.1|  PREDICTED: uncharacterized protein LOC102603...  81.6    7e-14   Solanum tuberosum [potatoes]
ref|XP_011009255.1|  PREDICTED: uncharacterized protein LOC105114...  81.3    8e-14   Populus euphratica
ref|XP_004985193.1|  PREDICTED: zinc finger CCCH domain-containin...  81.3    8e-14   
ref|XP_003595771.1|  Zinc finger CCCH domain-containing protein       81.3    9e-14   Medicago truncatula
ref|XP_011009254.1|  PREDICTED: uncharacterized protein LOC105114...  80.9    9e-14   Populus euphratica
ref|XP_004985192.1|  PREDICTED: zinc finger CCCH domain-containin...  81.3    9e-14   Setaria italica
ref|XP_008365252.1|  PREDICTED: zinc finger CCCH domain-containin...  80.9    9e-14   
ref|XP_010030823.1|  PREDICTED: uncharacterized protein LOC104420...  80.9    9e-14   
ref|XP_008441040.1|  PREDICTED: zinc finger CCCH domain-containin...  80.9    9e-14   Cucumis melo [Oriental melon]
ref|XP_011007566.1|  PREDICTED: zinc finger CCCH domain-containin...  80.9    9e-14   Populus euphratica
ref|XP_011007564.1|  PREDICTED: zinc finger CCCH domain-containin...  80.9    9e-14   Populus euphratica
ref|XP_011007563.1|  PREDICTED: zinc finger CCCH domain-containin...  80.9    1e-13   Populus euphratica
ref|XP_011072878.1|  PREDICTED: uncharacterized protein LOC105157993  81.3    1e-13   Sesamum indicum [beniseed]
ref|XP_010030812.1|  PREDICTED: uncharacterized protein LOC104420...  80.9    1e-13   
ref|XP_002310510.2|  hypothetical protein POPTR_0007s03970g           80.9    1e-13   Populus trichocarpa [western balsam poplar]
ref|NP_850221.1|  zinc finger domain protein FES1                     80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354057.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_008441033.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    1e-13   Cucumis melo [Oriental melon]
ref|XP_006464625.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    1e-13   Citrus sinensis [apfelsine]
ref|XP_008441039.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    1e-13   Cucumis melo [Oriental melon]
ref|XP_006464624.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    1e-13   Citrus sinensis [apfelsine]
gb|EYU23117.1|  hypothetical protein MIMGU_mgv1a001325mg              80.5    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_006464626.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    2e-13   Citrus sinensis [apfelsine]
ref|XP_008803631.1|  PREDICTED: zinc finger CCCH domain-containin...  80.5    2e-13   Phoenix dactylifera
gb|KDO58340.1|  hypothetical protein CISIN_1g043773mg                 80.1    2e-13   Citrus sinensis [apfelsine]
ref|XP_010936458.1|  PREDICTED: uncharacterized protein LOC105056082  80.1    2e-13   
ref|XP_009338137.1|  PREDICTED: uncharacterized protein LOC103930516  80.1    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_003528232.1|  PREDICTED: uncharacterized protein LOC100807...  80.1    2e-13   Glycine max [soybeans]
ref|XP_010322582.1|  PREDICTED: uncharacterized protein LOC101261...  80.1    2e-13   Solanum lycopersicum
ref|XP_010322581.1|  PREDICTED: uncharacterized protein LOC101261...  80.1    2e-13   Solanum lycopersicum
ref|XP_008360880.1|  PREDICTED: uncharacterized protein LOC103424566  79.7    3e-13   
ref|XP_006578526.1|  PREDICTED: serine/arginine repetitive matrix...  79.7    3e-13   Glycine max [soybeans]
ref|XP_004288332.1|  PREDICTED: zinc finger CCCH domain-containin...  79.3    3e-13   Fragaria vesca subsp. vesca
ref|XP_006581761.1|  PREDICTED: zinc finger CCCH domain-containin...  79.0    3e-13   
ref|XP_011466807.1|  PREDICTED: zinc finger CCCH domain-containin...  79.3    3e-13   Fragaria vesca subsp. vesca
ref|XP_007138369.1|  hypothetical protein PHAVU_009G202700g           79.3    4e-13   Phaseolus vulgaris [French bean]
ref|NP_566802.1|  histone-lysine N-methyltransferase                  76.3    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528041.1|  PREDICTED: zinc finger CCCH domain-containin...  79.0    4e-13   
ref|XP_002876993.1|  hypothetical protein ARALYDRAFT_347050           76.3    4e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_009132957.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like      78.2    4e-13   Brassica rapa
ref|XP_010550283.1|  PREDICTED: zinc finger CCCH domain-containin...  78.6    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_009132962.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  78.2    5e-13   
ref|XP_006406582.1|  hypothetical protein EUTSA_v10020512mg           78.2    6e-13   
ref|XP_007137708.1|  hypothetical protein PHAVU_009G149100g           78.6    6e-13   Phaseolus vulgaris [French bean]
ref|NP_188494.1|  zinc finger CCCH domain-containing protein 38       77.8    8e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDP20617.1|  unnamed protein product                              78.2    9e-13   Coffea canephora [robusta coffee]
ref|XP_011074773.1|  PREDICTED: zinc finger CCCH domain-containin...  77.8    9e-13   Sesamum indicum [beniseed]
ref|XP_010514354.1|  PREDICTED: zinc finger CCCH domain-containin...  75.1    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004237737.1|  PREDICTED: zinc finger CCCH domain-containin...  77.4    1e-12   Solanum lycopersicum
ref|XP_004237735.1|  PREDICTED: zinc finger CCCH domain-containin...  77.8    1e-12   Solanum lycopersicum
ref|XP_002885268.1|  hypothetical protein ARALYDRAFT_898233           77.4    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_010425413.1|  PREDICTED: zinc finger CCCH domain-containin...  75.1    1e-12   Camelina sativa [gold-of-pleasure]
emb|CAN65994.1|  hypothetical protein VITISV_031553                   75.9    1e-12   Vitis vinifera
ref|XP_011648492.1|  PREDICTED: uncharacterized protein LOC101219633  77.4    1e-12   Cucumis sativus [cucumbers]
ref|XP_010497111.1|  PREDICTED: zinc finger CCCH domain-containin...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
gb|KEH35591.1|  zinc finger C-x8-C-x5-C-x3-H type protein, putative   77.0    2e-12   Medicago truncatula
gb|AES72838.2|  zinc finger C-x8-C-x5-C-x3-H type protein, putative   76.6    2e-12   Medicago truncatula
ref|XP_010923915.1|  PREDICTED: zinc finger CCCH domain-containin...  76.6    2e-12   Elaeis guineensis
ref|XP_010680246.1|  PREDICTED: zinc finger CCCH domain-containin...  76.6    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003602587.1|  Zinc finger CCCH domain-containing protein       76.6    3e-12   
ref|XP_010260301.1|  PREDICTED: uncharacterized protein LOC104599449  75.5    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002891459.1|  predicted protein                                76.3    3e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_009136421.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1           75.5    3e-12   Brassica rapa
ref|XP_006578794.1|  PREDICTED: zinc finger CCCH domain-containin...  76.3    3e-12   Glycine max [soybeans]
ref|XP_006578792.1|  PREDICTED: zinc finger CCCH domain-containin...  76.3    3e-12   Glycine max [soybeans]
emb|CDX93701.1|  BnaA06g03470D                                        75.5    5e-12   
ref|XP_009147935.1|  PREDICTED: zinc finger CCCH domain-containin...  75.5    5e-12   Brassica rapa
ref|XP_010500425.1|  PREDICTED: zinc finger CCCH domain-containin...  75.5    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010500427.1|  PREDICTED: zinc finger CCCH domain-containin...  75.1    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008392056.1|  PREDICTED: zinc finger CCCH domain-containin...  75.5    6e-12   
emb|CDY40613.1|  BnaC06g02290D                                        75.1    6e-12   Brassica napus [oilseed rape]
ref|XP_006306863.1|  hypothetical protein CARUB_v10008408mg           75.1    7e-12   Capsella rubella
ref|XP_006394549.1|  hypothetical protein EUTSA_v10004428mg           73.9    7e-12   Eutrema salsugineum [saltwater cress]
ref|XP_010522535.1|  PREDICTED: flocculation protein FLO11 isofor...  74.3    9e-12   Tarenaya hassleriana [spider flower]
gb|EEC79460.1|  hypothetical protein OsI_20470                        74.7    9e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010522527.1|  PREDICTED: flocculation protein FLO11 isofor...  74.3    9e-12   Tarenaya hassleriana [spider flower]
sp|Q75K81.1|C3H36_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...  74.7    9e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001778840.1|  predicted protein                                68.9    1e-11   
ref|XP_010258014.1|  PREDICTED: serine/arginine repetitive matrix...  74.7    1e-11   Nelumbo nucifera [Indian lotus]
ref|XP_004503948.1|  PREDICTED: zinc finger CCCH domain-containin...  74.3    1e-11   Cicer arietinum [garbanzo]
ref|XP_004503949.1|  PREDICTED: zinc finger CCCH domain-containin...  73.9    2e-11   
emb|CDP18065.1|  unnamed protein product                              74.3    2e-11   Coffea canephora [robusta coffee]
gb|KJB19433.1|  hypothetical protein B456_003G101900                  73.9    2e-11   Gossypium raimondii
ref|XP_010461740.1|  PREDICTED: zinc finger CCCH domain-containin...  73.6    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010413801.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  73.2    2e-11   
ref|XP_008785610.1|  PREDICTED: uncharacterized protein LOC103704...  73.9    2e-11   
gb|KEH20898.1|  zinc finger C-x8-C-x5-C-x3-H type family protein      73.6    2e-11   Medicago truncatula
ref|XP_008785608.1|  PREDICTED: serine/arginine repetitive matrix...  73.9    2e-11   
ref|XP_003630250.1|  Zinc finger CCCH domain-containing protein       73.6    2e-11   Medicago truncatula
ref|XP_011019431.1|  PREDICTED: uncharacterized protein LOC105122...  73.6    2e-11   Populus euphratica
ref|XP_011012618.1|  PREDICTED: uncharacterized protein LOC105116...  73.6    2e-11   Populus euphratica
ref|XP_010939191.1|  PREDICTED: uncharacterized protein LOC105058097  73.9    2e-11   Elaeis guineensis
ref|XP_012080401.1|  PREDICTED: serine/arginine repetitive matrix...  73.6    2e-11   Jatropha curcas
ref|XP_009393329.1|  PREDICTED: zinc finger CCCH domain-containin...  73.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393328.1|  PREDICTED: zinc finger CCCH domain-containin...  73.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393327.1|  PREDICTED: zinc finger CCCH domain-containin...  73.6    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB19434.1|  hypothetical protein B456_003G101900                  73.6    2e-11   Gossypium raimondii
ref|XP_010413800.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  73.2    2e-11   
ref|XP_009112587.1|  PREDICTED: zinc finger CCCH domain-containin...  73.2    2e-11   
gb|KJB19432.1|  hypothetical protein B456_003G101900                  73.6    2e-11   Gossypium raimondii
emb|CDY18532.1|  BnaA01g26630D                                        72.8    4e-11   Brassica napus [oilseed rape]
ref|XP_004972916.1|  PREDICTED: zinc finger CCCH domain-containin...  72.8    4e-11   Setaria italica
ref|XP_010549343.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  72.4    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_010549345.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  72.4    6e-11   Tarenaya hassleriana [spider flower]
gb|KHF98921.1|  hypothetical protein F383_18133                       72.4    6e-11   Gossypium arboreum [tree cotton]
ref|XP_008809119.1|  PREDICTED: zinc finger CCCH domain-containin...  71.6    1e-10   Phoenix dactylifera
ref|XP_006580330.1|  PREDICTED: uncharacterized protein LOC102670057  70.9    1e-10   
gb|KDO65702.1|  hypothetical protein CISIN_1g000480mg                 71.2    1e-10   Citrus sinensis [apfelsine]
emb|CDX95510.1|  BnaC01g34020D                                        70.5    2e-10   
gb|EYU17414.1|  hypothetical protein MIMGU_mgv1a001764mg              70.5    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_010695245.1|  PREDICTED: zinc finger CCCH domain-containin...  70.5    2e-10   
ref|XP_010695244.1|  PREDICTED: uncharacterized protein LOC104907...  70.5    3e-10   
ref|XP_010906738.1|  PREDICTED: zinc finger CCCH domain-containin...  69.7    4e-10   
ref|XP_010906741.1|  PREDICTED: zinc finger CCCH domain-containin...  69.7    5e-10   
ref|NP_001060944.1|  Os08g0135800                                     69.3    5e-10   
ref|XP_004503947.1|  PREDICTED: zinc finger CCCH domain-containin...  69.3    5e-10   
gb|ADZ04636.1|  hypothetical protein                                  69.3    5e-10   
gb|EAZ05511.1|  hypothetical protein OsI_27727                        69.3    5e-10   
ref|NP_001148144.1|  zinc finger C-x8-C-x5-C-x3-H type family pro...  68.9    5e-10   
gb|EAZ41439.1|  hypothetical protein OsJ_25961                        69.3    5e-10   
ref|XP_008647823.1|  PREDICTED: zinc finger C-x8-C-x5-C-x3-H type...  68.9    5e-10   
gb|ERN07562.1|  hypothetical protein AMTR_s00154p00086540             69.3    6e-10   
ref|XP_009629285.1|  PREDICTED: zinc finger CCCH domain-containin...  69.3    6e-10   
ref|XP_002992469.1|  hypothetical protein SELMODRAFT_448779           68.2    6e-10   
ref|XP_006659097.1|  PREDICTED: zinc finger CCCH domain-containin...  68.9    7e-10   
ref|XP_002514638.1|  hypothetical protein RCOM_1469330                68.9    8e-10   
gb|AFW78541.1|  hypothetical protein ZEAMMB73_745426                  68.6    8e-10   
ref|XP_006655451.1|  PREDICTED: zinc finger CCCH domain-containin...  68.6    9e-10   
ref|XP_001754459.1|  predicted protein                                68.6    9e-10   
ref|XP_006356284.1|  PREDICTED: zinc finger CCCH domain-containin...  68.2    1e-09   
gb|EMT02379.1|  Zinc finger CCCH domain-containing protein 55         68.2    1e-09   
gb|EMS58846.1|  Zinc finger CCCH domain-containing protein 55         68.2    1e-09   
ref|XP_010487786.1|  PREDICTED: zinc finger CCCH domain-containin...  68.2    1e-09   
ref|XP_011101707.1|  PREDICTED: zinc finger CCCH domain-containin...  68.2    1e-09   
ref|XP_006297102.1|  hypothetical protein CARUB_v10013105mg           68.2    1e-09   
gb|KEH20899.1|  zinc finger C-x8-C-x5-C-x3-H type family protein      67.8    1e-09   
gb|EMS48921.1|  hypothetical protein TRIUR3_25454                     67.8    1e-09   
gb|EMT05437.1|  hypothetical protein F775_05324                       67.8    2e-09   
gb|KEH20897.1|  zinc finger C-x8-C-x5-C-x3-H type family protein      67.8    2e-09   
ref|XP_010234284.1|  PREDICTED: zinc finger CCCH domain-containin...  67.8    2e-09   
ref|XP_009765123.1|  PREDICTED: zinc finger CCCH domain-containin...  67.4    2e-09   
ref|XP_010507053.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  67.0    2e-09   
emb|CDX84667.1|  BnaA03g15630D                                        65.9    4e-09   
gb|KHN22339.1|  Zinc finger CCCH domain-containing protein 55         65.9    7e-09   
ref|XP_011099759.1|  PREDICTED: zinc finger CCCH domain-containin...  62.8    8e-09   
ref|XP_010465975.1|  PREDICTED: zinc finger CCCH domain-containin...  65.5    8e-09   
ref|NP_001055943.2|  Os05g0497500                                     64.3    2e-08   
ref|XP_009132961.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1-like ...  64.3    2e-08   
gb|KHN34067.1|  Zinc finger CCCH domain-containing protein 38         63.9    2e-08   
dbj|BAJ87088.1|  predicted protein                                    63.5    4e-08   
ref|XP_008662908.1|  PREDICTED: zinc finger CCCH domain-containin...  63.5    4e-08   
gb|EMS64902.1|  hypothetical protein TRIUR3_35462                     62.4    9e-08   
ref|XP_008810746.1|  PREDICTED: uncharacterized protein LOC103722082  62.0    1e-07   
ref|XP_011012614.1|  PREDICTED: uncharacterized protein LOC105116...  60.8    3e-07   
ref|XP_011019428.1|  PREDICTED: uncharacterized protein LOC105122...  60.8    3e-07   
dbj|BAK05835.1|  predicted protein                                    60.5    5e-07   
gb|EMT23516.1|  hypothetical protein F775_14183                       60.1    6e-07   
ref|XP_002441320.1|  hypothetical protein SORBIDRAFT_09g024420        59.7    6e-07   
ref|XP_002443818.1|  hypothetical protein SORBIDRAFT_07g002750        59.3    1e-06   
gb|AAS82598.1|  hypothetical protein S250_18C08.12                    59.3    1e-06   
ref|XP_003559719.1|  PREDICTED: uncharacterized protein LOC100828436  58.9    1e-06   
ref|XP_009403101.1|  PREDICTED: uncharacterized protein LOC103986733  58.5    1e-06   
ref|XP_010540463.1|  PREDICTED: protein FRIGIDA-ESSENTIAL 1 isofo...  58.5    2e-06   
gb|EPS64428.1|  hypothetical protein M569_10352                       54.7    2e-06   
ref|XP_011012617.1|  PREDICTED: uncharacterized protein LOC105116...  58.5    2e-06   
ref|XP_011019430.1|  PREDICTED: uncharacterized protein LOC105122...  58.5    2e-06   
ref|NP_001050514.1|  Os03g0569000                                     57.8    3e-06   
ref|XP_002309494.1|  hypothetical protein POPTR_0006s24370g           57.0    6e-06   
gb|EEE59375.1|  hypothetical protein OsJ_11487                        56.6    1e-05   
gb|ABF97182.1|  expressed protein                                     56.2    1e-05   
ref|XP_004961627.1|  PREDICTED: zinc finger CCCH domain-containin...  55.8    2e-05   
emb|CDM83558.1|  unnamed protein product                              55.8    2e-05   
ref|XP_006651557.1|  PREDICTED: uncharacterized protein LOC102720418  54.3    6e-05   



>ref|XP_009598530.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Nicotiana tomentosiformis]
Length=504

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 28/183 (15%)
 Frame = -3

Query  730  KDAVPRNLSEKE-----KELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSN  566
            +D +P NLSEKE      +  DTA AHQE+I  +S                +ADK + S 
Sbjct  339  RDILPDNLSEKELSNNEADTADTAVAHQEHINTSS----------------KADKLNLST  382

Query  565  DTVQKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPT  404
            + +Q+   + K + + E +  GN++D        V+++SR LK F +A+VEF+KELLKPT
Sbjct  383  E-LQRTRLRKKTKSEFERLGHGNEIDIDWKTDRSVNKESRVLKHFHAALVEFVKELLKPT  441

Query  403  WREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            W EGL+S DAYK IVKKT    ++++ P Q+   ++S+++YLS +QPKL KL+  YVDKY
Sbjct  442  WSEGLMSKDAYKIIVKKTVDKVVNSLHPHQVPGTAESIRQYLSVSQPKLAKLIEAYVDKY  501

Query  223  GRS  215
            G+S
Sbjct  502  GKS  504



>ref|XP_009760118.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009760119.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Nicotiana 
sylvestris]
Length=559

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 109/172 (63%), Gaps = 18/172 (10%)
 Frame = -3

Query  724  AVPRNLSEKEKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNG  545
            A  ++L+  E+E  D A AHQEN+  TS KE++ P+S               N   QK  
Sbjct  404  AAEKDLTADERETADRATAHQENVN-TSSKEEKHPRSV--------------NPRGQKR-  447

Query  544  AQYKMELKVESVKSGNDV--DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAY  371
             Q K+E    + +  ND   DG V+ +S  LK F +A+VEF+KELLKPTW EGLL  DAY
Sbjct  448  TQSKLEGPRHNYEIDNDFRRDGSVNYESGVLKHFRAALVEFVKELLKPTWHEGLLIRDAY  507

Query  370  KAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            K IVKK+    ++++QP+QI D ++S+K+YLS ++PK+ KL+ GYV+KYG+S
Sbjct  508  KMIVKKSVDKVINSLQPDQIPDTTESIKQYLSVSKPKVAKLIEGYVEKYGKS  559



>ref|XP_009760117.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Nicotiana 
sylvestris]
Length=666

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 109/172 (63%), Gaps = 18/172 (10%)
 Frame = -3

Query  724  AVPRNLSEKEKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNG  545
            A  ++L+  E+E  D A AHQEN+  TS KE++ P+S               N   QK  
Sbjct  511  AAEKDLTADERETADRATAHQENVN-TSSKEEKHPRSV--------------NPRGQKR-  554

Query  544  AQYKMELKVESVKSGNDV--DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAY  371
             Q K+E    + +  ND   DG V+ +S  LK F +A+VEF+KELLKPTW EGLL  DAY
Sbjct  555  TQSKLEGPRHNYEIDNDFRRDGSVNYESGVLKHFRAALVEFVKELLKPTWHEGLLIRDAY  614

Query  370  KAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            K IVKK+    ++++QP+QI D ++S+K+YLS ++PK+ KL+ GYV+KYG+S
Sbjct  615  KMIVKKSVDKVINSLQPDQIPDTTESIKQYLSVSKPKVAKLIEGYVEKYGKS  666



>ref|XP_009767961.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like, partial [Nicotiana 
sylvestris]
Length=690

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 111/183 (61%), Gaps = 28/183 (15%)
 Frame = -3

Query  730  KDAVPRNLSEKE-----KELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSN  566
            +D +P NLSEKE      +  DTA AHQE++  +S                +ADK + S 
Sbjct  525  RDILPDNLSEKELSNNEADTADTAVAHQEHVNTSS----------------KADKLNLST  568

Query  565  DTVQKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPT  404
            + +     + K + + E +  GN++D        V+++SR LK F +A+VEFIKELLKPT
Sbjct  569  ELLHTR-LRKKTKSEFERLGHGNEIDIDWKTDRSVNKESRILKHFHAALVEFIKELLKPT  627

Query  403  WREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            W EGL+S DAYK IVKKT    ++++ P Q+   ++S+++YLS +QPKL KL+  YVDKY
Sbjct  628  WSEGLMSKDAYKIIVKKTADKVVNSLHPHQVPGTAESIRQYLSVSQPKLAKLIEAYVDKY  687

Query  223  GRS  215
            G+S
Sbjct  688  GKS  690



>ref|XP_009622639.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=559

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 18/172 (10%)
 Frame = -3

Query  724  AVPRNLSEKEKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNG  545
            A  ++L+  E+E  D A  HQEN+  TS KE++ P+                N   QK  
Sbjct  404  AAEKDLTADERETTDRATTHQENVN-TSSKEEKHPRPV--------------NPRGQKR-  447

Query  544  AQYKMELKVESVKSGNDV--DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAY  371
             Q K+E    + +  ND   DG V+ +S  LK F +A+VEF+KELLKPTW EGLL  DAY
Sbjct  448  TQSKLERPRHNYEIDNDFRRDGSVNYESGVLKHFRAALVEFVKELLKPTWHEGLLIRDAY  507

Query  370  KAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            K IVKK+    ++++QP+QI D ++S+K+YLS ++PK+ KL+ GYV+KYG+S
Sbjct  508  KMIVKKSVDKVINSLQPDQIPDTTESIKQYLSVSKPKVAKLIEGYVEKYGKS  559



>ref|XP_006343225.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343226.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343227.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006343228.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X4 [Solanum 
tuberosum]
Length=848

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 115/183 (63%), Gaps = 15/183 (8%)
 Frame = -3

Query  730  KDAVPRNLSEK-----EKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSN  566
            +D +P NLSEK     E +  DTA AHQE    TS KE++  +SA+    T+ADK   + 
Sbjct  670  RDILPDNLSEKDMSTNETDTADTAVAHQE--INTSSKEEKYSRSANLRGATKADKQLSTE  727

Query  565  DTVQKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPT  404
              + +   + K + + E ++ G ++D        V+++SR +K F +A+VEF+KELL+PT
Sbjct  728  --LPRTRTRKKTQSESERLRHGTEIDIDRKTDRSVNKESRVMKHFHAALVEFVKELLRPT  785

Query  403  WREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            W EGL+S DAYK IVKKT    ++++ P QI   ++S+++YL  +Q KL KL+  YV+KY
Sbjct  786  WSEGLMSKDAYKMIVKKTIDKVVNSLHPNQIPGTAESIRQYLDLSQQKLAKLIEAYVEKY  845

Query  223  GRS  215
            G+S
Sbjct  846  GKS  848



>ref|XP_009622638.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=668

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 18/172 (10%)
 Frame = -3

Query  724  AVPRNLSEKEKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNG  545
            A  ++L+  E+E  D A  HQEN+  TS KE++ P+                N   QK  
Sbjct  513  AAEKDLTADERETTDRATTHQENVN-TSSKEEKHPRPV--------------NPRGQKR-  556

Query  544  AQYKMELKVESVKSGNDV--DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAY  371
             Q K+E    + +  ND   DG V+ +S  LK F +A+VEF+KELLKPTW EGLL  DAY
Sbjct  557  TQSKLERPRHNYEIDNDFRRDGSVNYESGVLKHFRAALVEFVKELLKPTWHEGLLIRDAY  616

Query  370  KAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            K IVKK+    ++++QP+QI D ++S+K+YLS ++PK+ KL+ GYV+KYG+S
Sbjct  617  KMIVKKSVDKVINSLQPDQIPDTTESIKQYLSVSKPKVAKLIEGYVEKYGKS  668



>ref|XP_010317439.1| PREDICTED: uncharacterized protein LOC101250369 isoform X2 [Solanum 
lycopersicum]
Length=782

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 113/183 (62%), Gaps = 15/183 (8%)
 Frame = -3

Query  730  KDAVPRNLSEK-----EKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSN  566
            +D +P  LSEK     E +  DTA AHQE    TS KE +  +SA+    T+ADK   + 
Sbjct  604  RDILPDYLSEKDMSTNETDTADTAVAHQE--INTSSKEDKYSRSANLRGATKADKQLSTE  661

Query  565  DTVQKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPT  404
              + +   + K + + E ++ G ++D        V+++SR +K F +A+VEF+KELL+PT
Sbjct  662  --LPRTRTRKKTQSESERLRHGTEIDIDRKTDRSVNKESRVMKHFHAALVEFVKELLRPT  719

Query  403  WREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            W EGL+S DAYK IVKKT    ++++ P QI   ++S+++YL  +Q KL KL+  YV+KY
Sbjct  720  WSEGLMSKDAYKMIVKKTINKVVNSLHPNQIPGTAESIRQYLDLSQQKLAKLIEAYVEKY  779

Query  223  GRS  215
            G+S
Sbjct  780  GKS  782



>ref|XP_010317438.1| PREDICTED: uncharacterized protein LOC101250369 isoform X1 [Solanum 
lycopersicum]
Length=816

 Score =   125 bits (315),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 113/183 (62%), Gaps = 15/183 (8%)
 Frame = -3

Query  730  KDAVPRNLSEK-----EKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSN  566
            +D +P  LSEK     E +  DTA AHQE    TS KE +  +SA+    T+ADK   + 
Sbjct  638  RDILPDYLSEKDMSTNETDTADTAVAHQE--INTSSKEDKYSRSANLRGATKADKQLSTE  695

Query  565  DTVQKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPT  404
              + +   + K + + E ++ G ++D        V+++SR +K F +A+VEF+KELL+PT
Sbjct  696  --LPRTRTRKKTQSESERLRHGTEIDIDRKTDRSVNKESRVMKHFHAALVEFVKELLRPT  753

Query  403  WREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            W EGL+S DAYK IVKKT    ++++ P QI   ++S+++YL  +Q KL KL+  YV+KY
Sbjct  754  WSEGLMSKDAYKMIVKKTINKVVNSLHPNQIPGTAESIRQYLDLSQQKLAKLIEAYVEKY  813

Query  223  GRS  215
            G+S
Sbjct  814  GKS  816



>ref|XP_006377394.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP55191.1| zinc finger family protein [Populus trichocarpa]
Length=669

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGND------VDGLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q +G++++ +LK +SV+  ND      + G   ++S+ L+ F SA+++F+K+LLKPTWRE
Sbjct  550  QTDGSRHEKDLKADSVRQNNDMEVDQKIGGDTQKESKVLRHFRSALIDFVKDLLKPTWRE  609

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVKKT    LST+QP QI    +S+K+YLS +QPK+ KLV GY+ KYG+S
Sbjct  610  GHLSKDAHNTIVKKTVEKVLSTLQPHQIPATVESIKQYLSSSQPKMAKLVEGYISKYGKS  669



>ref|XP_011043420.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X3 [Populus euphratica]
Length=648

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGND------VDGLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q + +++K +LK +SV+  ND      + G + ++S+ L+ F +A+++F+K+LLKPTWRE
Sbjct  529  QIDRSRHKKDLKADSVRQNNDMEVDQKIGGDLQKESKVLRHFRAALIDFVKDLLKPTWRE  588

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVKKT    LST+QP QI  N +S+K+YLS +QPK+ KLV GY+ KYG+S
Sbjct  589  GHLSKDAHNTIVKKTVEKVLSTLQPHQIPANVESIKQYLSSSQPKMAKLVEGYISKYGKS  648



>ref|XP_011043419.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Populus euphratica]
Length=753

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGND------VDGLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q + +++K +LK +SV+  ND      + G + ++S+ L+ F +A+++F+K+LLKPTWRE
Sbjct  634  QIDRSRHKKDLKADSVRQNNDMEVDQKIGGDLQKESKVLRHFRAALIDFVKDLLKPTWRE  693

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVKKT    LST+QP QI  N +S+K+YLS +QPK+ KLV GY+ KYG+S
Sbjct  694  GHLSKDAHNTIVKKTVEKVLSTLQPHQIPANVESIKQYLSSSQPKMAKLVEGYISKYGKS  753



>ref|XP_011043418.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Populus euphratica]
Length=756

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGND------VDGLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q + +++K +LK +SV+  ND      + G + ++S+ L+ F +A+++F+K+LLKPTWRE
Sbjct  637  QIDRSRHKKDLKADSVRQNNDMEVDQKIGGDLQKESKVLRHFRAALIDFVKDLLKPTWRE  696

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVKKT    LST+QP QI  N +S+K+YLS +QPK+ KLV GY+ KYG+S
Sbjct  697  GHLSKDAHNTIVKKTVEKVLSTLQPHQIPANVESIKQYLSSSQPKMAKLVEGYISKYGKS  756



>ref|XP_007025565.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007025566.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007025567.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28187.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28188.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28189.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
Length=784

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDV------DGLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q++G++ K +LKV+ V+  N++      DG   ++S+A+K F +A+V+ IKELLKPTWRE
Sbjct  665  QRDGSRCKKDLKVDRVREKNEIEVEHKADGDPQKESKAMKHFRAALVDLIKELLKPTWRE  724

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G L+ DA+  IVKK     L T+QP QI    +SVK+YLS +QPK+ KLV GYVDKY +S
Sbjct  725  GHLNRDAHNTIVKKAVDKVLGTVQPHQIPITFESVKQYLSSSQPKIAKLVQGYVDKYSKS  784



>ref|XP_008225130.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Prunus mume]
Length=648

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 92/147 (63%), Gaps = 7/147 (5%)
 Frame = -3

Query  634  EKQLPKSADFGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGNDVDGL------VH  476
            E+ L + +    +T+  KT    D+  Q + +++K ++ V+  +  N+VDG       V 
Sbjct  502  EENLSRPSHPKGSTKPHKTSSYGDSRPQSDSSRHKKDITVDRFRENNEVDGEHVTDGDVQ  561

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            Q+S+AL+ F +A+VE +KELLKP WREG LS DA+  IVKK     LS  QP+QI    +
Sbjct  562  QESKALRHFRAALVELVKELLKPKWREGCLSKDAHNKIVKKAVEKVLSAFQPQQIPPTVE  621

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +V +YLS  +PK+ KLV GYV+KYG+S
Sbjct  622  TVVQYLSSCRPKISKLVEGYVEKYGKS  648



>ref|XP_008225128.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Prunus mume]
Length=718

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 92/147 (63%), Gaps = 7/147 (5%)
 Frame = -3

Query  634  EKQLPKSADFGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGNDVDGL------VH  476
            E+ L + +    +T+  KT    D+  Q + +++K ++ V+  +  N+VDG       V 
Sbjct  572  EENLSRPSHPKGSTKPHKTSSYGDSRPQSDSSRHKKDITVDRFRENNEVDGEHVTDGDVQ  631

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            Q+S+AL+ F +A+VE +KELLKP WREG LS DA+  IVKK     LS  QP+QI    +
Sbjct  632  QESKALRHFRAALVELVKELLKPKWREGCLSKDAHNKIVKKAVEKVLSAFQPQQIPPTVE  691

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +V +YLS  +PK+ KLV GYV+KYG+S
Sbjct  692  TVVQYLSSCRPKISKLVEGYVEKYGKS  718



>ref|XP_007211370.1| hypothetical protein PRUPE_ppa002526mg [Prunus persica]
 gb|EMJ12569.1| hypothetical protein PRUPE_ppa002526mg [Prunus persica]
Length=662

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = -3

Query  634  EKQLPKSADFGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGNDVDGL------VH  476
            E+ L   +    +T+  KT    D+  Q + +++K ++ V+  +  N+VDG       V 
Sbjct  516  EENLSGPSHLKGSTKPHKTSSYGDSRPQSDSSRHKKDITVDRFRENNEVDGEHVTDGDVQ  575

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            Q+S+AL+ F +A+VE +KELLKP WREG LS DA+  IVKK     LS  QP+QI    +
Sbjct  576  QESKALRHFRAALVELVKELLKPKWREGCLSKDAHNKIVKKAVEKVLSAFQPQQIPPTVE  635

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +V +YLS  +PK+ KLV GYV+KYG+S
Sbjct  636  TVLQYLSSCRPKISKLVEGYVEKYGKS  662



>ref|XP_002305122.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE85633.2| zinc finger family protein [Populus trichocarpa]
Length=120

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -3

Query  481  VHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDN  302
            V ++S+ L+ F S +++F+KELLKPTWREG LS DA+  IVKKT    LS++QP QI   
Sbjct  32   VQEESKVLRHFRSVLIDFVKELLKPTWREGHLSEDAHNTIVKKTAEKVLSSLQPHQIPAA  91

Query  301  SDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +S+K++LS +QPK+ KLV GYV K+G+S
Sbjct  92   VESIKQFLSSSQPKMTKLVEGYVSKHGKS  120



>ref|XP_010686421.1| PREDICTED: uncharacterized protein LOC104900642 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=837

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  511  VKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS  332
            V+ G  ++ L  ++S+A+K F ++++EF+KEL+KP W EG LS D YK IV+K +   LS
Sbjct  739  VEKGEQLNELADEESKAIKYFRASLIEFVKELMKPIWHEGRLSKDVYKVIVQKAEDKILS  798

Query  331  TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            T+QP Q+ ++S+S+K+YLS +QPK+ KL+  YVDKYGR
Sbjct  799  TLQPNQVPNSSESIKQYLSSSQPKILKLIQAYVDKYGR  836



>ref|XP_010686420.1| PREDICTED: uncharacterized protein LOC104900642 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=844

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  511  VKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS  332
            V+ G  ++ L  ++S+A+K F ++++EF+KEL+KP W EG LS D YK IV+K +   LS
Sbjct  746  VEKGEQLNELADEESKAIKYFRASLIEFVKELMKPIWHEGRLSKDVYKVIVQKAEDKILS  805

Query  331  TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            T+QP Q+ ++S+S+K+YLS +QPK+ KL+  YVDKYGR
Sbjct  806  TLQPNQVPNSSESIKQYLSSSQPKILKLIQAYVDKYGR  843



>ref|XP_006361026.1| PREDICTED: uncharacterized protein LOC102581019 isoform X1 [Solanum 
tuberosum]
Length=593

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 99/169 (59%), Gaps = 18/169 (11%)
 Frame = -3

Query  715  RNLSEKEKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQY  536
            ++LS  E++  D A AHQEN+  +S +EK                +   N   QK   Q 
Sbjct  441  KDLSANERKTADRAIAHQENMNTSSKEEKH---------------SRSVNPRGQKRN-QS  484

Query  535  KMELKVESVKSGNDV--DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAI  362
            K+E    S +   D   DG V+ +S  +K F +A+VE +KELLKPTW EGLL  DAYK I
Sbjct  485  KLEKLGPSCEIDTDFRRDGSVNYESGVMKHFRAALVELVKELLKPTWHEGLLMRDAYKMI  544

Query  361  VKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            VKK     ++++ P+Q+ D ++S+ +YLS ++ K+ KL+ GY++KYG+S
Sbjct  545  VKKAVDKIINSLTPDQVPDTTESINQYLSVSKTKVSKLIEGYLEKYGKS  593



>ref|XP_011460576.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=728

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = -3

Query  604  GDTTEADKTHCSNDTVQKNGAQ-YKMELKVESVKSGNDV------DGLVHQDSRALKQFE  446
            G T     + C +   Q +G+  ++ ++KV+  +  N+V      DG V Q+S+ +KQF 
Sbjct  592  GSTNPNKISICGDSRHQSDGSSSHQRDIKVDKFRENNEVEGEHLTDGDVQQESKEMKQFR  651

Query  445  SAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQ  266
             A++E +KELLKP WREG LS DA+  IVKK     LS  QP+QI    ++V +YLS  +
Sbjct  652  GALIELVKELLKPKWREGSLSKDAHNKIVKKAVDKILSAFQPQQIPPTLEAVTQYLSACR  711

Query  265  PKLEKLVLGYVDKYGRS  215
            PK+ KLV GY+++YG+S
Sbjct  712  PKISKLVEGYIERYGKS  728



>ref|XP_004293802.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=733

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = -3

Query  604  GDTTEADKTHCSNDTVQKNGAQ-YKMELKVESVKSGNDV------DGLVHQDSRALKQFE  446
            G T     + C +   Q +G+  ++ ++KV+  +  N+V      DG V Q+S+ +KQF 
Sbjct  597  GSTNPNKISICGDSRHQSDGSSSHQRDIKVDKFRENNEVEGEHLTDGDVQQESKEMKQFR  656

Query  445  SAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQ  266
             A++E +KELLKP WREG LS DA+  IVKK     LS  QP+QI    ++V +YLS  +
Sbjct  657  GALIELVKELLKPKWREGSLSKDAHNKIVKKAVDKILSAFQPQQIPPTLEAVTQYLSACR  716

Query  265  PKLEKLVLGYVDKYGRS  215
            PK+ KLV GY+++YG+S
Sbjct  717  PKISKLVEGYIERYGKS  733



>ref|XP_011460575.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = -3

Query  604  GDTTEADKTHCSNDTVQKNGAQ-YKMELKVESVKSGNDV------DGLVHQDSRALKQFE  446
            G T     + C +   Q +G+  ++ ++KV+  +  N+V      DG V Q+S+ +KQF 
Sbjct  594  GSTNPNKISICGDSRHQSDGSSSHQRDIKVDKFRENNEVEGEHLTDGDVQQESKEMKQFR  653

Query  445  SAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQ  266
             A++E +KELLKP WREG LS DA+  IVKK     LS  QP+QI    ++V +YLS  +
Sbjct  654  GALIELVKELLKPKWREGSLSKDAHNKIVKKAVDKILSAFQPQQIPPTLEAVTQYLSACR  713

Query  265  PKLEKLVLGYVDKYGRS  215
            PK+ KLV GY+++YG+S
Sbjct  714  PKISKLVEGYIERYGKS  730



>emb|CDO99511.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 102/170 (60%), Gaps = 4/170 (2%)
 Frame = -3

Query  715  RNLSEKEK--ELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGA  542
            +N S K+   E  ++ G   +N   + LKE++   +    D  EAD+      +   +  
Sbjct  574  KNFSSKDSTAEAKESVGTQSQN-KKSFLKEERFLDNECVRDVMEADQMPIDCGSKSVSSG  632

Query  541  QYKMELKVESVKSGNDVDG-LVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKA  365
            +++ E K E  +   + D  L  ++SRALK F +++VE +KELLKP+W +G+LS DA+K 
Sbjct  633  RHRTESKEEMSRQMIEADADLKVEESRALKNFHASLVEVVKELLKPSWHKGVLSKDAHKI  692

Query  364  IVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            IVKK     LST+QP Q+   S+SVK+YLS +Q KL KLV GYVDKY +S
Sbjct  693  IVKKAVEKVLSTLQPHQVPSTSESVKQYLSLSQTKLAKLVEGYVDKYRKS  742



>gb|KJB57510.1| hypothetical protein B456_009G167600 [Gossypium raimondii]
 gb|KJB57511.1| hypothetical protein B456_009G167600 [Gossypium raimondii]
Length=774

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 83/120 (69%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            +++G + K +LKV+ V+  N++D      G   ++S+A++ F +A+V+ IKELLKPTWRE
Sbjct  655  RRDGFRCKKDLKVDRVREKNEIDIEHKADGEALKESKAMRHFHAALVDLIKELLKPTWRE  714

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVKK     + T+QP QI    +SVK+YLS +Q K+ +LV GY++KYG+S
Sbjct  715  GHLSKDAHNRIVKKAVNKVIGTVQPHQIPLTFESVKQYLSASQSKIARLVQGYIEKYGKS  774



>ref|XP_011096339.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Sesamum indicum]
Length=671

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 89/145 (61%), Gaps = 6/145 (4%)
 Frame = -3

Query  643  SLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVD------GL  482
            S +E++L  S     T + +    S+D    +  + K ELKV+   + N+ D        
Sbjct  446  SSREEKLLNSVHIEGTVKDNIFLLSSDNKLNDNTRDKAELKVDGSDNNNEADVDLKGADQ  505

Query  481  VHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDN  302
            +  +S+A K F+SA++EF+KEL+KPTWREGL+S DA+K IVKK     LST+QP QI   
Sbjct  506  LQSESKAFKYFQSALIEFVKELVKPTWREGLMSKDAHKLIVKKAVDKVLSTLQPNQIPST  565

Query  301  SDSVKEYLSFAQPKLEKLVLGYVDK  227
             +SV  YLS ++PKL KLV GY+DK
Sbjct  566  GESVNLYLSSSKPKLAKLVEGYIDK  590



>ref|XP_006449384.1| hypothetical protein CICLE_v10014553mg [Citrus clementina]
 gb|ESR62624.1| hypothetical protein CICLE_v10014553mg [Citrus clementina]
Length=649

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  646  TSLKEKQ---LPKSAD------FGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGN  497
            TS+ ++Q   +PK  D      F D +++ K +   D+ +Q +  +   E KV+  +  +
Sbjct  490  TSIVDEQNGAMPKENDPSVSTYFKDISKSKKPNAKYDSRIQNDRCRRNKEPKVDRARQNS  549

Query  496  DVD------GLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFL  335
            ++D      G   ++S+ +K F + +VEF+KELLKP+WREG LS DA+  IVKK     L
Sbjct  550  EMDLEHKADGDGRKESKLMKHFRNDLVEFVKELLKPSWREGRLSKDAHNTIVKKAVDKVL  609

Query  334  STMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +T+ P QI    +S K+YLS +QPK+ KLV GYVDKYG+S
Sbjct  610  ATLHPHQIPTTMESTKQYLSSSQPKIAKLVEGYVDKYGKS  649



>ref|XP_012091649.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X3 [Jatropha 
curcas]
Length=778

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGND--VDGLVHQDSRALKQFESAV  437
            D  D ++ D  H S+   Q +G ++K + KV+ VK   +  VD  +  +SRA++ F +A+
Sbjct  645  DIPDMSKVDADHDSSPRHQNDGPRHKKDSKVDKVKQKREMVVDQKIEGESRAVRHFRAAL  704

Query  436  VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
            V+F+KELLKPTWREG LS DA+  IVKK     LST+Q  QI    +S+K+YLS +QPK+
Sbjct  705  VDFVKELLKPTWREGHLSKDAHNTIVKKAVEKVLSTLQLHQIPTTMESIKQYLSSSQPKI  764

Query  256  EKLVLGYVDKYGRS  215
             KLV GY  KYG+S
Sbjct  765  AKLVEGYCTKYGKS  778



>ref|XP_012091648.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Jatropha 
curcas]
Length=793

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGND--VDGLVHQDSRALKQFESAV  437
            D  D ++ D  H S+   Q +G ++K + KV+ VK   +  VD  +  +SRA++ F +A+
Sbjct  660  DIPDMSKVDADHDSSPRHQNDGPRHKKDSKVDKVKQKREMVVDQKIEGESRAVRHFRAAL  719

Query  436  VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
            V+F+KELLKPTWREG LS DA+  IVKK     LST+Q  QI    +S+K+YLS +QPK+
Sbjct  720  VDFVKELLKPTWREGHLSKDAHNTIVKKAVEKVLSTLQLHQIPTTMESIKQYLSSSQPKI  779

Query  256  EKLVLGYVDKYGRS  215
             KLV GY  KYG+S
Sbjct  780  AKLVEGYCTKYGKS  793



>ref|XP_012091647.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP20996.1| hypothetical protein JCGZ_21467 [Jatropha curcas]
Length=913

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGND--VDGLVHQDSRALKQFESAV  437
            D  D ++ D  H S+   Q +G ++K + KV+ VK   +  VD  +  +SRA++ F +A+
Sbjct  780  DIPDMSKVDADHDSSPRHQNDGPRHKKDSKVDKVKQKREMVVDQKIEGESRAVRHFRAAL  839

Query  436  VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
            V+F+KELLKPTWREG LS DA+  IVKK     LST+Q  QI    +S+K+YLS +QPK+
Sbjct  840  VDFVKELLKPTWREGHLSKDAHNTIVKKAVEKVLSTLQLHQIPTTMESIKQYLSSSQPKI  899

Query  256  EKLVLGYVDKYGRS  215
             KLV GY  KYG+S
Sbjct  900  AKLVEGYCTKYGKS  913



>ref|XP_006467756.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X3 [Citrus 
sinensis]
Length=787

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  646  TSLKEKQ---LPKSAD------FGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGN  497
            TS+ ++Q   +PK  D      F D +++ K +   D+ +Q +  +   E KV+  +  +
Sbjct  628  TSIIDEQNGAMPKENDPSVSTYFKDISKSKKPNAKYDSRIQNDRCRRNKEPKVDRARQNS  687

Query  496  DVD------GLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFL  335
            ++D      G   ++S+ +K F + +VEF+KELLKP+WREG LS DA+  IVKK     L
Sbjct  688  EMDLEHKADGDGRKESKLMKHFRNDLVEFVKELLKPSWREGRLSKDAHNTIVKKAVDKVL  747

Query  334  STMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +T+ P QI    +S K+YLS +QPK+ KLV GYVDKYG+S
Sbjct  748  ATLHPHQIPTTMESTKQYLSSSQPKIAKLVEGYVDKYGKS  787



>gb|KDO77654.1| hypothetical protein CISIN_1g003507mg [Citrus sinensis]
Length=814

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  646  TSLKEKQ---LPKSAD------FGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGN  497
            TS+ ++Q   +PK  D      F D +++ K +   D+ +Q +  +   E KV+  +  +
Sbjct  655  TSIIDEQNGAMPKENDPSVSTYFKDISKSKKPNAKYDSRIQNDRCRRNKEPKVDRARQNS  714

Query  496  DVD------GLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFL  335
            ++D      G   ++S+ +K F + +VEF+KELLKP+WREG LS DA+  IVKK     L
Sbjct  715  EMDLEHKADGDGRKESKLMKHFRNDLVEFVKELLKPSWREGRLSKDAHNTIVKKAVDKVL  774

Query  334  STMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +T+ P QI    +S K+YLS +QPK+ KLV GYVDKYG+S
Sbjct  775  ATLHPHQIPTTMESTKQYLSSSQPKIAKLVEGYVDKYGKS  814



>ref|XP_006467754.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467755.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Citrus 
sinensis]
Length=814

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = -3

Query  646  TSLKEKQ---LPKSAD------FGDTTEADKTHCSNDT-VQKNGAQYKMELKVESVKSGN  497
            TS+ ++Q   +PK  D      F D +++ K +   D+ +Q +  +   E KV+  +  +
Sbjct  655  TSIIDEQNGAMPKENDPSVSTYFKDISKSKKPNAKYDSRIQNDRCRRNKEPKVDRARQNS  714

Query  496  DVD------GLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFL  335
            ++D      G   ++S+ +K F + +VEF+KELLKP+WREG LS DA+  IVKK     L
Sbjct  715  EMDLEHKADGDGRKESKLMKHFRNDLVEFVKELLKPSWREGRLSKDAHNTIVKKAVDKVL  774

Query  334  STMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +T+ P QI    +S K+YLS +QPK+ KLV GYVDKYG+S
Sbjct  775  ATLHPHQIPTTMESTKQYLSSSQPKIAKLVEGYVDKYGKS  814



>ref|XP_009352887.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 [Pyrus x bretschneideri]
Length=769

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGL------VHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q +G++++   K+   +  N+VDG       V Q+S+A+K F +A+V+ +KELLKP WRE
Sbjct  650  QSDGSRHQEGTKLGRFREKNEVDGEHLTDRDVQQESKAVKNFRAALVDLVKELLKPKWRE  709

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVK+     +S  QP QI    ++V++YLS  +PK+ KLV GYV+KYG+S
Sbjct  710  GSLSKDAHNMIVKRAVEKIISAFQPHQIPSTIETVEQYLSACRPKISKLVEGYVEKYGKS  769



>ref|XP_006361027.1| PREDICTED: uncharacterized protein LOC102581019 isoform X2 [Solanum 
tuberosum]
 ref|XP_006361028.1| PREDICTED: uncharacterized protein LOC102581019 isoform X3 [Solanum 
tuberosum]
Length=592

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 96/166 (58%), Gaps = 18/166 (11%)
 Frame = -3

Query  715  RNLSEKEKELMDTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQY  536
            ++LS  E++  D A AHQEN+  +S +EK                +   N   QK   Q 
Sbjct  441  KDLSANERKTADRAIAHQENMNTSSKEEKH---------------SRSVNPRGQKRN-QS  484

Query  535  KMELKVESVKSGNDV--DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAI  362
            K+E    S +   D   DG V+ +S  +K F +A+VE +KELLKPTW EGLL  DAYK I
Sbjct  485  KLEKLGPSCEIDTDFRRDGSVNYESGVMKHFRAALVELVKELLKPTWHEGLLMRDAYKMI  544

Query  361  VKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            VKK     ++++ P+Q+ D ++S+ +YLS ++ K+ KL+ GY++KY
Sbjct  545  VKKAVDKIINSLTPDQVPDTTESINQYLSVSKTKVSKLIEGYLEKY  590



>ref|XP_008383703.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Malus domestica]
Length=770

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGL------VHQDSRALKQFESAVVEFIKELLKPTWRE  395
            Q +G++++   K+   +  N+VDG       V Q+S+A+K F +A+V+ +KELLKP WRE
Sbjct  651  QSDGSRHQEGTKLGRFREKNEVDGEHLTDGDVQQESKAVKNFRAALVDLVKELLKPKWRE  710

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            G LS DA+  IVK+     +S  QP QI    ++V +YLS  +PK+ KLV GYV+KYG+S
Sbjct  711  GSLSKDAHNMIVKRAVEKIISAFQPHQIPSTIETVVQYLSACRPKISKLVEGYVEKYGKS  770



>gb|KJB68637.1| hypothetical protein B456_010G256500 [Gossypium raimondii]
Length=634

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLV-------HQDSRALKQFESAVVEFIKELLKPTWR  398
            ++ G++ K +L+V+ V+  N++D  V       +++S+A++ F +A+V+ IK+LLKPTWR
Sbjct  514  RRGGSRCKRDLEVDRVREKNEIDVEVEHKADGDYKESKAMRHFHAALVDLIKQLLKPTWR  573

Query  397  EGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            EG LS DA+  IVKK       ++QP Q+    +SVK+YLS +QPK+ +LV GY++KY +
Sbjct  574  EGHLSKDAHNTIVKKAVDKVFGSIQPHQLPVTFESVKQYLSSSQPKITRLVEGYIEKYKK  633

Query  217  S  215
            S
Sbjct  634  S  634



>gb|KJB68635.1| hypothetical protein B456_010G256500 [Gossypium raimondii]
 gb|KJB68636.1| hypothetical protein B456_010G256500 [Gossypium raimondii]
Length=772

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLV-------HQDSRALKQFESAVVEFIKELLKPTWR  398
            ++ G++ K +L+V+ V+  N++D  V       +++S+A++ F +A+V+ IK+LLKPTWR
Sbjct  652  RRGGSRCKRDLEVDRVREKNEIDVEVEHKADGDYKESKAMRHFHAALVDLIKQLLKPTWR  711

Query  397  EGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            EG LS DA+  IVKK       ++QP Q+    +SVK+YLS +QPK+ +LV GY++KY +
Sbjct  712  EGHLSKDAHNTIVKKAVDKVFGSIQPHQLPVTFESVKQYLSSSQPKITRLVEGYIEKYKK  771

Query  217  S  215
            S
Sbjct  772  S  772



>gb|KJB68638.1| hypothetical protein B456_010G256500 [Gossypium raimondii]
Length=775

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLV-------HQDSRALKQFESAVVEFIKELLKPTWR  398
            ++ G++ K +L+V+ V+  N++D  V       +++S+A++ F +A+V+ IK+LLKPTWR
Sbjct  655  RRGGSRCKRDLEVDRVREKNEIDVEVEHKADGDYKESKAMRHFHAALVDLIKQLLKPTWR  714

Query  397  EGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            EG LS DA+  IVKK       ++QP Q+    +SVK+YLS +QPK+ +LV GY++KY +
Sbjct  715  EGHLSKDAHNTIVKKAVDKVFGSIQPHQLPVTFESVKQYLSSSQPKITRLVEGYIEKYKK  774

Query  217  S  215
            S
Sbjct  775  S  775



>gb|KJB68639.1| hypothetical protein B456_010G256500 [Gossypium raimondii]
Length=731

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLV-------HQDSRALKQFESAVVEFIKELLKPTWR  398
            ++ G++ K +L+V+ V+  N++D  V       +++S+A++ F +A+V+ IK+LLKPTWR
Sbjct  611  RRGGSRCKRDLEVDRVREKNEIDVEVEHKADGDYKESKAMRHFHAALVDLIKQLLKPTWR  670

Query  397  EGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            EG LS DA+  IVKK       ++QP Q+    +SVK+YLS +QPK+ +LV GY++KY +
Sbjct  671  EGHLSKDAHNTIVKKAVDKVFGSIQPHQLPVTFESVKQYLSSSQPKITRLVEGYIEKYKK  730

Query  217  S  215
            S
Sbjct  731  S  731



>ref|XP_010272379.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Nelumbo nucifera]
Length=873

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 89/140 (64%), Gaps = 11/140 (8%)
 Frame = -3

Query  601  DTTEADK-THCSNDTVQKNGAQYKMELKVESVK---------SGNDVD-GLVHQDSRALK  455
            D    DK +H    T Q +G++ K EL+ +  +         S + VD    H++S+ALK
Sbjct  734  DVANLDKMSHDGGFTHQSDGSKLKKELRTDGGQKIEVDLHRNSKHQVDEARPHKESKALK  793

Query  454  QFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLS  275
             F + +V+F+KEL+KP+WR G LS DA+K IVKK     LST+QP QI + ++S+ +YLS
Sbjct  794  LFRTDLVDFVKELVKPSWRGGHLSKDAHKTIVKKAVDKVLSTLQPHQIPNTTESINQYLS  853

Query  274  FAQPKLEKLVLGYVDKYGRS  215
             ++PK+ KLV  YV+KYG++
Sbjct  854  SSRPKITKLVEAYVEKYGKT  873



>ref|XP_010272377.1| PREDICTED: zinc finger CCCH domain-containing protein 36 isoform 
X1 [Nelumbo nucifera]
Length=874

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 89/140 (64%), Gaps = 11/140 (8%)
 Frame = -3

Query  601  DTTEADK-THCSNDTVQKNGAQYKMELKVESVK---------SGNDVD-GLVHQDSRALK  455
            D    DK +H    T Q +G++ K EL+ +  +         S + VD    H++S+ALK
Sbjct  735  DVANLDKMSHDGGFTHQSDGSKLKKELRTDGGQKIEVDLHRNSKHQVDEARPHKESKALK  794

Query  454  QFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLS  275
             F + +V+F+KEL+KP+WR G LS DA+K IVKK     LST+QP QI + ++S+ +YLS
Sbjct  795  LFRTDLVDFVKELVKPSWRGGHLSKDAHKTIVKKAVDKVLSTLQPHQIPNTTESINQYLS  854

Query  274  FAQPKLEKLVLGYVDKYGRS  215
             ++PK+ KLV  YV+KYG++
Sbjct  855  SSRPKITKLVEAYVEKYGKT  874



>gb|KHG29652.1| Zinc finger CCCH domain-containing 27 -like protein [Gossypium 
arboreum]
Length=759

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 89/137 (65%), Gaps = 8/137 (6%)
 Frame = -3

Query  601  DTTEADKTHCSNDTVQKNG-AQYKMELKVESVKSGNDVDGLV-------HQDSRALKQFE  446
            D ++A+K    +D   + G ++ K +L+V+  +  N++D  V       +++S+A++ F 
Sbjct  623  DISKANKNDRDHDGRHRRGRSRCKKDLEVDRAREKNEIDVEVEHKADGDYKESKAMRHFH  682

Query  445  SAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQ  266
            +A+V+ IKELLKPTWREG LS DA+  IVKK       ++QP Q+    +SVK+YLS +Q
Sbjct  683  AALVDLIKELLKPTWREGHLSKDAHNTIVKKAVDKVFGSIQPHQLPVTFESVKQYLSSSQ  742

Query  265  PKLEKLVLGYVDKYGRS  215
            PK+ +LV GY++KY +S
Sbjct  743  PKITRLVEGYIEKYKKS  759



>ref|XP_009397197.1| PREDICTED: zinc finger CCCH domain-containing protein 36 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397198.1| PREDICTED: zinc finger CCCH domain-containing protein 36 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397199.1| PREDICTED: zinc finger CCCH domain-containing protein 36 [Musa 
acuminata subsp. malaccensis]
Length=773

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++S+A+K F +A+V+F+KELLKP W+EG LS DA+K IVKK     LS +QP QI  +++
Sbjct  687  KESKAVKNFRTALVDFLKELLKPVWKEGHLSKDAHKMIVKKASEKVLSALQPHQIPSDTE  746

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            S+  YLS ++PKL KLV GYV+KY +S
Sbjct  747  SINHYLSISKPKLLKLVEGYVNKYSKS  773



>ref|XP_011096340.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Sesamum indicum]
Length=586

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 6/144 (4%)
 Frame = -3

Query  658  NIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVD---  488
            ++   S +E++L  S     T + +    S+D    +  + K ELKV+   + N+ D   
Sbjct  441  DVPSNSSREEKLLNSVHIEGTVKDNIFLLSSDNKLNDNTRDKAELKVDGSDNNNEADVDL  500

Query  487  ---GLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPE  317
                 +  +S+A K F+SA++EF+KEL+KPTWREGL+S DA+K IVKK     LST+QP 
Sbjct  501  KGADQLQSESKAFKYFQSALIEFVKELVKPTWREGLMSKDAHKLIVKKAVDKVLSTLQPN  560

Query  316  QIRDNSDSVKEYLSFAQPKLEKLV  245
            QI    +SV  YLS ++PKL KLV
Sbjct  561  QIPSTGESVNLYLSSSKPKLAKLV  584



>ref|XP_011628978.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 [Amborella trichopoda]
Length=682

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -3

Query  505  SGNDVDGLVH-QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLST  329
            S N  DG  H +DS+ LK F +A+V+F+KELLKP WREG LS DA+K +VKK     LS 
Sbjct  585  SANAADGNRHDKDSKLLKCFRAALVDFVKELLKPFWREGRLSKDAHKTVVKKAVEKVLSA  644

Query  328  MQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            M P QI   ++S+ +YLS ++ K+ KLV GYV KY +S
Sbjct  645  MHPNQIPGTTESINQYLSTSRTKIRKLVEGYVAKYAKS  682



>gb|ERM93742.1| hypothetical protein AMTR_s00004p00261980 [Amborella trichopoda]
Length=941

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -3

Query  505  SGNDVDGLVH-QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLST  329
            S N  DG  H +DS+ LK F +A+V+F+KELLKP WREG LS DA+K +VKK     LS 
Sbjct  844  SANAADGNRHDKDSKLLKCFRAALVDFVKELLKPFWREGRLSKDAHKTVVKKAVEKVLSA  903

Query  328  MQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            M P QI   ++S+ +YLS ++ K+ KLV GYV KY +S
Sbjct  904  MHPNQIPGTTESINQYLSTSRTKIRKLVEGYVAKYAKS  941



>gb|EPS61456.1| hypothetical protein M569_13342, partial [Genlisea aurea]
Length=101

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -3

Query  472  DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDS  293
            +S+AL  F  A+ E++KEL+KPTWREGL+S DA+K IVKK     +ST QP QI    ++
Sbjct  16   ESKALICFRGALAEYVKELVKPTWREGLMSKDAHKLIVKKCVDKVVSTFQPHQIPATLEA  75

Query  292  VKEYLSFAQPKLEKLVLGYVDKYGRS  215
               YLS ++ +LEKLV GY+++YG++
Sbjct  76   ANGYLSSSRSRLEKLVEGYIERYGKT  101



>ref|XP_010655449.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Vitis vinifera]
 emb|CBI30597.3| unnamed protein product [Vitis vinifera]
Length=745

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 77/117 (66%), Gaps = 6/117 (5%)
 Frame = -3

Query  550  NGAQYKMELKVESVKSGN------DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGL  389
            +GA ++ ELK+E  K  N       +D  V ++S+AL+ F   +++FIK+L++PTW  G 
Sbjct  621  DGASHEEELKMEWGKQSNAKCDDHKIDEDVQKESKALRHFRFVLIDFIKDLVRPTWHRGQ  680

Query  388  LSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            LS DA+ +IVK++    LST++P QI    +++  YLS +QPK+ KLV GYV+K+ R
Sbjct  681  LSKDAHNSIVKRSVDKVLSTLEPHQIPSTEEAIHHYLSVSQPKIAKLVQGYVEKHRR  737



>ref|XP_003593623.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES63874.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=892

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 83/133 (62%), Gaps = 13/133 (10%)
 Frame = -3

Query  595  TEADKTHCSNDT------VQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVV  434
            TE D  H S+++      V K+   ++ME+  ++       DG V ++++ LK F + +V
Sbjct  767  TEHDARHHSDESEHKKNRVAKDNKFHEMEVDFQT-------DGSVLKETKTLKIFHAVLV  819

Query  433  EFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLE  254
            + +KELLKP W EG LS DA+  IVKK+    +ST++P QI    D+ K+Y+S  +PK+ 
Sbjct  820  DLVKELLKPFWHEGRLSKDAHILIVKKSVDKVISTLEPRQIPTTEDTAKQYVSLCRPKIA  879

Query  253  KLVLGYVDKYGRS  215
            KLV GYV+K+G+S
Sbjct  880  KLVHGYVNKHGKS  892



>gb|KEH36560.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=891

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 83/133 (62%), Gaps = 13/133 (10%)
 Frame = -3

Query  595  TEADKTHCSNDT------VQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVV  434
            TE D  H S+++      V K+   ++ME+  ++       DG V ++++ LK F + +V
Sbjct  766  TEHDARHHSDESEHKKNRVAKDNKFHEMEVDFQT-------DGSVLKETKTLKIFHAVLV  818

Query  433  EFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLE  254
            + +KELLKP W EG LS DA+  IVKK+    +ST++P QI    D+ K+Y+S  +PK+ 
Sbjct  819  DLVKELLKPFWHEGRLSKDAHILIVKKSVDKVISTLEPRQIPTTEDTAKQYVSLCRPKIA  878

Query  253  KLVLGYVDKYGRS  215
            KLV GYV+K+G+S
Sbjct  879  KLVHGYVNKHGKS  891



>ref|XP_008439823.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Cucumis melo]
 ref|XP_008439825.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Cucumis melo]
 ref|XP_008439826.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X2 [Cucumis melo]
Length=737

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG   ++S+A + F SA++E +KE+LKP WREG L  D +  +VKKT    L  +Q  Q
Sbjct  645  LDGNAPKESKATRHFRSALIELVKEILKPKWREGHLKKDVHNTVVKKTFDKVLGALQSHQ  704

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +   ++SVK+YLS ++PK+EKLV GYV KYG+S
Sbjct  705  VPTTAESVKQYLSSSRPKIEKLVEGYVSKYGKS  737



>ref|XP_008356058.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Malus domestica]
Length=813

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 82/139 (59%), Gaps = 5/139 (4%)
 Frame = -3

Query  631  KQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQ  452
            KQ   S  +GD+     +    + ++ +  + K E+  E +  GN     V Q+S+A++ 
Sbjct  680  KQNKASTAYGDSRHVSDSSGHQEDIKVDRFRDKNEVDGEHLTDGN-----VQQESKAVRN  734

Query  451  FESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSF  272
            F +A+V+ +KELLKP WREG LS DA+  IVK+     +S  QP QI    ++V +YLS 
Sbjct  735  FRAALVDLVKELLKPKWREGSLSKDAHNMIVKRAVEKIISAFQPHQIPPTIETVIQYLSV  794

Query  271  AQPKLEKLVLGYVDKYGRS  215
             +PK+ KLV GYV KYG+S
Sbjct  795  CRPKISKLVEGYVVKYGKS  813



>ref|XP_008371700.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Malus domestica]
Length=813

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 82/139 (59%), Gaps = 5/139 (4%)
 Frame = -3

Query  631  KQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQ  452
            KQ   S  +GD+     +    + ++ +  + K E+  E +  GN     V Q+S+A++ 
Sbjct  680  KQNKASTAYGDSRHVSDSSGHQEDIKVDRFRDKNEVDGEHLTDGN-----VQQESKAVRN  734

Query  451  FESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSF  272
            F +A+V+ +KELLKP WREG LS DA+  IVK+     +S  QP QI    ++V +YLS 
Sbjct  735  FRAALVDLVKELLKPKWREGSLSKDAHNMIVKRAVEKIISAFQPHQIPPTIETVIQYLSV  794

Query  271  AQPKLEKLVLGYVDKYGRS  215
             +PK+ KLV GYV KYG+S
Sbjct  795  CRPKISKLVEGYVVKYGKS  813



>ref|XP_010057376.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 [Eucalyptus grandis]
Length=613

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -3

Query  481  VHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDN  302
            V+Q+S+AL+ F  A+++++KELLKP W+ G LS DA+  IVKK     L+T+QP+QI  N
Sbjct  525  VNQESKALRHFRVALIDYVKELLKPAWQGGRLSKDAHNLIVKKAVDKVLTTLQPQQIPPN  584

Query  301  SDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +S+K +LSF+Q KL +LV  YV K+G+
Sbjct  585  PESIKHFLSFSQFKLTRLVEAYVTKHGK  612



>gb|KCW74544.1| hypothetical protein EUGRSUZ_E03255 [Eucalyptus grandis]
Length=713

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -3

Query  481  VHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDN  302
            V+Q+S+AL+ F  A+++++KELLKP W+ G LS DA+  IVKK     L+T+QP+QI  N
Sbjct  625  VNQESKALRHFRVALIDYVKELLKPAWQGGRLSKDAHNLIVKKAVDKVLTTLQPQQIPPN  684

Query  301  SDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +S+K +LSF+Q KL +LV  YV K+G+
Sbjct  685  PESIKHFLSFSQFKLTRLVEAYVTKHGK  712



>gb|KHG12575.1| Zinc finger CCCH domain-containing 27 -like protein [Gossypium 
arboreum]
Length=768

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 80/126 (63%), Gaps = 7/126 (6%)
 Frame = -3

Query  601  DTTEADKTHCSNDTV-QKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFES  443
            D ++  KT    D   +++G + K +LKV+ V+  N++D      G   ++S+A++ F +
Sbjct  638  DISKTSKTDTDRDARHRRDGFRCKKDLKVDRVREKNEIDIEHKADGEALKESKAMRHFHA  697

Query  442  AVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQP  263
            A+V+ IKELLKPTWREG LS DA+  IVKK     + TMQP QI    +SVK+YLS +Q 
Sbjct  698  ALVDLIKELLKPTWREGHLSKDAHNRIVKKAVNKVIGTMQPHQIPLTFESVKQYLSASQS  757

Query  262  KLEKLV  245
            K+ +LV
Sbjct  758  KIARLV  763



>gb|KGN49245.1| hypothetical protein Csa_6G518020 [Cucumis sativus]
Length=693

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            ++G   ++S+A + F SA++E +KE+LKP WREG L  D +  +VKKT    L  +Q  Q
Sbjct  601  MEGNAPKESKATRHFRSALIELVKEILKPKWREGHLKKDVHNTVVKKTFDKVLGALQSHQ  660

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +    +SVK+YLS ++PK+EKLV GYV KYG+S
Sbjct  661  VPTTVESVKQYLSSSRPKIEKLVEGYVSKYGKS  693



>ref|XP_004134948.2| PREDICTED: uncharacterized protein LOC101203293 [Cucumis sativus]
Length=752

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            ++G   ++S+A + F SA++E +KE+LKP WREG L  D +  +VKKT    L  +Q  Q
Sbjct  660  MEGNAPKESKATRHFRSALIELVKEILKPKWREGHLKKDVHNTVVKKTFDKVLGALQSHQ  719

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +    +SVK+YLS ++PK+EKLV GYV KYG+S
Sbjct  720  VPTTVESVKQYLSSSRPKIEKLVEGYVSKYGKS  752



>ref|XP_010928945.1| PREDICTED: zinc finger CCCH domain-containing protein 36 [Elaeis 
guineensis]
Length=903

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++S+AL+ F  A+V+F+KEL+KP WREG LS DA+K IVKK     + ++QP QI   ++
Sbjct  817  KESKALRIFRVALVDFVKELVKPFWREGHLSKDAHKMIVKKAVEKVIGSLQPHQIPSTAE  876

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            S+ +YLS +Q KL KLV  YVDKY +S
Sbjct  877  SINQYLSLSQTKLLKLVEAYVDKYAKS  903



>ref|XP_009342631.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Pyrus x bretschneideri]
Length=837

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 55/145 (38%), Positives = 86/145 (59%), Gaps = 17/145 (12%)
 Frame = -3

Query  631  KQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVDGL------VHQD  470
            KQ   S  +GD+    ++ CS         +++ ++KV+  +  N+VDG       V Q+
Sbjct  704  KQNKASTAYGDS--GHESDCS---------RHQEDIKVDRFRDKNEVDGEHLTDGNVQQE  752

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            S+A++ F +A+V+ +K++LKP WR+G LS DA+  IVK+     +S  QP QI    ++V
Sbjct  753  SKAVRNFRAALVDLVKDMLKPKWRDGSLSKDAHNMIVKRAVEKIISAFQPHQIPPTIETV  812

Query  289  KEYLSFAQPKLEKLVLGYVDKYGRS  215
              YLS  +PK+ KLV GYV KYG+S
Sbjct  813  MHYLSVCRPKISKLVEGYVVKYGKS  837



>ref|XP_008777661.1| PREDICTED: zinc finger CCCH domain-containing protein 36-like 
[Phoenix dactylifera]
Length=900

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 99/168 (59%), Gaps = 8/168 (5%)
 Frame = -3

Query  712  NLSEKEKELMD-TAGAHQENIYYTSLKEKQLPKSADFGDT-TEADKTHCSNDTVQKNGAQ  539
            +L+   ++++D    AHQ   Y T + +   P S D G++    D+ H           +
Sbjct  737  SLNHSTEDIIDKNTAAHQFTGYITPV-DAPGPDSIDGGNSFMSKDEKHW---VPHATDGE  792

Query  538  YKMELKVESVKSGNDVDGLVH-QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAI  362
               E+ ++S  +GN VD   + ++S+AL+ F  A+V+F+KEL+KP WR+G  S DA+K I
Sbjct  793  NVNEVDLDS-NTGNQVDKARNDKESKALRIFRFALVDFVKELVKPFWRDGHFSKDAHKMI  851

Query  361  VKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            VKK     +S++QP QI   ++S+ +YLS ++ K+ KLV GY+DKY R
Sbjct  852  VKKAVEKVISSLQPHQIPSTAESINQYLSLSRTKIFKLVEGYMDKYAR  899



>gb|KJB57509.1| hypothetical protein B456_009G167600 [Gossypium raimondii]
Length=769

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVD------GLVHQDSRALKQFESAVVEFIKELLKPTWRE  395
            +++G + K +LKV+ V+  N++D      G   ++S+A++ F +A+V+ IKELLKPTWRE
Sbjct  655  RRDGFRCKKDLKVDRVREKNEIDIEHKADGEALKESKAMRHFHAALVDLIKELLKPTWRE  714

Query  394  GLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLV  245
            G LS DA+  IVKK     + T+QP QI    +SVK+YLS +Q K+ +LV
Sbjct  715  GHLSKDAHNRIVKKAVNKVIGTVQPHQIPLTFESVKQYLSASQSKIARLV  764



>ref|XP_010655448.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Vitis vinifera]
Length=771

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = -3

Query  550  NGAQYKMELKVESVKSGN------DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGL  389
            +GA ++ ELK+E  K  N       +D  V ++S+AL+ F   +++FIK+L++PTW  G 
Sbjct  621  DGASHEEELKMEWGKQSNAKCDDHKIDEDVQKESKALRHFRFVLIDFIKDLVRPTWHRGQ  680

Query  388  LSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYV  233
            LS DA+ +IVK++    LST++P QI    +++  YLS +QPK+ KLV GY+
Sbjct  681  LSKDAHNSIVKRSVDKVLSTLEPHQIPSTEEAIHHYLSVSQPKIAKLVQGYL  732



>ref|XP_008789751.1| PREDICTED: zinc finger CCCH domain-containing protein 36-like 
isoform X2 [Phoenix dactylifera]
Length=872

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++S+AL+ F  A+V+F+K+L+KP WREG LS DA+K IVKK     + ++QP QI   ++
Sbjct  786  KESKALRNFRVALVDFVKDLVKPFWREGQLSKDAHKMIVKKAVEKVIGSLQPHQIPSTAE  845

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            S+ +YLS +Q KL KLV  Y+DKY +S
Sbjct  846  SINQYLSLSQTKLFKLVEAYMDKYAKS  872



>ref|XP_008789750.1| PREDICTED: zinc finger CCCH domain-containing protein 36-like 
isoform X1 [Phoenix dactylifera]
Length=912

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++S+AL+ F  A+V+F+K+L+KP WREG LS DA+K IVKK     + ++QP QI   ++
Sbjct  826  KESKALRNFRVALVDFVKDLVKPFWREGQLSKDAHKMIVKKAVEKVIGSLQPHQIPSTAE  885

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            S+ +YLS +Q KL KLV  Y+DKY +S
Sbjct  886  SINQYLSLSQTKLFKLVEAYMDKYAKS  912



>ref|XP_004485810.1| PREDICTED: uncharacterized protein DDB_G0283697-like isoform 
X3 [Cicer arietinum]
Length=908

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 7/115 (6%)
 Frame = -3

Query  559  VQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSG  380
            V K+   Y+M++  ++       DG V ++++A+K F +A+V+ +KELLKP W EG LS 
Sbjct  801  VSKDNKIYEMDVDFQT-------DGSVQKETKAVKIFRAALVDLVKELLKPFWHEGRLSK  853

Query  379  DAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            DA+  IVKK+    +ST++  QI    D+ K+Y+S  + K+ KLV GYV KYG+S
Sbjct  854  DAHIVIVKKSVDKVVSTLEAHQIPTTEDTAKQYVSSCRSKIAKLVNGYVSKYGKS  908



>ref|XP_004485809.1| PREDICTED: uncharacterized protein DDB_G0283697-like isoform 
X2 [Cicer arietinum]
Length=926

 Score = 93.2 bits (230),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 7/115 (6%)
 Frame = -3

Query  559  VQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSG  380
            V K+   Y+M++  ++       DG V ++++A+K F +A+V+ +KELLKP W EG LS 
Sbjct  819  VSKDNKIYEMDVDFQT-------DGSVQKETKAVKIFRAALVDLVKELLKPFWHEGRLSK  871

Query  379  DAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            DA+  IVKK+    +ST++  QI    D+ K+Y+S  + K+ KLV GYV KYG+S
Sbjct  872  DAHIVIVKKSVDKVVSTLEAHQIPTTEDTAKQYVSSCRSKIAKLVNGYVSKYGKS  926



>ref|XP_004485808.1| PREDICTED: uncharacterized protein DDB_G0283697-like isoform 
X1 [Cicer arietinum]
Length=932

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 7/115 (6%)
 Frame = -3

Query  559  VQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSG  380
            V K+   Y+M++  ++       DG V ++++A+K F +A+V+ +KELLKP W EG LS 
Sbjct  825  VSKDNKIYEMDVDFQT-------DGSVQKETKAVKIFRAALVDLVKELLKPFWHEGRLSK  877

Query  379  DAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            DA+  IVKK+    +ST++  QI    D+ K+Y+S  + K+ KLV GYV KYG+S
Sbjct  878  DAHIVIVKKSVDKVVSTLEAHQIPTTEDTAKQYVSSCRSKIAKLVNGYVSKYGKS  932



>gb|AEW08394.1| hypothetical protein 2_8201_01, partial [Pinus radiata]
 gb|AFG61103.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61104.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61105.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61106.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61107.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61108.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61109.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61110.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61111.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61112.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61113.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61114.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61115.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
 gb|AFG61116.1| hypothetical protein 2_8201_01, partial [Pinus taeda]
Length=86

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  472  DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDS  293
            DSR++K F SA+ EF+KE LKP+WREG +S +A+K IVKK        MQ  QI  +   
Sbjct  1    DSRSMKLFRSALAEFVKEALKPSWREGHMSKEAFKTIVKKAVDKVAGAMQNHQIPKSRGR  60

Query  292  VKEYLSFAQPKLEKLVLGYVDKYGR  218
            + +Y++ ++ KL KLV GYVDKY R
Sbjct  61   IDQYVASSERKLTKLVQGYVDKYVR  85



>ref|XP_003547155.2| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Glycine max]
Length=881

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG + ++S+ALK F +A+V+ +KELLKP W EG LS DA+  IVKK+    +ST++P Q
Sbjct  790  IDGSIQKESKALKFFRAALVDHVKELLKPAWHEGHLSKDAHIMIVKKSVDKVVSTLEPHQ  849

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            I    D+ K+Y+S +Q K+ KLV GYV+KYG+
Sbjct  850  I-PIMDTAKQYVSSSQVKIAKLVNGYVNKYGK  880



>gb|KHN18955.1| Zinc finger CCCH domain-containing protein 27 [Glycine soja]
Length=849

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG + ++S+ALK F +A+V+ +KELLKP W EG LS DA+  IVKK+    +ST++P Q
Sbjct  758  IDGSIQKESKALKFFRAALVDHVKELLKPAWHEGHLSKDAHIMIVKKSVDKVVSTLEPHQ  817

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
            I    D+ K+Y+S +Q K+ KLV GYV+KYG+
Sbjct  818  I-PIMDTAKQYVSSSQVKIAKLVNGYVNKYGK  848



>ref|XP_012087634.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Jatropha curcas]
 ref|XP_012087635.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Jatropha curcas]
 ref|XP_012087636.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X2 [Jatropha curcas]
 ref|XP_012087638.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X3 [Jatropha curcas]
 gb|KDP24789.1| hypothetical protein JCGZ_25410 [Jatropha curcas]
Length=878

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G  ++D + L+ F+ A+VEF+KELLKPTW+EG +S DAYK IVKK       TMQ   +
Sbjct  786  EGKKNKDVKGLRAFKFALVEFVKELLKPTWKEGQMSKDAYKNIVKKVVDKVTGTMQGANV  845

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                + +++YLSF++PKL KLV  YV+K+
Sbjct  846  PQTQEKIQQYLSFSKPKLTKLVQAYVEKF  874



>ref|XP_009143827.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 [Brassica rapa]
Length=624

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQD--SRALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ ++ +LK +      D+DG V  D  ++ ++QF +AVVE IK++LKP WREG LS
Sbjct  501  RSDGSSHQKKLKTD------DMDGEVRSDAGTKVMRQFRTAVVETIKDMLKPLWREGRLS  554

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVK+     +S  +Q  Q+  NS+SV++YLS +  ++ KLV GYV+KYG+
Sbjct  555  KDVHNMIVKRATEKIVSAAVQLHQVPTNSESVEKYLSMSSTRIVKLVEGYVEKYGK  610



>emb|CDY17206.1| BnaA05g09820D [Brassica napus]
Length=703

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQD--SRALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ ++ +LK +      D+DG V  D  ++ ++QF +AVVE IK++LKP WREG LS
Sbjct  502  RSDGSSHQKKLKTD------DMDGEVRSDAGTKVMRQFRTAVVETIKDMLKPLWREGRLS  555

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVK+     +S  +Q  Q+  NS+SV++YLS +  ++ KLV GYV+KYG+
Sbjct  556  KDVHNMIVKRATEKIVSAAVQLHQVPTNSESVEKYLSMSSTRIVKLVEGYVEKYGK  611



>emb|CAN59796.1| hypothetical protein VITISV_001904 [Vitis vinifera]
Length=779

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = -3

Query  550  NGAQYKMELKVESVKSGN------DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGL  389
            +GA ++ ELK+E  K  N       +D  V ++S+AL+ F   +++FIK+L++PTW  G 
Sbjct  633  DGASHEEELKMEWGKQSNAKCDDHKIDEDVQKESKALRHFRFVLIDFIKDLVRPTWHRGQ  692

Query  388  LSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLV  245
            LS DA+ +IVK++    LST++P QI    +++  YLS +QPK+ KLV
Sbjct  693  LSKDAHNSIVKRSVDKVLSTLEPHQIPSTEEAIHHYLSVSQPKIAKLV  740



>ref|XP_006410533.1| hypothetical protein EUTSA_v10016429mg [Eutrema salsugineum]
 gb|ESQ51986.1| hypothetical protein EUTSA_v10016429mg [Eutrema salsugineum]
Length=581

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -3

Query  499  NDVDGLVHQD---SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLST  329
            +++DG V      ++  +QF +AVVE IKE+LKP WREG L+ D +  IVK++    +ST
Sbjct  482  DEIDGEVRSSDAGTKVTRQFRTAVVETIKEMLKPLWREGRLTKDVHNMIVKRSAEKIVST  541

Query  328  -MQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +Q  Q+   ++SV++YLS + PK+ KLV GYV+KYG+
Sbjct  542  AVQFHQVPTETESVEQYLSMSAPKIVKLVEGYVEKYGK  579



>ref|XP_007048330.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX92487.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
1 [Theobroma cacao]
Length=946

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G   +D + ++ F+ A+VEF+K+LLKPTW+EG +  DAYK IVKK      +TMQ   I
Sbjct  855  EGKKSKDGKGIRAFKFALVEFVKDLLKPTWKEGQIGKDAYKNIVKKVVDKVTATMQGANI  914

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                + + +YLSF++PKL KLV  YV+K+
Sbjct  915  PQTPEKIDQYLSFSKPKLSKLVQAYVEKF  943



>ref|XP_007048331.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOX92488.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative isoform 
2 [Theobroma cacao]
Length=967

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G   +D + ++ F+ A+VEF+K+LLKPTW+EG +  DAYK IVKK      +TMQ   I
Sbjct  876  EGKKSKDGKGIRAFKFALVEFVKDLLKPTWKEGQIGKDAYKNIVKKVVDKVTATMQGANI  935

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                + + +YLSF++PKL KLV  YV+K+
Sbjct  936  PQTPEKIDQYLSFSKPKLSKLVQAYVEKF  964



>ref|XP_010111195.1| Zinc finger CCCH domain-containing protein 27 [Morus notabilis]
 gb|EXC30586.1| Zinc finger CCCH domain-containing protein 27 [Morus notabilis]
Length=917

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 91/143 (64%), Gaps = 9/143 (6%)
 Frame = -3

Query  625  LPKSADFGDTTEADKTHCSNDTV-QKNGAQYKMELKVES------VKSGNDVDGLVHQDS  467
            L +    G +   D T   +D   Q+ G +  +++K++S      +++G+ ++G V ++S
Sbjct  777  LKQENSLGSSAAKDITAAKSDGRHQRLGPRDSVDVKIDSFRQKNKMEAGHIMEGGVDKES  836

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +AL+QF +A+++ +KE LKP WREGLLS DA+  IVKK     LST+QP+Q+  + + V 
Sbjct  837  KALRQFRAALIDSVKESLKPKWREGLLSKDAHNKIVKKAVEKVLSTLQPDQMPTSMELVM  896

Query  286  EYLSFAQPKLEKLVLGYVDKYGR  218
            ++L+ ++PK++KL+   V +Y R
Sbjct  897  QFLASSRPKIDKLI--EVSEYTR  917



>ref|XP_006594577.1| PREDICTED: uncharacterized protein YFR016C-like isoform X1 [Glycine 
max]
Length=921

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG + ++S+ALK F + +++ +KELLKP W EG LS D +  IVKK+    ++T++P Q
Sbjct  830  MDGSMQKESKALKFFRAVLIDHVKELLKPAWHEGRLSKDTHIMIVKKSVDKVVNTLEPHQ  889

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            I    D+ K+Y+S +Q K+ KLV GYV+KYG+S
Sbjct  890  I-PTIDTAKQYVSSSQVKIAKLVNGYVNKYGKS  921



>gb|KHN08501.1| Zinc finger CCCH domain-containing protein 27 [Glycine soja]
Length=903

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG + ++S+ALK F + +++ +KELLKP W EG LS D +  IVKK+    ++T++P Q
Sbjct  812  MDGSMQKESKALKFFRAVLIDHVKELLKPAWHEGRLSKDTHIMIVKKSVDKVVNTLEPHQ  871

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            I    D+ K+Y+S +Q K+ KLV GYV+KYG+S
Sbjct  872  I-PTIDTAKQYVSSSQVKIAKLVNGYVNKYGKS  903



>gb|KJB18751.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
Length=789

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++ ++ F+ A+VEF+K+LLKPTW+EG +  +AYK IVKK     ++T+Q   I    
Sbjct  702  NKDTKGIRAFKFALVEFVKDLLKPTWKEGQIGKEAYKNIVKKVVDKVIATVQGTNIPQTP  761

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            + + +YLSF++PKL KLV  YV+K+ +S
Sbjct  762  EKIDQYLSFSKPKLSKLVQAYVEKFQKS  789



>ref|XP_010540460.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010540461.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010540462.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Tarenaya hassleriana]
Length=813

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 70/101 (69%), Gaps = 3/101 (3%)
 Frame = -3

Query  508  KSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFL  335
            K+ +DVDG V  D+  + ++ F +A++E IKELLKP WREG LS D +  IVKK     +
Sbjct  713  KATDDVDGEVRSDAGMKVMRNFRTALIENIKELLKPIWREGRLSKDVHNMIVKKAVEKVI  772

Query  334  ST-MQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            ST +Q  Q+  +++S+++YLS +Q K+ KLV GYV+K+ +S
Sbjct  773  STAVQFHQVPTDTESIEQYLSVSQTKIVKLVEGYVEKFRKS  813



>gb|KJB18742.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18745.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18746.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18747.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18749.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18750.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
Length=972

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++ ++ F+ A+VEF+K+LLKPTW+EG +  +AYK IVKK     ++T+Q   I    
Sbjct  885  NKDTKGIRAFKFALVEFVKDLLKPTWKEGQIGKEAYKNIVKKVVDKVIATVQGTNIPQTP  944

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            + + +YLSF++PKL KLV  YV+K+ +S
Sbjct  945  EKIDQYLSFSKPKLSKLVQAYVEKFQKS  972



>gb|KJB18743.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18744.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
 gb|KJB18748.1| hypothetical protein B456_003G068000 [Gossypium raimondii]
Length=932

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++ ++ F+ A+VEF+K+LLKPTW+EG +  +AYK IVKK     ++T+Q   I    
Sbjct  845  NKDTKGIRAFKFALVEFVKDLLKPTWKEGQIGKEAYKNIVKKVVDKVIATVQGTNIPQTP  904

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            + + +YLSF++PKL KLV  YV+K+ +S
Sbjct  905  EKIDQYLSFSKPKLSKLVQAYVEKFQKS  932



>ref|XP_010509824.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Camelina 
sativa]
Length=566

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  LK +      ++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  456  RSDGSSYKKTLKPD------EIDGEVRSDAEIKVMRQFRTAVVETVKEMLKPLWREGRLT  509

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     +S  +Q  Q+  ++ SV +YL  +  K+ KLV GYV+KYG+
Sbjct  510  KDVHNMIVKKAAEKVVSAAVQFHQVPTDTGSVDQYLGLSATKIVKLVEGYVEKYGK  565



>gb|KJB29889.1| hypothetical protein B456_005G122500 [Gossypium raimondii]
Length=854

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G   +D + ++ F+ A+VEF+K+LLKPTW+EG +  +AYK+IV+K      +TMQ   I
Sbjct  763  EGKKSKDVKGVRAFKFALVEFVKDLLKPTWKEGQIGKEAYKSIVRKVVDKVTATMQGTNI  822

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
                + + +YLSF++PKL KLV  YV+K+ +S
Sbjct  823  PRTPEKIDQYLSFSKPKLSKLVHAYVEKFQKS  854



>gb|KJB29890.1| hypothetical protein B456_005G122500 [Gossypium raimondii]
 gb|KJB29891.1| hypothetical protein B456_005G122500 [Gossypium raimondii]
Length=857

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G   +D + ++ F+ A+VEF+K+LLKPTW+EG +  +AYK+IV+K      +TMQ   I
Sbjct  766  EGKKSKDVKGVRAFKFALVEFVKDLLKPTWKEGQIGKEAYKSIVRKVVDKVTATMQGTNI  825

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
                + + +YLSF++PKL KLV  YV+K+ +S
Sbjct  826  PRTPEKIDQYLSFSKPKLSKLVHAYVEKFQKS  857



>ref|XP_010469420.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Camelina 
sativa]
Length=572

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  LK       +++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  462  RSDGSSYKKTLK------SDEIDGEVRSDAEIKVMRQFRTAVVETVKEMLKPLWREGRLT  515

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     +S  +Q  Q+  ++ SV +YL  +  K+ KLV GYV+KYG+
Sbjct  516  KDVHNMIVKKAAEKVVSAAVQFHQVPTDTGSVDQYLGLSATKIVKLVEGYVEKYGK  571



>ref|XP_002527649.1| hypothetical protein RCOM_1278130 [Ricinus communis]
 gb|EEF34720.1| hypothetical protein RCOM_1278130 [Ricinus communis]
Length=886

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 8/99 (8%)
 Frame = -3

Query  523  KVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKA  344
            K++  K G DV G+        + F+ A+VEF+K+LLKP W+EG +S DAYK IVKK   
Sbjct  791  KIDEGKKGKDVKGI--------RAFKFALVEFVKDLLKPAWKEGQMSKDAYKNIVKKVVD  842

Query  343  NFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDK  227
                TMQ   I    + +++YLSF++PKL KLV  YV+K
Sbjct  843  KVTGTMQGASIPQTQEKIQQYLSFSKPKLTKLVQAYVEK  881



>ref|XP_010030848.1| PREDICTED: uncharacterized protein LOC104420739 isoform X3 [Eucalyptus 
grandis]
 gb|KCW83740.1| hypothetical protein EUGRSUZ_B00612 [Eucalyptus grandis]
Length=698

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (51%), Gaps = 26/153 (17%)
 Frame = -3

Query  682  DTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKS  503
            DTAG     + Y S        +++F D  +A +     D ++  G   K          
Sbjct  569  DTAGVEVGAVEYVS--------ASNFIDAADATEVEMEIDQIKSTGKSKK----------  610

Query  502  GNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ  323
                    H+DSR++K F+ A+V+F+KE+L+P+WR G +S +AYK I+KKT      TM+
Sbjct  611  --------HKDSRSMKPFKIALVDFVKEVLRPSWRRGNMSKEAYKTILKKTVDKVTGTMK  662

Query  322  PEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
               I  +   +  Y+  +Q KL KLV+ YVDKY
Sbjct  663  SHHIPKSRAEINHYIDSSQRKLTKLVMRYVDKY  695



>ref|XP_010030843.1| PREDICTED: uncharacterized protein LOC104420739 isoform X2 [Eucalyptus 
grandis]
Length=847

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (51%), Gaps = 26/153 (17%)
 Frame = -3

Query  682  DTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKS  503
            DTAG     + Y S        +++F D  +A +     D ++  G   K          
Sbjct  718  DTAGVEVGAVEYVS--------ASNFIDAADATEVEMEIDQIKSTGKSKK----------  759

Query  502  GNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ  323
                    H+DSR++K F+ A+V+F+KE+L+P+WR G +S +AYK I+KKT      TM+
Sbjct  760  --------HKDSRSMKPFKIALVDFVKEVLRPSWRRGNMSKEAYKTILKKTVDKVTGTMK  811

Query  322  PEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
               I  +   +  Y+  +Q KL KLV+ YVDKY
Sbjct  812  SHHIPKSRAEINHYIDSSQRKLTKLVMRYVDKY  844



>ref|XP_010469419.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Camelina 
sativa]
Length=608

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  LK       +++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  498  RSDGSSYKKTLK------SDEIDGEVRSDAEIKVMRQFRTAVVETVKEMLKPLWREGRLT  551

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     +S  +Q  Q+  ++ SV +YL  +  K+ KLV GYV+KYG+
Sbjct  552  KDVHNMIVKKAAEKVVSAAVQFHQVPTDTGSVDQYLGLSATKIVKLVEGYVEKYGK  607



>ref|XP_010509823.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X1 [Camelina 
sativa]
Length=602

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  LK +      ++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  492  RSDGSSYKKTLKPD------EIDGEVRSDAEIKVMRQFRTAVVETVKEMLKPLWREGRLT  545

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     +S  +Q  Q+  ++ SV +YL  +  K+ KLV GYV+KYG+
Sbjct  546  KDVHNMIVKKAAEKVVSAAVQFHQVPTDTGSVDQYLGLSATKIVKLVEGYVEKYGK  601



>ref|XP_010030832.1| PREDICTED: uncharacterized protein LOC104420739 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030837.1| PREDICTED: uncharacterized protein LOC104420739 isoform X1 [Eucalyptus 
grandis]
Length=858

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (51%), Gaps = 26/153 (17%)
 Frame = -3

Query  682  DTAGAHQENIYYTSLKEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKS  503
            DTAG     + Y S        +++F D  +A +     D ++  G   K          
Sbjct  729  DTAGVEVGAVEYVS--------ASNFIDAADATEVEMEIDQIKSTGKSKK----------  770

Query  502  GNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ  323
                    H+DSR++K F+ A+V+F+KE+L+P+WR G +S +AYK I+KKT      TM+
Sbjct  771  --------HKDSRSMKPFKIALVDFVKEVLRPSWRRGNMSKEAYKTILKKTVDKVTGTMK  822

Query  322  PEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
               I  +   +  Y+  +Q KL KLV+ YVDKY
Sbjct  823  SHHIPKSRAEINHYIDSSQRKLTKLVMRYVDKY  855



>ref|XP_007148139.1| hypothetical protein PHAVU_006G183400g [Phaseolus vulgaris]
 gb|ESW20133.1| hypothetical protein PHAVU_006G183400g [Phaseolus vulgaris]
Length=844

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG + ++ +ALK   +A+V+ +KELLKP W EG LS D Y  IV+K+    +S+++P Q
Sbjct  753  MDGSMQKEVKALKMLRAALVDHVKELLKPVWHEGRLSKDEYIMIVRKSVDKVVSSIEPHQ  812

Query  313  IRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            I    D+ K+Y+S ++ K+ KLV GYV+KYG+S
Sbjct  813  I-PTIDTAKQYVSSSRVKIAKLVNGYVNKYGKS  844



>ref|XP_006293824.1| hypothetical protein CARUB_v10022810mg, partial [Capsella rubella]
 gb|EOA26722.1| hypothetical protein CARUB_v10022810mg, partial [Capsella rubella]
Length=598

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  LK +      ++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  488  RSDGSSYKKTLKAD------EIDGEVRSDAEIKVMRQFRTAVVETVKEMLKPLWREGRLT  541

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             + +  IVKK     +S  ++  Q+  +++SV++YL F   K+ KLV GYV KYG+
Sbjct  542  KEVHNMIVKKAAEKVVSGAVECHQVPTDTESVEQYLGFNATKMVKLVEGYVQKYGK  597



>ref|XP_010090865.1| Zinc finger CCCH domain-containing protein 38 [Morus notabilis]
 gb|EXB40990.1| Zinc finger CCCH domain-containing protein 38 [Morus notabilis]
Length=954

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            DG   +DS+  + F+ A+VEF+KELLKPTW+EG +  DAYK IVKK      STMQ   I
Sbjct  837  DGKKSKDSKGSRAFKFALVEFVKELLKPTWKEGQIDKDAYKNIVKKVVDKVTSTMQGANI  896

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                + +  YLSF++PKL KLV G  + Y
Sbjct  897  PQTQEKIDHYLSFSKPKLTKLVQGLDNLY  925



>ref|XP_009795159.1| PREDICTED: uncharacterized protein LOC104241896 [Nicotiana sylvestris]
Length=1337

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQ--KNGAQYKM-ELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             +FG+T EA+     N +     +G      E+++E VK   +      +DSR++K F+S+
Sbjct  1205  EFGETAEAEVGAVENGSPSDSSDGEDVPAGEIEIEQVKPSGEKK--KSKDSRSMKLFKSS  1262

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             V  F+KELLKP+WR+G +S + +K IVKKT       M+  QI  +   +  Y+  +Q K
Sbjct  1263  VANFVKELLKPSWRQGNMSKEVFKTIVKKTVDKVSGAMKSHQIPKSKAKIDHYIDSSQRK  1322

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1323  LTKLVMGYVDKY  1334



>ref|XP_009593595.1| PREDICTED: bromodomain-containing protein 4-like [Nicotiana tomentosiformis]
Length=1344

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQ--KNGAQYKM-ELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             +FG+T EA+     N +     +G      E+++E VK   +      +DSR++K F+S+
Sbjct  1212  EFGETAEAEVGAVENGSPSDSSDGEDVPAGEIEIEQVKPSGEKK--KSKDSRSMKLFKSS  1269

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             V  F+KELLKP+WR+G +S + +K IVKKT       M+  QI  +   +  Y+  +Q K
Sbjct  1270  VANFVKELLKPSWRQGNMSKEVFKTIVKKTVDKVSGAMKSHQIPKSKAKIDHYIDSSQRK  1329

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1330  LTKLVMGYVDKY  1341



>ref|XP_006293825.1| hypothetical protein CARUB_v10022810mg, partial [Capsella rubella]
 gb|EOA26723.1| hypothetical protein CARUB_v10022810mg, partial [Capsella rubella]
Length=642

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  LK +      ++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  532  RSDGSSYKKTLKAD------EIDGEVRSDAEIKVMRQFRTAVVETVKEMLKPLWREGRLT  585

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             + +  IVKK     +S  ++  Q+  +++SV++YL F   K+ KLV GYV KYG+
Sbjct  586  KEVHNMIVKKAAEKVVSGAVECHQVPTDTESVEQYLGFNATKMVKLVEGYVQKYGK  641



>ref|XP_002881309.1| frigida-essential 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57568.1| frigida-essential 1 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK  +K       +++DG V  D+  + ++QF +AVVE +KE+LKP WREG L+
Sbjct  480  RSDGSSYKKTMK------SDEIDGEVRSDAGMKVMRQFRTAVVETVKEMLKPLWREGRLT  533

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     +S  +Q  Q+  +++SV +YL  +  ++ KLV GYV+KYG+
Sbjct  534  KDVHNMIVKKAAEKVVSAAVQFHQVPTDTESVDQYLGLSATRIVKLVEGYVEKYGK  589



>gb|KFK24426.1| hypothetical protein AALP_AAs55026U000500 [Arabis alpina]
Length=589

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 72/114 (63%), Gaps = 9/114 (8%)
 Frame = -3

Query  550  NGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLSGD  377
            +G+ YK  +K       ++VDG V  D+  + ++QF +AVVE IKE+LKP WREG LS D
Sbjct  481  DGSSYKKIVK------SDEVDGEVRSDAGMKVMRQFRTAVVENIKEMLKPLWREGRLSKD  534

Query  376  AYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +  IVKK     +S  +Q  Q+  +++SV++YL  +  K+ KLV GY +KYG+
Sbjct  535  VHNMIVKKAAEKVVSAAVQFHQVPTDTESVEQYLGLSATKIVKLVEGYAEKYGK  588



>gb|KDO65703.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
Length=1038

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  907   EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  963

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  964   LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1023

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1024  LTKLVMGYVDKY  1035



>ref|XP_004301108.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011464298.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011464299.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=1459

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  472   DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDS  293
             DSR+ + F+SAV +F+K+LLKP+WR+G +S +A+K IVKKT       M+  QI  +   
Sbjct  1374  DSRSTRLFKSAVADFVKDLLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSEAK  1433

Query  292   VKEYLSFAQPKLEKLVLGYVDKY  224
             +  Y+  +Q KL KLV+GYVDKY
Sbjct  1434  INHYIDSSQRKLTKLVMGYVDKY  1456



>ref|XP_011464300.1| PREDICTED: serine/arginine repetitive matrix protein 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=1442

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  472   DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDS  293
             DSR+ + F+SAV +F+K+LLKP+WR+G +S +A+K IVKKT       M+  QI  +   
Sbjct  1357  DSRSTRLFKSAVADFVKDLLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSEAK  1416

Query  292   VKEYLSFAQPKLEKLVLGYVDKY  224
             +  Y+  +Q KL KLV+GYVDKY
Sbjct  1417  INHYIDSSQRKLTKLVMGYVDKY  1439



>gb|ABK25348.1| unknown [Picea sitchensis]
Length=488

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F  A+ EF+KE LKP+WREG +S +A+K IVKK        MQ  QI  +  
Sbjct  402  KDSRSMKLFRQALAEFVKEALKPSWREGHMSKEAFKTIVKKAVDKVAGAMQNHQIPKSRG  461

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGR  218
             + +Y++ ++ KL KLV GYVDKY R
Sbjct  462  RIDQYVASSERKLTKLVQGYVDKYVR  487



>gb|KDO65701.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
Length=1436

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1305  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1361

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1362  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1421

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1422  LTKLVMGYVDKY  1433



>gb|KDO65697.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
 gb|KDO65698.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
 gb|KDO65699.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
Length=1440

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1309  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1365

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1366  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1425

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1426  LTKLVMGYVDKY  1437



>gb|KDO65700.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
Length=1411

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1280  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1336

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1337  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1396

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1397  LTKLVMGYVDKY  1408



>ref|XP_006440779.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 gb|ESR54019.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
Length=1264

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1133  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1189

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1190  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1249

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1250  LTKLVMGYVDKY  1261



>ref|XP_006440778.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 ref|XP_006440780.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 gb|ESR54018.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 gb|ESR54020.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
Length=1410

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1279  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1335

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1336  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1395

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1396  LTKLVMGYVDKY  1407



>emb|CDY27932.1| BnaCnng05170D [Brassica napus]
Length=689

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQD--SRALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ ++ +LK +      ++DG V  D  ++ ++QF +AVVE IK++LKP WREG LS
Sbjct  501  RSDGSSHQKKLKTD------EMDGEVRSDAGTKVMRQFRTAVVETIKDMLKPLWREGRLS  554

Query  382  GDAYKAIVKKTKANFLS-TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVK+     +S  +Q  Q+  N++SV++YLS +  ++ KLV GYV+K+G+
Sbjct  555  KDVHNMIVKRATEKIVSAAVQLHQVPTNNESVEKYLSMSSTRIVKLVEGYVEKFGK  610



>gb|KDO65696.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
Length=1441

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1310  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1366

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1367  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1426

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1427  LTKLVMGYVDKY  1438



>ref|XP_006440777.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 ref|XP_006440781.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 gb|ESR54017.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
 gb|ESR54021.1| hypothetical protein CICLE_v10018493mg [Citrus clementina]
Length=1439

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1308  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1364

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1365  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1424

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1425  LTKLVMGYVDKY  1436



>gb|KDO65695.1| hypothetical protein CISIN_1g000480mg [Citrus sinensis]
Length=1469

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1338  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1394

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1395  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDQYIVSSQRK  1454

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1455  LTKLVMGYVDKY  1466



>ref|XP_010042580.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Eucalyptus 
grandis]
Length=211

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
             +DSR++K F+ A+ +F++E+L+P+WR+G +S +A+K IVKKT       M+   I  + 
Sbjct  124  RKDSRSMKLFKIALADFVREVLRPSWRQGNMSKEAFKTIVKKTVNKVTGAMKSHHIPKSQ  183

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
              +  Y+  +Q KL KLV+GYVDKY
Sbjct  184  VKINHYIDSSQRKLTKLVMGYVDKY  208



>ref|XP_011628568.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Amborella 
trichopoda]
 ref|XP_011628569.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Amborella 
trichopoda]
Length=978

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  463  ALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKE  284
             ++ F+ A+V+F+KELLKPTW+EG +S +A+K IVKK       T+Q  QI +  + + +
Sbjct  896  GMRMFKFALVDFVKELLKPTWKEGHMSKEAHKTIVKKVVDKVTGTLQGPQIPNTQEKIDQ  955

Query  283  YLSFAQPKLEKLVLGYVDKYGRS  215
            YLSF+Q KL KLV  YV+KY +S
Sbjct  956  YLSFSQEKLTKLVQAYVEKYVKS  978



>gb|EEC74757.1| hypothetical protein OsI_10522 [Oryza sativa Indica Group]
Length=357

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT     S++    I     
Sbjct  271  KDSRSMKLFKVAIADFVKEVLKPSWRQGNISREAFKTIVKKTVDKVSSSVPNNHIPKTPA  330

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K+Y+  +Q K+ KLV+GYVDKY
Sbjct  331  KIKQYVQSSQKKVTKLVMGYVDKY  354



>gb|ERN19938.1| hypothetical protein AMTR_s00071p00110320 [Amborella trichopoda]
Length=957

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  463  ALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKE  284
             ++ F+ A+V+F+KELLKPTW+EG +S +A+K IVKK       T+Q  QI +  + + +
Sbjct  875  GMRMFKFALVDFVKELLKPTWKEGHMSKEAHKTIVKKVVDKVTGTLQGPQIPNTQEKIDQ  934

Query  283  YLSFAQPKLEKLVLGYVDKYGRS  215
            YLSF+Q KL KLV  YV+KY +S
Sbjct  935  YLSFSQEKLTKLVQAYVEKYVKS  957



>ref|XP_011657760.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X3 [Cucumis sativus]
Length=739

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -3

Query  517  ESVKSGNDVDGLVH-----QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKK  353
            ++ ++ N  DG VH     +D++ ++ F+ A+VEF+KELLKPTW+EG +S D YK IVKK
Sbjct  634  DTTENANGNDG-VHDKKKSKDAKGIRAFKFALVEFVKELLKPTWKEGHISKDVYKTIVKK  692

Query  352  TKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDK  227
                   T+Q   I    + +  YLSF++ KL KLV  YVD+
Sbjct  693  VVDKVTGTLQGGHIPQTQEKIDHYLSFSKSKLTKLVQAYVDR  734



>ref|XP_002278177.1| PREDICTED: zinc finger CCCH domain-containing protein 55 [Vitis 
vinifera]
 ref|XP_010664885.1| PREDICTED: zinc finger CCCH domain-containing protein 55 [Vitis 
vinifera]
Length=913

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  496  DVDGLVHQ-----DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS  332
            D DG V +     D + ++ F++A+VEF+KE+LKPTW+EG +S + +K IVKK       
Sbjct  815  DADGGVDEGNRIKDEKGMRIFKNALVEFVKEILKPTWKEGQMSREVHKTIVKKVVDKVTG  874

Query  331  TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            T+Q E +    + + +YLS+++PKL KLV  YV+K+ +S
Sbjct  875  TIQGEHVPKTQEKIDQYLSYSKPKLTKLVQAYVEKFLKS  913



>ref|XP_010245822.1| PREDICTED: zinc finger CCCH domain-containing protein 55 [Nelumbo 
nucifera]
Length=1019

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = -3

Query  496   DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPE  317
             D +G  +++++ ++ F+ A+VEF+KE+LKPTW+EG +S +A+K IVKK      ST+Q  
Sbjct  926   DEEGKRNKEAKGMRMFKFALVEFVKEILKPTWKEGQMSKEAHKTIVKKVVDKVTSTLQGA  985

Query  316   QIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
             Q+    + +  YLS+++ KL KLV  YV+KY
Sbjct  986   QVPQTQEKIDHYLSYSKAKLTKLVQAYVEKY  1016



>ref|XP_006477692.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X1 [Citrus sinensis]
Length=1436

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1305  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1361

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1362  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKNHQIPKSQAKIDQYIVSSQRK  1421

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1422  LTKLVMGYVDKY  1433



>ref|XP_006477693.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X2 [Citrus sinensis]
Length=1408

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1277  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1333

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1334  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKNHQIPKSQAKIDQYIVSSQRK  1393

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1394  LTKLVMGYVDKY  1405



>ref|XP_006477694.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X3 [Citrus sinensis]
Length=1382

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQK-NGAQY--KMELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G++ +A+     N++    NGA      E++++ +KS +      +++SR++K F+ A
Sbjct  1251  EYGESADAEVGAVENESPNNPNGAGNLNSGEIEIDPIKSPSKSK---NKESRSMKLFKVA  1307

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WREG +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1308  LADFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMKNHQIPKSQAKIDQYIVSSQRK  1367

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1368  LTKLVMGYVDKY  1379



>emb|CBI19970.3| unnamed protein product [Vitis vinifera]
Length=994

 Score = 84.7 bits (208),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -3

Query  496  DVDGLVHQ-----DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS  332
            D DG V +     D + ++ F++A+VEF+KE+LKPTW+EG +S + +K IVKK       
Sbjct  896  DADGGVDEGNRIKDEKGMRIFKNALVEFVKEILKPTWKEGQMSREVHKTIVKKVVDKVTG  955

Query  331  TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            T+Q E +    + + +YLS+++PKL KLV  YV+K+ +S
Sbjct  956  TIQGEHVPKTQEKIDQYLSYSKPKLTKLVQAYVEKFLKS  994



>ref|XP_011657755.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis sativus]
 ref|XP_011657756.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis sativus]
 ref|XP_011657758.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis sativus]
Length=876

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -3

Query  517  ESVKSGNDVDGLVH-----QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKK  353
            ++ ++ N  DG VH     +D++ ++ F+ A+VEF+KELLKPTW+EG +S D YK IVKK
Sbjct  771  DTTENANGNDG-VHDKKKSKDAKGIRAFKFALVEFVKELLKPTWKEGHISKDVYKTIVKK  829

Query  352  TKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDK  227
                   T+Q   I    + +  YLSF++ KL KLV  YVD+
Sbjct  830  VVDKVTGTLQGGHIPQTQEKIDHYLSFSKSKLTKLVQAYVDR  871



>ref|XP_011657759.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X2 [Cucumis sativus]
 gb|KGN48365.1| hypothetical protein Csa_6G483460 [Cucumis sativus]
Length=873

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = -3

Query  517  ESVKSGNDVDGLVH-----QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKK  353
            ++ ++ N  DG VH     +D++ ++ F+ A+VEF+KELLKPTW+EG +S D YK IVKK
Sbjct  768  DTTENANGNDG-VHDKKKSKDAKGIRAFKFALVEFVKELLKPTWKEGHISKDVYKTIVKK  826

Query  352  TKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDK  227
                   T+Q   I    + +  YLSF++ KL KLV  YVD+
Sbjct  827  VVDKVTGTLQGGHIPQTQEKIDHYLSFSKSKLTKLVQAYVDR  868



>emb|CAN61511.1| hypothetical protein VITISV_013331 [Vitis vinifera]
Length=913

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -3

Query  496  DVDGLVHQ-----DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS  332
            D DG V +     D + ++ F++A+VEF+KE+LKPTW+EG +S + +K IVKK       
Sbjct  815  DADGGVDEGNRIKDEKGMRIFKNALVEFVKEILKPTWKEGQMSREVHKTIVKKVVDKVTG  874

Query  331  TMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            T+Q E +    + +  YLS+++PKL KLV  YV+K+ +S
Sbjct  875  TIQGEHVPKTQEKIDHYLSYSKPKLTKLVQAYVEKFLKS  913



>ref|XP_008439820.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Cucumis melo]
 ref|XP_008439821.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Cucumis melo]
 ref|XP_008439822.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X1 [Cucumis melo]
Length=739

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG   ++S+A + F SA++E +KE+LKP WREG L  D +  +VKKT    L  +Q  Q
Sbjct  645  LDGNAPKESKATRHFRSALIELVKEILKPKWREGHLKKDVHNTVVKKTFDKVLGALQSHQ  704

Query  313  IRDNSDSVKEYLSFAQPKLEKLV  245
            +   ++SVK+YLS ++PK+EKLV
Sbjct  705  VPTTAESVKQYLSSSRPKIEKLV  727



>ref|XP_006649632.1| PREDICTED: nuclear receptor coactivator 6-like [Oryza brachyantha]
Length=965

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F++A+ +F+KE+LKP+WR+G +S +A+K IVKKT     S +    I     
Sbjct  879  KDSRSMKLFKAAIADFVKEVLKPSWRQGNISREAFKTIVKKTVDKVSSAVPNNHIPKTPA  938

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K+Y+  +Q K+ KLV+GYVDKY
Sbjct  939  KIKQYVQSSQKKVTKLVMGYVDKY  962



>ref|XP_008439827.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 isoform X3 [Cucumis melo]
Length=631

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  493  VDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQ  314
            +DG   ++S+A + F SA++E +KE+LKP WREG L  D +  +VKKT    L  +Q  Q
Sbjct  537  LDGNAPKESKATRHFRSALIELVKEILKPKWREGHLKKDVHNTVVKKTFDKVLGALQSHQ  596

Query  313  IRDNSDSVKEYLSFAQPKLEKLV  245
            +   ++SVK+YLS ++PK+EKLV
Sbjct  597  VPTTAESVKQYLSSSRPKIEKLV  619



>gb|EYU23832.1| hypothetical protein MIMGU_mgv1a003868mg [Erythranthe guttata]
Length=559

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -3

Query  481  VHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDN  302
             ++D + ++ F++++VEF+K+LLKPTW+EG +S +A+K IVKK      ST+Q +QI   
Sbjct  469  TNKDDKGIRIFKNSLVEFVKDLLKPTWKEGKMSREAHKTIVKKVVDKVTSTIQADQIPKT  528

Query  301  SDSVKEYLSFAQPKLEKLVLGYVDK  227
             + +++YLS+++PK+ KLV  YV +
Sbjct  529  QEKIEQYLSYSKPKIAKLVQAYVGR  553



>ref|XP_010105373.1| Zinc finger CCCH domain-containing protein 55 [Morus notabilis]
 gb|EXC04469.1| Zinc finger CCCH domain-containing protein 55 [Morus notabilis]
Length=617

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 74/130 (57%), Gaps = 5/130 (4%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKN-GAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVV  434
            +FG+T +A+     N++  K  G     E   E+   G        +DSR+ K F+ A+ 
Sbjct  489  EFGETADAEVGSVQNESPSKPVGVATAGERGTETKSPGKKKK----KDSRSTKPFKIAIA  544

Query  433  EFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLE  254
            +F+K++LKP+WR+G +S +A+K IVKKT       M+  Q+  +   + +Y+   Q KL 
Sbjct  545  DFVKDVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKGHQMPKSQAKINQYIDSQQRKLT  604

Query  253  KLVLGYVDKY  224
            KLV+GYVDKY
Sbjct  605  KLVMGYVDKY  614



>emb|CBI15319.3| unnamed protein product [Vitis vinifera]
Length=1155

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +  
Sbjct  1069  KDSRSMKLFKVALADFVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQA  1128

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              +  Y+  +Q KL KLV+GYVDKY
Sbjct  1129  KINHYIDSSQRKLTKLVMGYVDKY  1152



>ref|XP_002438162.1| hypothetical protein SORBIDRAFT_10g008980 [Sorghum bicolor]
 gb|EER89529.1| hypothetical protein SORBIDRAFT_10g008980 [Sorghum bicolor]
Length=231

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IV+KT     +++    I     
Sbjct  145  KDSRSMKLFKIAIADFVKEVLKPSWRQGNMSKEAFKTIVRKTVDKVSNSVPSSHIPKTPA  204

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K Y+  +Q K+ KLV+GYVDKY
Sbjct  205  RIKHYVQSSQKKVTKLVMGYVDKY  228



>ref|XP_008239998.1| PREDICTED: serine/arginine repetitive matrix protein 2 [Prunus 
mume]
Length=1486

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR+++ F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +  
Sbjct  1400  KDSRSMRLFKIAIADFVKEILKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKRHQIPKSQA  1459

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              +  Y+  +Q KL KLV+GYVDKY
Sbjct  1460  KINHYIDSSQRKLTKLVMGYVDKY  1483



>ref|XP_007208403.1| hypothetical protein PRUPE_ppa001169mg [Prunus persica]
 gb|EMJ09602.1| hypothetical protein PRUPE_ppa001169mg [Prunus persica]
Length=890

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+VEF+K+LLKPTW+EG ++ DAYK IVKK      STMQ   I    + + 
Sbjct  807  KGSRAFKFALVEFVKDLLKPTWKEGQINKDAYKTIVKKVVDKVTSTMQGANIPQTQEKID  866

Query  286  EYLSFAQPKLEKLVLGYVDK  227
             YLSF++PKL KLV  YV+K
Sbjct  867  HYLSFSKPKLTKLVQAYVEK  886



>ref|XP_002265512.2| PREDICTED: uncharacterized protein LOC100246698 [Vitis vinifera]
 ref|XP_010663452.1| PREDICTED: uncharacterized protein LOC100246698 [Vitis vinifera]
 ref|XP_010663453.1| PREDICTED: uncharacterized protein LOC100246698 [Vitis vinifera]
 ref|XP_010663454.1| PREDICTED: uncharacterized protein LOC100246698 [Vitis vinifera]
 ref|XP_010663455.1| PREDICTED: uncharacterized protein LOC100246698 [Vitis vinifera]
 ref|XP_010663456.1| PREDICTED: uncharacterized protein LOC100246698 [Vitis vinifera]
Length=1637

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +  
Sbjct  1551  KDSRSMKLFKVALADFVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQA  1610

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              +  Y+  +Q KL KLV+GYVDKY
Sbjct  1611  KINHYIDSSQRKLTKLVMGYVDKY  1634



>dbj|BAJ95044.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97089.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=870

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S DA+K IV+KT     S++    I     
Sbjct  784  KDSRSMKLFKVAIADFVKEVLKPSWRQGNMSRDAFKMIVRKTVDKVSSSVPGNHIPKTPA  843

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +++Y+  +Q K+ KLV+GYVDKY
Sbjct  844  KIRQYVQSSQRKVTKLVMGYVDKY  867



>ref|XP_010030916.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Eucalyptus grandis]
Length=1045

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 5/131 (4%)
 Frame = -3

Query  607   FGDTTEADKTHCSNDTVQKN---GAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAV  437
             FG+T E +     N +V          ++E++++ +KS         +DSR++K F+ A+
Sbjct  914   FGETAEVEVGAVENASVSNAIDAADATEVEMEIDQIKSPGKSK--KRKDSRSMKLFKVAL  971

Query  436   VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
              +F+KE+L+P+WR+G +S +A+K IVKKT       M+   I  +   +  Y+  +Q KL
Sbjct  972   ADFVKEVLRPSWRQGNMSKEAFKTIVKKTVDKVTGAMKSHHIPKSQVKINHYIDSSQRKL  1031

Query  256   EKLVLGYVDKY  224
              KLV+GYVDKY
Sbjct  1032  TKLVMGYVDKY  1042



>ref|XP_008645057.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=937

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+SA+ +F+KE+LKP+WR+G +S +A+K IV+KT      ++    I     
Sbjct  851  KDSRSMKLFKSAIADFVKEVLKPSWRQGNMSKEAFKTIVRKTVDKVSGSVPSSHIPKTPA  910

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K Y+  +Q K+ KLV+GYVDKY
Sbjct  911  KIKHYVQSSQRKVTKLVMGYVDKY  934



>gb|EEE58583.1| hypothetical protein OsJ_09910 [Oryza sativa Japonica Group]
Length=929

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT     S++    I     
Sbjct  843  KDSRSMKLFKVAIADFVKEVLKPSWRQGNISREAFKTIVKKTVDKVSSSVPNNHIPKTPA  902

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K+Y+  +Q K+ KLV+GYVDKY
Sbjct  903  KIKQYVQSSQKKVTKLVMGYVDKY  926



>ref|XP_010030912.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Eucalyptus grandis]
Length=1236

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 5/131 (4%)
 Frame = -3

Query  607   FGDTTEADKTHCSNDTVQKN---GAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAV  437
             FG+T E +     N +V          ++E++++ +KS         +DSR++K F+ A+
Sbjct  1105  FGETAEVEVGAVENASVSNAIDAADATEVEMEIDQIKSPGKSK--KRKDSRSMKLFKVAL  1162

Query  436   VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
              +F+KE+L+P+WR+G +S +A+K IVKKT       M+   I  +   +  Y+  +Q KL
Sbjct  1163  ADFVKEVLRPSWRQGNMSKEAFKTIVKKTVDKVTGAMKSHHIPKSQVKINHYIDSSQRKL  1222

Query  256   EKLVLGYVDKY  224
              KLV+GYVDKY
Sbjct  1223  TKLVMGYVDKY  1233



>ref|NP_001169577.1| hypothetical protein [Zea mays]
 ref|XP_008645052.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34168.1| unknown [Zea mays]
 tpg|DAA44079.1| TPA: hypothetical protein ZEAMMB73_003111 [Zea mays]
 tpg|DAA44080.1| TPA: hypothetical protein ZEAMMB73_003111 [Zea mays]
Length=978

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+SA+ +F+KE+LKP+WR+G +S +A+K IV+KT      ++    I     
Sbjct  892  KDSRSMKLFKSAIADFVKEVLKPSWRQGNMSKEAFKTIVRKTVDKVSGSVPSSHIPKTPA  951

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K Y+  +Q K+ KLV+GYVDKY
Sbjct  952  KIKHYVQSSQRKVTKLVMGYVDKY  975



>ref|XP_011623976.1| PREDICTED: uncharacterized protein LOC18435787 isoform X2 [Amborella 
trichopoda]
Length=1688

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +++RA+K F  A+ EF+K++LKP+WREG +S +A+K IVKKT       M+  QI     
Sbjct  1602  KEARAMKLFRIALAEFVKDILKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKTQA  1661

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              +++Y++ +Q KL KLV+GYVDKY
Sbjct  1662  KIEQYVASSQRKLTKLVMGYVDKY  1685



>ref|XP_007210311.1| hypothetical protein PRUPE_ppa002296mg [Prunus persica]
 gb|EMJ11510.1| hypothetical protein PRUPE_ppa002296mg [Prunus persica]
Length=691

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR+++ F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +  
Sbjct  605  KDSRSMRLFKIAIADFVKEILKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKRHQIPKSQA  664

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +  Y+  +Q KL KLV+GYVDKY
Sbjct  665  KIDHYIDSSQRKLTKLVMGYVDKY  688



>ref|NP_001049373.1| Os03g0214900 [Oryza sativa Japonica Group]
 gb|ABF94631.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11287.1| Os03g0214900 [Oryza sativa Japonica Group]
Length=979

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT     S++    I     
Sbjct  893  KDSRSMKLFKVAIADFVKEVLKPSWRQGNISREAFKTIVKKTVDKVSSSVPNNHIPKTPA  952

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +K+Y+  +Q K+ KLV+GYVDKY
Sbjct  953  KIKQYVQSSQKKVTKLVMGYVDKY  976



>ref|XP_011623975.1| PREDICTED: uncharacterized protein LOC18435787 isoform X1 [Amborella 
trichopoda]
Length=1691

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +++RA+K F  A+ EF+K++LKP+WREG +S +A+K IVKKT       M+  QI     
Sbjct  1605  KEARAMKLFRIALAEFVKDILKPSWREGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKTQA  1664

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              +++Y++ +Q KL KLV+GYVDKY
Sbjct  1665  KIEQYVASSQRKLTKLVMGYVDKY  1688



>ref|XP_010030905.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Eucalyptus grandis]
Length=1266

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 5/131 (4%)
 Frame = -3

Query  607   FGDTTEADKTHCSNDTVQKN---GAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAV  437
             FG+T E +     N +V          ++E++++ +KS         +DSR++K F+ A+
Sbjct  1135  FGETAEVEVGAVENASVSNAIDAADATEVEMEIDQIKSPGKSK--KRKDSRSMKLFKVAL  1192

Query  436   VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
              +F+KE+L+P+WR+G +S +A+K IVKKT       M+   I  +   +  Y+  +Q KL
Sbjct  1193  ADFVKEVLRPSWRQGNMSKEAFKTIVKKTVDKVTGAMKSHHIPKSQVKINHYIDSSQRKL  1252

Query  256   EKLVLGYVDKY  224
              KLV+GYVDKY
Sbjct  1253  TKLVMGYVDKY  1263



>gb|KCW83742.1| hypothetical protein EUGRSUZ_B00614 [Eucalyptus grandis]
 gb|KCW83743.1| hypothetical protein EUGRSUZ_B00614 [Eucalyptus grandis]
Length=1470

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 5/131 (4%)
 Frame = -3

Query  607   FGDTTEADKTHCSNDTVQKN---GAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAV  437
             FG+T E +     N +V          ++E++++ +KS         +DSR++K F+ A+
Sbjct  1339  FGETAEVEVGAVENASVSNAIDAADATEVEMEIDQIKSPGKSK--KRKDSRSMKLFKVAL  1396

Query  436   VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
              +F+KE+L+P+WR+G +S +A+K IVKKT       M+   I  +   +  Y+  +Q KL
Sbjct  1397  ADFVKEVLRPSWRQGNMSKEAFKTIVKKTVDKVTGAMKSHHIPKSQVKINHYIDSSQRKL  1456

Query  256   EKLVLGYVDKY  224
              KLV+GYVDKY
Sbjct  1457  TKLVMGYVDKY  1467



>dbj|BAD93829.1| hypothetical protein [Arabidopsis thaliana]
Length=152

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
             +D + ++ F+ A+VE +KELLKP W+EG L+ D YK IVKK       TMQ   +    
Sbjct  65   EKDPKGMRAFKFALVEVVKELLKPAWKEGKLNKDGYKNIVKKVAEKVTGTMQSGNVPQTQ  124

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
            + +  YLS ++PKL KLV  YV K  ++
Sbjct  125  EKIDHYLSASKPKLTKLVQAYVGKIKKT  152



>ref|XP_010027683.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Eucalyptus 
grandis]
 ref|XP_010027685.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Eucalyptus 
grandis]
 ref|XP_010027686.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Eucalyptus 
grandis]
 ref|XP_010027687.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Eucalyptus 
grandis]
 ref|XP_010027688.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Eucalyptus 
grandis]
 gb|KCW54261.1| hypothetical protein EUGRSUZ_I00225 [Eucalyptus grandis]
Length=837

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++ + L+ F+ A+VE +KELLKPTW++G +  +AYK IVKK      STMQ   I  + +
Sbjct  733  KEPKGLRAFKFALVEHVKELLKPTWKDGQIGKEAYKTIVKKAVDKVTSTMQGASIPQSQE  792

Query  295  SVKEYLSFAQPKLEKLVLGYV  233
             +  YLSFAQPKL KLV  YV
Sbjct  793  KIDHYLSFAQPKLTKLVQAYV  813



>ref|XP_009386491.1| PREDICTED: uncharacterized protein LOC103973599 [Musa acuminata 
subsp. malaccensis]
Length=1586

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ A+ EF+KE+LKP+WR+G +S +A+K IVKKT      ++   QI     
Sbjct  1500  KDSRSMKLFKVALAEFVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGSVPSHQIPKTQA  1559

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              + +Y+  +Q KL KLV+GYVDKY
Sbjct  1560  KINQYVESSQRKLTKLVMGYVDKY  1583



>ref|XP_011022967.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X2 [Populus euphratica]
Length=865

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVK+       TMQ   I    
Sbjct  777  NKDAKGNRAFKFALVEFVKDLLKPAWKEGQMSKDAYKNIVKRVVDKVTGTMQSASIPTTQ  836

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + +++YLS ++PKL KLV  YV+K+
Sbjct  837  EKIEQYLSVSKPKLTKLVQAYVEKF  861



>ref|XP_011022964.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Populus euphratica]
 ref|XP_011022965.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Populus euphratica]
Length=867

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVK+       TMQ   I    
Sbjct  779  NKDAKGNRAFKFALVEFVKDLLKPAWKEGQMSKDAYKNIVKRVVDKVTGTMQSASIPTTQ  838

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + +++YLS ++PKL KLV  YV+K+
Sbjct  839  EKIEQYLSVSKPKLTKLVQAYVEKF  863



>ref|XP_007037601.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007037602.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY22102.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY22103.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1579

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 80/132 (61%), Gaps = 6/132 (5%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQKNGAQYKM---ELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             +FG+T +A+     N +   N  +  M   E++++ +KS        ++ SR++K F+ A
Sbjct  1448  EFGETADAEVGAIENGS-PSNQVEVNMTTGEIEIDQIKSPGKSK--ENKGSRSMKLFKVA  1504

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             + +F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +   + +Y+  +Q K
Sbjct  1505  LADFVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSYQIPKSRAKIDQYIESSQRK  1564

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1565  LTKLVMGYVDKY  1576



>ref|XP_006292961.1| hypothetical protein CARUB_v10019238mg [Capsella rubella]
 gb|EOA25859.1| hypothetical protein CARUB_v10019238mg [Capsella rubella]
Length=266

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDV------DGLVHQDSRALKQF  449
            +FG+  E  +   S++T   N     ME++  +V  G+D+             SR++K F
Sbjct  130  EFGENAEIGRECNSHETGTPNSHNEDMEVE-NNVHEGDDMRKKSTEKSKERDSSRSMKLF  188

Query  448  ESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFA  269
            +  + +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  +I  +   + +Y+  +
Sbjct  189  KVVLTKFVKDLLKPSWRQGNMSKEAFKTIVKRVVDKVSNSMEGRRIPKSRAKIDKYIDTS  248

Query  268  QPKLEKLVLGYVDKY  224
            Q KL KLV+GYVDKY
Sbjct  249  QQKLTKLVMGYVDKY  263



>ref|XP_008231642.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Prunus 
mume]
Length=887

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+VEF+K+LLKPTW++G ++ DAYK IVKK      STMQ   I    + + 
Sbjct  804  KGSRAFKFALVEFVKDLLKPTWKDGQINKDAYKTIVKKVVDKVTSTMQGANIPQTQEKID  863

Query  286  EYLSFAQPKLEKLVLGYVDK  227
             YLSF++PKL KLV  YV+K
Sbjct  864  HYLSFSKPKLTKLVQAYVEK  883



>gb|AAO72717.1| unknown protein [Arabidopsis thaliana]
Length=381

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 71/116 (61%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK        K  +++DG V  D+  + ++ F +AVVE IKE+LKP WREG L+
Sbjct  271  RSDGSSYK------KTKKSDEIDGEVRSDAGMKVMRLFRTAVVETIKEMLKPLWREGRLT  324

Query  382  GDAYKAIVKKTKANFL-STMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     + + +Q  Q+  +++SV +YL  +  ++ KLV GYV+KYG+
Sbjct  325  KDVHNMIVKKAAEKVVGAAVQFHQVPTDTESVDQYLGLSGTRIVKLVEGYVEKYGK  380



>ref|XP_004502920.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Cicer arietinum]
Length=854

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+ EF+KELLKPTW+EG ++ + YK IVKK       TMQ   I    +
Sbjct  768  KDMKGIRAFKFALAEFVKELLKPTWKEGQITKEDYKTIVKKVVDKVTGTMQGANIPQTQE  827

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +  YLSF++PKL KLV  YV+K  +S
Sbjct  828  KIDHYLSFSKPKLNKLVQAYVEKVQKS  854



>ref|XP_006371890.1| hypothetical protein POPTR_0018s05310g [Populus trichocarpa]
 gb|ERP49687.1| hypothetical protein POPTR_0018s05310g [Populus trichocarpa]
Length=717

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+W++G +S +A+K IVKKT       M+  QI  +  
Sbjct  631  KDSRSMKLFKVALADFVKEVLKPSWQQGNMSKEAFKTIVKKTVDKVAGAMKSHQIPKSKV  690

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +  Y+  +Q KL KLV+GYVDKY +
Sbjct  691  KIDHYIDSSQWKLTKLVMGYVDKYAK  716



>emb|CDX79547.1| BnaC03g18830D [Brassica napus]
Length=539

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 62/94 (66%), Gaps = 3/94 (3%)
 Frame = -3

Query  490  DGLVHQD--SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS-TMQP  320
            DG V  D  ++A++QF +AVVE IKE++KP WREG L+ + +  +VK+     +S  +Q 
Sbjct  443  DGEVRSDAGTKAMRQFRTAVVETIKEMVKPLWREGRLTKEVHNMVVKRASEKIVSAAVQS  502

Query  319  EQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             Q+  +S S  +YLS +  K+ KLV GYV+KYG+
Sbjct  503  HQVPTDSASADQYLSMSATKIVKLVEGYVEKYGK  536



>ref|XP_004488474.1| PREDICTED: uncharacterized protein LOC101503336 isoform X2 [Cicer 
arietinum]
Length=1461

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ ++  F+KE+LKP+WR+G +S  A+K IVKKT       M+  +I  + +
Sbjct  1375  KDSRSMKLFKVSIANFVKEVLKPSWRQGNMSKVAFKTIVKKTVDKVSGAMKGHRIPKSQE  1434

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              + +Y+  +Q KL KLV+GYVDKY
Sbjct  1435  KISQYIDSSQRKLTKLVMGYVDKY  1458



>ref|XP_004488473.1| PREDICTED: uncharacterized protein LOC101503336 isoform X1 [Cicer 
arietinum]
Length=1568

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ ++  F+KE+LKP+WR+G +S  A+K IVKKT       M+  +I  + +
Sbjct  1482  KDSRSMKLFKVSIANFVKEVLKPSWRQGNMSKVAFKTIVKKTVDKVSGAMKGHRIPKSQE  1541

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              + +Y+  +Q KL KLV+GYVDKY
Sbjct  1542  KISQYIDSSQRKLTKLVMGYVDKY  1565



>ref|XP_002307020.2| hypothetical protein POPTR_0005s06240g [Populus trichocarpa]
 gb|EEE94016.2| hypothetical protein POPTR_0005s06240g [Populus trichocarpa]
Length=858

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVKK       TM    I    
Sbjct  770  NKDAKGNRAFKFALVEFVKDLLKPAWKEGQISKDAYKNIVKKVVDKVTGTMHSASIPTTQ  829

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + +++YLS ++PKL KLV  YV+K+
Sbjct  830  EKIEQYLSVSKPKLTKLVQAYVEKF  854



>ref|XP_006354749.1| PREDICTED: uncharacterized protein LOC102603976 isoform X1 [Solanum 
tuberosum]
Length=1328

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQKNGAQYKM---ELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             +FG+T EA+     N +   +  +  +   E+++E VK   +      ++SR+++ F+ +
Sbjct  1196  EFGETAEAEVGAVENGSPSDSSDEEDVPTGEIEIEQVKPSGEKKK--SKESRSMRLFKIS  1253

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             V  F+KE+LKP+WR+G +S + +K IVKKT       M+  QI  +   +  Y+  +Q K
Sbjct  1254  VANFVKEMLKPSWRQGNMSKEVFKTIVKKTVDKVSGAMKSHQIPKSKTKIDHYIDSSQRK  1313

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1314  LTKLVMGYVDKY  1325



>ref|XP_011009255.1| PREDICTED: uncharacterized protein LOC105114418 isoform X2 [Populus 
euphratica]
Length=781

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+W++G +S +A+K IVKKT       M+  QI  +  
Sbjct  695  KDSRSMKLFKIALADFVKEVLKPSWQQGNMSKEAFKTIVKKTVDKVAGAMKSHQIPKSKV  754

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +  Y+  +Q KL KLV+GYVDKY +
Sbjct  755  KIDHYIDSSQWKLTKLVMGYVDKYAK  780



>ref|XP_004985193.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X2 [Setaria italica]
Length=903

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IV+KT     +++    I     
Sbjct  817  KDSRSMKLFKVAIADFVKEVLKPSWRQGNMSKEAFKTIVRKTVDKVSNSVPSSHIPKTPA  876

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +K Y+  +Q K+ KLV+GYVDKY +
Sbjct  877  KIKHYVQSSQRKVTKLVMGYVDKYAK  902



>ref|XP_003595771.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES66022.1| hypothetical protein MTR_2g060650 [Medicago truncatula]
Length=1448

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ ++  F+KE+LKP+WR+G +S  A+K IVKKT       M+  +I  + +
Sbjct  1362  KDSRSMKLFKVSIANFVKEVLKPSWRQGNMSKVAFKTIVKKTVDKVSGAMKGHRIPKSQE  1421

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              + +Y+  +Q KL KLV+GYVDKY
Sbjct  1422  KISQYIDSSQRKLTKLVMGYVDKY  1445



>ref|XP_011009254.1| PREDICTED: uncharacterized protein LOC105114418 isoform X1 [Populus 
euphratica]
Length=797

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+W++G +S +A+K IVKKT       M+  QI  +  
Sbjct  711  KDSRSMKLFKIALADFVKEVLKPSWQQGNMSKEAFKTIVKKTVDKVAGAMKSHQIPKSKV  770

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +  Y+  +Q KL KLV+GYVDKY +
Sbjct  771  KIDHYIDSSQWKLTKLVMGYVDKYAK  796



>ref|XP_004985192.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X1 [Setaria italica]
Length=949

 Score = 81.3 bits (199),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +DSR++K F+ A+ +F+KE+LKP+WR+G +S +A+K IV+KT     +++    I     
Sbjct  863  KDSRSMKLFKVAIADFVKEVLKPSWRQGNMSKEAFKTIVRKTVDKVSNSVPSSHIPKTPA  922

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGR  218
             +K Y+  +Q K+ KLV+GYVDKY +
Sbjct  923  KIKHYVQSSQRKVTKLVMGYVDKYAK  948



>ref|XP_008365252.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Malus domestica]
 ref|XP_008365253.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Malus domestica]
Length=881

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  457  KQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYL  278
            + F  A+VE +KELLKP+W+EG +S DAYK IVKK      STMQ   I    + +  YL
Sbjct  801  RAFRFALVENVKELLKPSWKEGQVSKDAYKTIVKKVVDKVTSTMQGANIPQTQEKIDHYL  860

Query  277  SFAQPKLEKLVLGYVDK  227
            SF++PKL KLV  YV+K
Sbjct  861  SFSKPKLTKLVQAYVEK  877



>ref|XP_010030823.1| PREDICTED: uncharacterized protein LOC104420717 isoform X2 [Eucalyptus 
grandis]
Length=858

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
             +DSR++K F+ A+ +F++E+L+P+WR+G +S +A+K IVKKT       M+   I  + 
Sbjct  771  RKDSRSMKLFKIALADFVREVLRPSWRQGNMSKEAFKTIVKKTVNKVTGAMKSHHIPKSQ  830

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
              +  Y+  +Q KL KLV+GYVDKY
Sbjct  831  VKINHYIDSSQRKLTKLVMGYVDKY  855



>ref|XP_008441040.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X3 [Cucumis melo]
Length=738

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -3

Query  460  LKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEY  281
            ++ F+ A+VEF+KELLKPTW+EG +S D YK IVKK       T+Q   I    + +  Y
Sbjct  656  IRAFKFALVEFVKELLKPTWKEGHISKDVYKTIVKKVVDKVTGTLQGGHIPQTQEKIDHY  715

Query  280  LSFAQPKLEKLVLGYVDK  227
            LSF++ KL KLV  YVD+
Sbjct  716  LSFSKSKLTKLVQAYVDR  733



>ref|XP_011007566.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X3 [Populus euphratica]
Length=863

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVKK      STM    I    
Sbjct  775  NKDAKGNRAFKFALVEFVKDLLKPAWKEGQISKDAYKNIVKKVVDKVTSTMHSASIPTTQ  834

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + ++ YLS ++PKL KLV  YV+K+
Sbjct  835  EKIELYLSVSKPKLTKLVQAYVEKF  859



>ref|XP_011007564.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X2 [Populus euphratica]
Length=864

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVKK      STM    I    
Sbjct  776  NKDAKGNRAFKFALVEFVKDLLKPAWKEGQISKDAYKNIVKKVVDKVTSTMHSASIPTTQ  835

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + ++ YLS ++PKL KLV  YV+K+
Sbjct  836  EKIELYLSVSKPKLTKLVQAYVEKF  860



>ref|XP_011007563.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Populus euphratica]
Length=880

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVKK      STM    I    
Sbjct  792  NKDAKGNRAFKFALVEFVKDLLKPAWKEGQISKDAYKNIVKKVVDKVTSTMHSASIPTTQ  851

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + ++ YLS ++PKL KLV  YV+K+
Sbjct  852  EKIELYLSVSKPKLTKLVQAYVEKF  876



>ref|XP_011072878.1| PREDICTED: uncharacterized protein LOC105157993 [Sesamum indicum]
 ref|XP_011072879.1| PREDICTED: uncharacterized protein LOC105157993 [Sesamum indicum]
 ref|XP_011072880.1| PREDICTED: uncharacterized protein LOC105157993 [Sesamum indicum]
Length=1429

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 68/115 (59%), Gaps = 6/115 (5%)
 Frame = -3

Query  568   NDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGL  389
             NDT   N      E++++ VK+         +DSR++K F+ ++  F+KE+LKP+WR+G 
Sbjct  1318  NDTTDLNAG----EIEIDQVKASGKK--KKGKDSRSMKLFKISIATFVKEVLKPSWRQGN  1371

Query  388   LSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
             +S +A+K IVKKT       M+   I  +   +  Y+  ++ KL KLV+GYVDKY
Sbjct  1372  MSKEAFKTIVKKTVDKVSGAMKSHHIPRSQSKINHYIDSSRGKLTKLVMGYVDKY  1426



>ref|XP_010030812.1| PREDICTED: uncharacterized protein LOC104420717 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030818.1| PREDICTED: uncharacterized protein LOC104420717 isoform X1 [Eucalyptus 
grandis]
Length=863

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
             +DSR++K F+ A+ +F++E+L+P+WR+G +S +A+K IVKKT       M+   I  + 
Sbjct  776  RKDSRSMKLFKIALADFVREVLRPSWRQGNMSKEAFKTIVKKTVNKVTGAMKSHHIPKSQ  835

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
              +  Y+  +Q KL KLV+GYVDKY
Sbjct  836  VKINHYIDSSQRKLTKLVMGYVDKY  860



>ref|XP_002310510.2| hypothetical protein POPTR_0007s03970g [Populus trichocarpa]
 ref|XP_006380374.1| hypothetical protein POPTR_0007s03970g [Populus trichocarpa]
 ref|XP_006380375.1| hypothetical protein POPTR_0007s03970g [Populus trichocarpa]
 gb|EEE90960.2| hypothetical protein POPTR_0007s03970g [Populus trichocarpa]
 gb|ERP58171.1| hypothetical protein POPTR_0007s03970g [Populus trichocarpa]
 gb|ERP58172.1| hypothetical protein POPTR_0007s03970g [Populus trichocarpa]
Length=860

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -3

Query  478  HQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNS  299
            ++D++  + F+ A+VEF+K+LLKP W+EG +S DAYK IVKK       TMQ   I    
Sbjct  772  NKDAKGSRAFKFALVEFVKDLLKPAWKEGQMSKDAYKNIVKKVVDKVTGTMQSASIPTTQ  831

Query  298  DSVKEYLSFAQPKLEKLVLGYVDKY  224
            + +++YL  ++PKL KLV  YV+K+
Sbjct  832  EKIEQYLLVSKPKLTKLVQAYVEKF  856



>ref|NP_850221.1| zinc finger domain protein FES1 [Arabidopsis thaliana]
 sp|Q84VG7.2|FES1_ARATH RecName: Full=Protein FRIGIDA-ESSENTIAL 1; AltName: Full=Zinc 
finger CCCH domain-containing protein 27; Short=AtC3H27 [Arabidopsis 
thaliana]
 gb|AEC08893.1| zinc finger CCCH domain-containing protein 27 [Arabidopsis thaliana]
Length=587

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 71/116 (61%), Gaps = 9/116 (8%)
 Frame = -3

Query  556  QKNGAQYKMELKVESVKSGNDVDGLVHQDS--RALKQFESAVVEFIKELLKPTWREGLLS  383
            + +G+ YK        K  +++DG V  D+  + ++ F +AVVE IKE+LKP WREG L+
Sbjct  477  RSDGSSYK------KTKKSDEIDGEVRSDAGMKVMRLFRTAVVETIKEMLKPLWREGRLT  530

Query  382  GDAYKAIVKKTKANFL-STMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             D +  IVKK     + + +Q  Q+  +++SV +YL  +  ++ KLV GYV+KYG+
Sbjct  531  KDVHNMIVKKAAEKVVGAAVQFHQVPTDTESVDQYLGLSGTRIVKLVEGYVEKYGK  586



>ref|XP_009354057.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Pyrus x bretschneideri]
 ref|XP_009354058.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Pyrus x bretschneideri]
Length=885

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+VE +KELLKP+W+EG +S DAYK IVKK      STMQ   I    + + 
Sbjct  802  KGSRAFKFALVENVKELLKPSWKEGQVSKDAYKTIVKKVVDKVTSTMQGANIPQTQEKID  861

Query  286  EYLSFAQPKLEKLVLGYVDK  227
             YLSF++PKL KLV  YV+K
Sbjct  862  HYLSFSKPKLTKLVQAYVEK  881



>ref|XP_008441033.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis melo]
 ref|XP_008441034.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis melo]
 ref|XP_008441035.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis melo]
 ref|XP_008441036.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis melo]
 ref|XP_008441037.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis melo]
 ref|XP_008441038.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Cucumis melo]
Length=875

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -3

Query  460  LKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEY  281
            ++ F+ A+VEF+KELLKPTW+EG +S D YK IVKK       T+Q   I    + +  Y
Sbjct  793  IRAFKFALVEFVKELLKPTWKEGHISKDVYKTIVKKVVDKVTGTLQGGHIPQTQEKIDHY  852

Query  280  LSFAQPKLEKLVLGYVDK  227
            LSF++ KL KLV  YVD+
Sbjct  853  LSFSKSKLTKLVQAYVDR  870



>ref|XP_006464625.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X2 [Citrus sinensis]
Length=887

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ-PEQIRDNS  299
            +D++ L+ F+ A+ EF+KELLKPTW+EG ++ DAYK IVKK     + TMQ    I    
Sbjct  800  KDTKGLRAFKFALAEFVKELLKPTWKEGQINKDAYKNIVKKVVDKVIGTMQGAANIPQTQ  859

Query  298  DSVKEYLSFAQPKLEKLVLGYVDK  227
            + + +YLSF++ KL KLV  YV+K
Sbjct  860  EKIDQYLSFSKSKLTKLVQAYVEK  883



>ref|XP_008441039.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X2 [Cucumis melo]
Length=872

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -3

Query  460  LKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEY  281
            ++ F+ A+VEF+KELLKPTW+EG +S D YK IVKK       T+Q   I    + +  Y
Sbjct  790  IRAFKFALVEFVKELLKPTWKEGHISKDVYKTIVKKVVDKVTGTLQGGHIPQTQEKIDHY  849

Query  280  LSFAQPKLEKLVLGYVDK  227
            LSF++ KL KLV  YVD+
Sbjct  850  LSFSKSKLTKLVQAYVDR  867



>ref|XP_006464624.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Citrus sinensis]
Length=910

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ-PEQIRDNS  299
            +D++ L+ F+ A+ EF+KELLKPTW+EG ++ DAYK IVKK     + TMQ    I    
Sbjct  823  KDTKGLRAFKFALAEFVKELLKPTWKEGQINKDAYKNIVKKVVDKVIGTMQGAANIPQTQ  882

Query  298  DSVKEYLSFAQPKLEKLVLGYVDK  227
            + + +YLSF++ KL KLV  YV+K
Sbjct  883  EKIDQYLSFSKSKLTKLVQAYVEK  906



>gb|EYU23117.1| hypothetical protein MIMGU_mgv1a001325mg [Erythranthe guttata]
Length=839

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  472  DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDS  293
            DSR++  F+ ++  F+KE+LKP+WREG +S +A+K IVKKT       M+   I  +   
Sbjct  754  DSRSINSFKISIAAFVKEVLKPSWREGNMSKEAFKTIVKKTVDKVSGAMRSHHIPKSQTK  813

Query  292  VKEYLSFAQPKLEKLVLGYVDKY  224
            +  Y+  ++ KL KLV+GYVDKY
Sbjct  814  INHYIDSSRGKLTKLVMGYVDKY  836



>ref|XP_006464626.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X3 [Citrus sinensis]
Length=870

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ-PEQIRDNS  299
            +D++ L+ F+ A+ EF+KELLKPTW+EG ++ DAYK IVKK     + TMQ    I    
Sbjct  783  KDTKGLRAFKFALAEFVKELLKPTWKEGQINKDAYKNIVKKVVDKVIGTMQGAANIPQTQ  842

Query  298  DSVKEYLSFAQPKLEKLVLGYVDK  227
            + + +YLSF++ KL KLV  YV+K
Sbjct  843  EKIDQYLSFSKSKLTKLVQAYVEK  866



>ref|XP_008803631.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Phoenix dactylifera]
 ref|XP_008803633.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Phoenix dactylifera]
Length=975

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G   +D + L+ F+ A+VE++K++LKPTW+EG L+ +A+K IVKK      ST+Q   I
Sbjct  884  EGKRSRDDKGLRMFKFALVEYVKDILKPTWKEGRLTKEAHKTIVKKVIEKVTSTLQDPNI  943

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
                + +  YLS+++ KL  LV  YV KYG+S
Sbjct  944  PWTQERIDMYLSYSKVKLNNLVQAYVQKYGKS  975



>gb|KDO58340.1| hypothetical protein CISIN_1g043773mg [Citrus sinensis]
Length=925

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQ-PEQIRDNS  299
            +D++ L+ F+ A+ EF+KELLKPTW+EG ++ DAYK IVKK     + TMQ    I    
Sbjct  838  KDTKGLRAFKFALAEFVKELLKPTWKEGQINKDAYKNIVKKVVDKVIGTMQGAANIPQTQ  897

Query  298  DSVKEYLSFAQPKLEKLVLGYVDK  227
            + + +YLSF++ KL KLV  YV+K
Sbjct  898  EKIDQYLSFSKSKLTKLVQAYVEK  921



>ref|XP_010936458.1| PREDICTED: uncharacterized protein LOC105056082 [Elaeis guineensis]
Length=1616

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = -3

Query  604   GDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFI  425
             G   + D  +CS     + G     E++++ V+S         +DSR+LK  + A+ +F+
Sbjct  1490  GSPQQVDAKNCSAVIPTEGGNTAAGEIEIDHVRSPGKKKS---KDSRSLKLLKIALADFV  1546

Query  424   KELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLV  245
             KE+LKP WR+G +S +A+K IVKKT       +   QI      + +Y+  +Q KL KLV
Sbjct  1547  KEVLKPLWRQGNISKEAFKTIVKKTVDKVSGAIPSHQIPKTQAKINQYVESSQRKLTKLV  1606

Query  244   LGYVDKY  224
             + YVDKY
Sbjct  1607  MAYVDKY  1613



>ref|XP_009338137.1| PREDICTED: uncharacterized protein LOC103930516 [Pyrus x bretschneideri]
 ref|XP_009338144.1| PREDICTED: uncharacterized protein LOC103930516 [Pyrus x bretschneideri]
Length=968

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 4/131 (3%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKNGAQYKM--ELKVESVKSGNDVDGLVHQDSRALKQFESAV  437
            +FG+T +A+     ++++   G    M  E++++ V+S           S  L  F+ A+
Sbjct  837  EFGETADAEVGVVEDESLSDRGGAANMAGEIEIDQVESPGKSKKKKDSRSTRL--FKIAI  894

Query  436  VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
              F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +   +  Y+  +Q KL
Sbjct  895  ANFVKEILKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKKHQIPKSEAKINHYIDSSQRKL  954

Query  256  EKLVLGYVDKY  224
             KLV+GYVDKY
Sbjct  955  TKLVMGYVDKY  965



>ref|XP_003528232.1| PREDICTED: uncharacterized protein LOC100807768 isoform X1 [Glycine 
max]
Length=1629

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQKNGAQYKM---ELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G+T +A+     N+++  +    KM   E+++  VKS         +DSR++K F+ +
Sbjct  1497  EYGETADAEVGAVENESLSDDVDVAKMTSGEVEINQVKSPGKRK--KSKDSRSMKLFKVS  1554

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             +  F+KE+LKP+WR+G +S  A+K IVKKT       M+  ++  +   + +Y+  +Q K
Sbjct  1555  IANFVKEVLKPSWRQGNMSKVAFKTIVKKTVDKVSGAMKGHRVPKSQVKISQYIDSSQRK  1614

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1615  LTKLVMGYVDKY  1626



>ref|XP_010322582.1| PREDICTED: uncharacterized protein LOC101261830 isoform X2 [Solanum 
lycopersicum]
Length=1342

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -3

Query  529   ELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKT  350
             E+++E VK   + +    ++SR+++ F+ +V  F+KE+LKP+WR+G +S + +K IVKKT
Sbjct  1240  EVEIEQVKPSGEKNK--SKESRSMRLFKISVANFVKEMLKPSWRQGNISKEVFKTIVKKT  1297

Query  349   KANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                    M+  QI  +   +  Y+  +Q KL KLV+GYVDKY
Sbjct  1298  VDKVSGAMKSHQIPKSKSKIDHYIDSSQRKLTKLVMGYVDKY  1339



>ref|XP_010322581.1| PREDICTED: uncharacterized protein LOC101261830 isoform X1 [Solanum 
lycopersicum]
Length=1348

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -3

Query  529   ELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKT  350
             E+++E VK   + +    ++SR+++ F+ +V  F+KE+LKP+WR+G +S + +K IVKKT
Sbjct  1246  EVEIEQVKPSGEKNK--SKESRSMRLFKISVANFVKEMLKPSWRQGNISKEVFKTIVKKT  1303

Query  349   KANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                    M+  QI  +   +  Y+  +Q KL KLV+GYVDKY
Sbjct  1304  VDKVSGAMKSHQIPKSKSKIDHYIDSSQRKLTKLVMGYVDKY  1345



>ref|XP_008360880.1| PREDICTED: uncharacterized protein LOC103424566 [Malus domestica]
Length=975

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 4/131 (3%)
 Frame = -3

Query  610  DFGDTTEADKTHCSNDTVQKNGAQYKM--ELKVESVKSGNDVDGLVHQDSRALKQFESAV  437
            +FG+T +A+     ++++   G    M  E++++ V+S           S  L  F+ A+
Sbjct  844  EFGETADAEVGVVEDESLSDPGGAANMAGEIEIDQVESPGKSKKKKDSRSTRL--FKIAI  901

Query  436  VEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKL  257
              F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +   +  Y+  +Q KL
Sbjct  902  ANFVKEILKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKKHQIPKSEAKINHYIDSSQRKL  961

Query  256  EKLVLGYVDKY  224
             KLV+GYVDKY
Sbjct  962  TKLVMGYVDKY  972



>ref|XP_006578526.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Glycine 
max]
Length=1641

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  475   QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
             +DSR++K F+ ++  F+KE+LKP+WR+G +S  A+K IVKKT       M+  ++  +  
Sbjct  1555  KDSRSMKLFKVSIANFVKEVLKPSWRQGNMSKVAFKTIVKKTVDKVSGAMKGHRVPKSQT  1614

Query  295   SVKEYLSFAQPKLEKLVLGYVDKY  224
              + +Y+  +Q KL KLV+GYVDKY
Sbjct  1615  KISQYIDSSQRKLTKLVMGYVDKY  1638



>ref|XP_004288332.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011466805.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=976

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++++ ++ F+ A+ EF+K+LLKP+W++G +S DAYK IVKK       T+    I    +
Sbjct  890  KEAKGIRAFKFALAEFVKDLLKPSWKDGQVSKDAYKTIVKKVVDKVTGTIPGANIPQTQE  949

Query  295  SVKEYLSFAQPKLEKLVLGYVDK  227
             +  YLSF++PKL KLVL YV+K
Sbjct  950  KIDSYLSFSKPKLTKLVLAYVEK  972



>ref|XP_006581761.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X5 [Glycine max]
Length=702

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+VEF+KELLKPTW++G ++ D YK IVKK       +MQ   I    + + 
Sbjct  619  KGSRAFKFALVEFVKELLKPTWKDGQITKDDYKTIVKKVVDKVTGSMQGANIPQTQEKID  678

Query  286  EYLSFAQPKLEKLVLGYVDK  227
             YLSF++PKL KLV  YV+K
Sbjct  679  HYLSFSKPKLNKLVQAYVEK  698



>ref|XP_011466807.1| PREDICTED: zinc finger CCCH domain-containing protein 38 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=923

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++++ ++ F+ A+ EF+K+LLKP+W++G +S DAYK IVKK       T+    I    +
Sbjct  837  KEAKGIRAFKFALAEFVKDLLKPSWKDGQVSKDAYKTIVKKVVDKVTGTIPGANIPQTQE  896

Query  295  SVKEYLSFAQPKLEKLVLGYVDK  227
             +  YLSF++PKL KLVL YV+K
Sbjct  897  KIDSYLSFSKPKLTKLVLAYVEK  919



>ref|XP_007138369.1| hypothetical protein PHAVU_009G202700g [Phaseolus vulgaris]
 gb|ESW10363.1| hypothetical protein PHAVU_009G202700g [Phaseolus vulgaris]
Length=1633

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQKNGAQYKM---ELKVESVKSGNDVDGLVHQDSRALKQFESA  440
             ++G+T +A+     N+++  +    +M   E+++  VKS         +DSR++K F+ +
Sbjct  1501  EYGETADAEVGDIENESLSDDVDVARMSTEEVEINRVKSPGKRKK--SKDSRSMKLFKVS  1558

Query  439   VVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPK  260
             +  F+KE+LKP+WR+G +S  A+K IVKKT       M+  ++  +   + +Y+  +Q K
Sbjct  1559  IANFVKEVLKPSWRQGNMSKVAFKTIVKKTVDKVSGAMKGHRVPKSQVKISQYIDSSQQK  1618

Query  259   LEKLVLGYVDKY  224
             L KLV+GYVDKY
Sbjct  1619  LTKLVMGYVDKY  1630



>ref|NP_566802.1| histone-lysine N-methyltransferase [Arabidopsis thaliana]
 ref|NP_974368.1| histone-lysine N-methyltransferase [Arabidopsis thaliana]
 dbj|BAB01232.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL07209.1| unknown protein [Arabidopsis thaliana]
 gb|AAU05527.1| At3g26850 [Arabidopsis thaliana]
 gb|AEE77222.1| histone-lysine N-methyltransferase [Arabidopsis thaliana]
 gb|AEE77223.1| histone-lysine N-methyltransferase [Arabidopsis thaliana]
Length=265

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+  + +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  +I  +   +
Sbjct  181  SRSMKLFKVVLTKFVKDLLKPSWRQGNMSKEAFKTIVKRVVDKVSNSMEGRRIPKSRAKI  240

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
             +Y+  +Q KL KLV+GYVDKY
Sbjct  241  DKYIDSSQQKLTKLVMGYVDKY  262



>ref|XP_003528041.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Glycine max]
 ref|XP_006581758.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X2 [Glycine max]
 ref|XP_006581759.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X3 [Glycine max]
 ref|XP_006581760.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X4 [Glycine max]
 gb|KHN09598.1| Zinc finger CCCH domain-containing protein 38 [Glycine soja]
Length=828

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+VEF+KELLKPTW++G ++ D YK IVKK       +MQ   I    + + 
Sbjct  745  KGSRAFKFALVEFVKELLKPTWKDGQITKDDYKTIVKKVVDKVTGSMQGANIPQTQEKID  804

Query  286  EYLSFAQPKLEKLVLGYVDK  227
             YLSF++PKL KLV  YV+K
Sbjct  805  HYLSFSKPKLNKLVQAYVEK  824



>ref|XP_002876993.1| hypothetical protein ARALYDRAFT_347050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53252.1| hypothetical protein ARALYDRAFT_347050 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+  + +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  +I  +   +
Sbjct  182  SRSMKLFKVVLTKFVKDLLKPSWRQGNMSKEAFKTIVKRVVDKVSNSMEGHRIPKSRAKI  241

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
              Y+  +Q KL KLV+GYVDKY
Sbjct  242  DRYIDSSQQKLTKLVMGYVDKY  263



>ref|XP_009132957.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like [Brassica rapa]
Length=468

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -3

Query  490  DGLVHQD--SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS-TMQP  320
            DG    D  ++A++QF +AVVE IKE++KP WREG L+ + +  +VK+     +S  +Q 
Sbjct  372  DGEARSDAGTKAMRQFRTAVVETIKEMVKPLWREGRLTKEVHNMVVKRASEKIVSAAVQS  431

Query  319  EQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             Q+  +S  V +YLS +  K+ KLV GYV+KYG+
Sbjct  432  HQVPTDSAFVDQYLSMSATKIVKLVEGYVEKYGK  465



>ref|XP_010550283.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Tarenaya 
hassleriana]
Length=751

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KE+LKP WREG +S DAYK IVKK       TMQ   +    +
Sbjct  665  KDPKGIRAFKFALVETVKEILKPFWREGRMSKDAYKNIVKKVVDKVTGTMQNGNVPQTQE  724

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             ++ YLS ++PKL KLV  Y+ K  +S
Sbjct  725  KIEHYLSASKPKLTKLVQAYISKVKKS  751



>ref|XP_009132962.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1-like isoform X2 [Brassica 
rapa]
Length=522

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -3

Query  490  DGLVHQD--SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLS-TMQP  320
            DG    D  ++A++QF +AVVE IKE++KP WREG L+ + +  +VK+     +S  +Q 
Sbjct  426  DGEARSDAGTKAMRQFRTAVVETIKEMVKPLWREGRLTKEVHNMVVKRASEKIVSAAVQS  485

Query  319  EQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGR  218
             Q+  +S  V +YLS +  K+ KLV GYV+KYG+
Sbjct  486  HQVPTDSAFVDQYLSMSATKIVKLVEGYVEKYGK  519



>ref|XP_006406582.1| hypothetical protein EUTSA_v10020512mg [Eutrema salsugineum]
 gb|ESQ48035.1| hypothetical protein EUTSA_v10020512mg [Eutrema salsugineum]
Length=521

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KELLKP W+EG ++ D YK IVKK       TMQ   +    +
Sbjct  434  KDPKGMRAFKFALVEIVKELLKPAWKEGKMNKDGYKNIVKKVVEKVTGTMQSGNVPQTQE  493

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             +  YLS ++PKL KLV  Y+ K+
Sbjct  494  KIDHYLSASKPKLTKLVQAYISKF  517



>ref|XP_007137708.1| hypothetical protein PHAVU_009G149100g [Phaseolus vulgaris]
 gb|ESW09702.1| hypothetical protein PHAVU_009G149100g [Phaseolus vulgaris]
Length=858

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 6/106 (6%)
 Frame = -3

Query  562  TVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLS  383
            + ++NG    ME      ++G   D    +D + ++ F+ A+VEF+KELLKPTW+EG ++
Sbjct  754  STKENGPLENME------QTGGPDDAKKTKDLKGIRAFKFALVEFVKELLKPTWKEGQIT  807

Query  382  GDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLV  245
             D YK IVKK       +MQ   I    + +  YLSF++PKL KLV
Sbjct  808  KDDYKTIVKKVVDKVTGSMQGANIPQTQEKIDNYLSFSKPKLNKLV  853



>ref|NP_188494.1| zinc finger CCCH domain-containing protein 38 [Arabidopsis thaliana]
 sp|Q9LIH5.1|C3H38_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 38; 
Short=AtC3H38 [Arabidopsis thaliana]
 dbj|BAB02222.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43560.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE76125.1| zinc finger CCCH domain-containing protein 38 [Arabidopsis thaliana]
Length=676

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KELLKP W+EG L+ D YK IVKK       TMQ   +    +
Sbjct  590  KDPKGMRAFKFALVEVVKELLKPAWKEGKLNKDGYKNIVKKVAEKVTGTMQSGNVPQTQE  649

Query  295  SVKEYLSFAQPKLEKLVLGYVDK  227
             +  YLS ++PKL KLV  YV K
Sbjct  650  KIDHYLSASKPKLTKLVQAYVGK  672



>emb|CDP20617.1| unnamed protein product [Coffea canephora]
Length=895

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 76/138 (55%), Gaps = 9/138 (7%)
 Frame = -3

Query  637  KEKQLPKSADFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRAL  458
            K+++ P +++  D        C     QK       E   E VK GN   G  ++D + +
Sbjct  762  KQQEAPAASEVKDNNTESVVEC-----QKGQEDLHKENGDEHVKVGN---GNNNKDDKDM  813

Query  457  KQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYL  278
            + F++A+V+F+KE LKPTW+EG +S + +K IVKK      STMQ + I        +YL
Sbjct  814  RLFKNALVDFVKETLKPTWKEGRMSREVHKTIVKKVVDKVTSTMQ-DHIPKTQGKTDQYL  872

Query  277  SFAQPKLEKLVLGYVDKY  224
            S ++PK+ KLV  YV+++
Sbjct  873  SHSKPKITKLVQAYVERH  890



>ref|XP_011074773.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Sesamum indicum]
 ref|XP_011074774.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Sesamum indicum]
 ref|XP_011074775.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Sesamum indicum]
Length=838

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -3

Query  481  VHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDN  302
             ++D +A++ F+++++EF+K++LKPTW+EG +S + +K IVKK       T+Q + I   
Sbjct  748  ANKDDKAMRIFKNSLIEFVKDILKPTWKEGKMSREVHKTIVKKVVDKVTGTIQVDHIPKT  807

Query  301  SDSVKEYLSFAQPKLEKLVLGYVDK  227
             + V +YLS+++PK+ KLV  YV +
Sbjct  808  QEKVDQYLSYSKPKIAKLVQAYVGR  832



>ref|XP_010514354.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
 ref|XP_010514355.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
Length=262

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+  + +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  +I  +   +
Sbjct  178  SRSMKLFKVVLTKFVKDLLKPSWRQGNMSKEAFKTIVKRVVDKVSNSMEGHRIPKSRAKI  237

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
              Y+  ++ KL KLV+GYVDKY
Sbjct  238  DRYIDTSRQKLTKLVMGYVDKY  259



>ref|XP_004237737.1| PREDICTED: zinc finger CCCH domain-containing protein 55 [Solanum 
lycopersicum]
 ref|XP_010320035.1| PREDICTED: zinc finger CCCH domain-containing protein 55 [Solanum 
lycopersicum]
Length=600

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G  ++D + ++ F++A++EF+KE+LKP W+EG +S + +K IVKK        +Q EQ+
Sbjct  507  EGSGNKDEKVMRLFKNALIEFVKEILKPIWKEGKMSREVHKTIVKKVVDKVTGAIQGEQV  566

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDK  227
                + +++YLS ++PK+ KLV  YV++
Sbjct  567  PKTQEKIEQYLSHSKPKITKLVQAYVER  594



>ref|XP_004237735.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Solanum lycopersicum]
Length=837

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = -3

Query  490  DGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQI  311
            +G  + + + ++ F++A++EF+KE+LKP W+EG +S + +K IVKK     + ++Q EQ+
Sbjct  744  EGSGNNNEKVMRLFKNALIEFVKEILKPIWKEGKMSREVHKTIVKKVVDKVIGSIQGEQV  803

Query  310  RDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
                + ++EYLS ++PK+ KLV  YV+ +
Sbjct  804  AKTQEDIEEYLSRSKPKITKLVQAYVEWF  832



>ref|XP_002885268.1| hypothetical protein ARALYDRAFT_898233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61527.1| hypothetical protein ARALYDRAFT_898233 [Arabidopsis lyrata subsp. 
lyrata]
Length=685

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KELLKP W+EG L+ D YK IVKK       +MQ   +    +
Sbjct  599  KDPKGMRAFKFALVEVVKELLKPAWKEGKLNKDGYKNIVKKVAEKVTGSMQSGNVPQTQE  658

Query  295  SVKEYLSFAQPKLEKLVLGYVDK  227
             +  YLS A+PKL KLV  Y+ K
Sbjct  659  KIDHYLSAAKPKLTKLVQAYISK  681



>ref|XP_010425413.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
 ref|XP_010425415.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
 ref|XP_010425416.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
Length=263

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+  + +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  +I  +   +
Sbjct  179  SRSMKLFKVVLTKFVKDLLKPSWRQGNMSKEAFKTIVKRVVDKVSNSMEGHRIPKSRAKI  238

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
              Y+  ++ KL KLV+GYVDKY
Sbjct  239  DRYIDTSRQKLTKLVMGYVDKY  260



>emb|CAN65994.1| hypothetical protein VITISV_031553 [Vitis vinifera]
Length=347

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 68/116 (59%), Gaps = 0/116 (0%)
 Frame = -3

Query  571  SNDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVEFIKELLKPTWREG  392
            S + + K+      +++VE+ K   +       D++A+  F+  +VEF+K LL PTW++G
Sbjct  226  SRNIIDKDPDNESKKMQVEAKKPQENCPLEKSNDAKAMVAFKFQLVEFVKVLLSPTWKQG  285

Query  391  LLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
             LS +AYK IVKK     ++T++   I      + +YLS ++PK+ KLV  YV+K+
Sbjct  286  QLSKEAYKNIVKKVADKVIATIEGPYIPRTQQKIDQYLSLSKPKIAKLVQAYVEKF  341



>ref|XP_011648492.1| PREDICTED: uncharacterized protein LOC101219633 [Cucumis sativus]
 gb|KGN63739.1| hypothetical protein Csa_1G014360 [Cucumis sativus]
Length=1640

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = -3

Query  610   DFGDTTEADKTHCSNDTVQKNGAQYKMELKVESVKSGNDVDGLVHQDSRALKQFESAVVE  431
             +FG+T +A+     ND    + A    E++++ VKS           S  L  F  A+ +
Sbjct  1513  EFGETGDAEAGAVENDL--DDDANLSGEIEIDQVKSSEKSKKSKGSRSLKL--FRIAIAD  1568

Query  430   FIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSFAQPKLEK  251
             F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +   +  Y+  +Q KL K
Sbjct  1569  FVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKINRYIDSSQRKLTK  1628

Query  250   LVLGYVDKY  224
             LV+GYVDKY
Sbjct  1629  LVMGYVDKY  1637



>ref|XP_010497111.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
 ref|XP_010497112.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
 ref|XP_010497113.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
 ref|XP_010497114.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Camelina sativa]
Length=246

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+  + +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  ++  +   +
Sbjct  162  SRSMKLFKVVLTKFVKDLLKPSWRQGNMSKEAFKTIVKRVVDKVSTSMEGHRVPKSRAKI  221

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
              Y+  ++ KL KLV+GYVDKY
Sbjct  222  DRYIDTSRQKLTKLVMGYVDKY  243



>gb|KEH35591.1| zinc finger C-x8-C-x5-C-x3-H type protein, putative [Medicago 
truncatula]
Length=1024

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  466   RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
             +  + F+ A+ EF+KELLKPTW+EG ++ + YK IVKK       T+Q   I    + + 
Sbjct  941   KGSRAFKFALAEFVKELLKPTWKEGKITKEDYKTIVKKVVDKVTGTIQEANIPQTQEKID  1000

Query  286   EYLSFAQPKLEKLVLGYVDK  227
             +YLSF++PKL KLV  YV+K
Sbjct  1001  QYLSFSKPKLNKLVQAYVEK  1020



>gb|AES72838.2| zinc finger C-x8-C-x5-C-x3-H type protein, putative [Medicago 
truncatula]
Length=993

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+ EF+KELLKPTW+EG ++ + YK IVKK       T+Q   I    + + 
Sbjct  910  KGSRAFKFALAEFVKELLKPTWKEGKITKEDYKTIVKKVVDKVTGTIQEANIPQTQEKID  969

Query  286  EYLSFAQPKLEKLVLGYVDK  227
            +YLSF++PKL KLV  YV+K
Sbjct  970  QYLSFSKPKLNKLVQAYVEK  989



>ref|XP_010923915.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Elaeis guineensis]
 ref|XP_010923916.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
[Elaeis guineensis]
Length=985

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = -3

Query  496  DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPE  317
            D +G   +D + ++ F+ A+VE +K++LKPTW+EG L+ + +K IVKK      ST+Q  
Sbjct  892  DGEGKRSRDDKGVRMFKFALVEHVKDMLKPTWKEGRLTKEVHKTIVKKVVEKVTSTLQDP  951

Query  316  QIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             I    + +  YLS ++ KL KLV  YV KYG+S
Sbjct  952  TIPWTQERIDVYLSCSKVKLNKLVQAYVQKYGKS  985



>ref|XP_010680246.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680247.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010680248.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Beta 
vulgaris subsp. vulgaris]
Length=973

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 1/91 (1%)
 Frame = -3

Query  496  DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPE  317
            D DG   +D + ++ F+ A+ EF+KELLKP W++G +S +AYK IVKK       T+ P 
Sbjct  881  DHDGKKLKDIKGIRPFKFALAEFVKELLKPYWKDGQVSKEAYKTIVKKVVDKVTETLGP-  939

Query  316  QIRDNSDSVKEYLSFAQPKLEKLVLGYVDKY  224
            QI    + +  YLS ++PK+EKLV  YV K+
Sbjct  940  QIPQTKEKIDLYLSCSKPKIEKLVQAYVGKH  970



>ref|XP_003602587.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=1084

 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  457   KQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYL  278
             + F+ A+ EF+KELLKPTW+EG ++ + YK IVKK       T+Q   I    + + +YL
Sbjct  936   RAFKFALAEFVKELLKPTWKEGKITKEDYKTIVKKVVDKVTGTIQEANIPQTQEKIDQYL  995

Query  277   SFAQPKLEKLVLGYVDK  227
             SF++PKL KLV  YV+K
Sbjct  996   SFSKPKLNKLVQAYVEK  1012



>ref|XP_010260301.1| PREDICTED: uncharacterized protein LOC104599449 [Nelumbo nucifera]
Length=456

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  451  FESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSF  272
            F+ A+ +F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +   + +Y+  
Sbjct  367  FKIALADFVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKINQYIES  426

Query  271  AQPKLEKLVLGYVDKY  224
            +Q KL KLV+GYVDKY
Sbjct  427  SQHKLTKLVMGYVDKY  442



>ref|XP_002891459.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67718.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=735

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = -3

Query  496  DVDGLVHQDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPE  317
            D D    +D + ++ F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q  
Sbjct  642  DEDNKKEKDPKGMRAFKFALVEIVKELLKPAWKEGGMNKDAYKNIVKKVVDKVTGAIQTG  701

Query  316  QIRDNSDSVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             I    + +  YLS ++PKL KLV  YV K  +S
Sbjct  702  NIPQTQEKIDHYLSASKPKLTKLVQAYVSKVKKS  735



>ref|XP_009136421.1| PREDICTED: protein FRIGIDA-ESSENTIAL 1 [Brassica rapa]
Length=458

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+ A+ +F+K+LLKP+WR+G +S +A+K IVK+      ++M+  ++  +   +
Sbjct  374  SRSMKLFQVALTKFVKDLLKPSWRQGNMSKEAFKTIVKRAVDKVSNSMEGRRVPKSKAKI  433

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
             +Y+  ++ KL KLV+GYVDKY
Sbjct  434  DKYIDSSRDKLTKLVMGYVDKY  455



>ref|XP_006578794.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X4 [Glycine max]
Length=833

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  457  KQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYL  278
            + F+ A+VEF+KELLKPTW++G ++ + YK IVKK       +MQ   I    + +  YL
Sbjct  753  RAFKFALVEFVKELLKPTWKDGQITKEDYKTIVKKVVDKVTGSMQGVNIPQTQEKIDHYL  812

Query  277  SFAQPKLEKLVLGYVDK  227
            SF++PKL KLV  YV+K
Sbjct  813  SFSKPKLNKLVQAYVEK  829



>ref|XP_006578792.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X2 [Glycine max]
 ref|XP_006578793.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X3 [Glycine max]
 ref|XP_003523233.2| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Glycine max]
 gb|KHN31135.1| Zinc finger CCCH domain-containing protein 38 [Glycine soja]
Length=836

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -3

Query  457  KQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYL  278
            + F+ A+VEF+KELLKPTW++G ++ + YK IVKK       +MQ   I    + +  YL
Sbjct  756  RAFKFALVEFVKELLKPTWKDGQITKEDYKTIVKKVVDKVTGSMQGVNIPQTQEKIDHYL  815

Query  277  SFAQPKLEKLVLGYVDK  227
            SF++PKL KLV  YV+K
Sbjct  816  SFSKPKLNKLVQAYVEK  832



>emb|CDX93701.1| BnaA06g03470D [Brassica napus]
Length=626

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + +K F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q   I    +
Sbjct  540  KDPKGMKAFKFALVEIVKELLKPAWKEGGMNKDAYKNIVKKAVDKVTGAIQTGNIPQTQE  599

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +  YLS ++PKL KLV  Y+ K  +S
Sbjct  600  KIDHYLSASKPKLTKLVQAYISKVKKS  626



>ref|XP_009147935.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
[Brassica rapa]
Length=632

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + +K F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q   I    +
Sbjct  546  KDPKGMKAFKFALVEIVKELLKPAWKEGGMNKDAYKNIVKKAVDKVTGAIQTGNIPQTQE  605

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +  YLS ++PKL KLV  Y+ K  +S
Sbjct  606  KIDHYLSASKPKLTKLVQAYISKVKKS  632



>ref|XP_010500425.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Camelina sativa]
 ref|XP_010500426.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X1 [Camelina sativa]
Length=734

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q   I    +
Sbjct  648  KDPKGMRAFKFALVEIVKELLKPAWKEGGMNKDAYKNIVKKVVDKVTGAIQSGNIPQTQE  707

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +  YLS ++PKL KLV  YV K  +S
Sbjct  708  KIDHYLSASKPKLTKLVQAYVSKVKKS  734



>ref|XP_010500427.1| PREDICTED: zinc finger CCCH domain-containing protein 38-like 
isoform X2 [Camelina sativa]
Length=693

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q   I    +
Sbjct  607  KDPKGMRAFKFALVEIVKELLKPAWKEGGMNKDAYKNIVKKVVDKVTGAIQSGNIPQTQE  666

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +  YLS ++PKL KLV  YV K  +S
Sbjct  667  KIDHYLSASKPKLTKLVQAYVSKVKKS  693



>ref|XP_008392056.1| PREDICTED: zinc finger CCCH domain-containing protein 38 [Malus 
domestica]
Length=896

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            +  + F+ A+VE +KELLKP+W+EG +S DAYK IVKK      STMQ   I    + + 
Sbjct  796  KGSRAFKFALVENVKELLKPSWKEGQVSKDAYKTIVKKVVDKVTSTMQGANIPQTQEKID  855

Query  286  EYLSFAQPKLEKLV  245
             YLSF++PKL KLV
Sbjct  856  HYLSFSKPKLTKLV  869



>emb|CDY40613.1| BnaC06g02290D [Brassica napus]
Length=644

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -3

Query  472  DSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDS  293
            D + +K F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q   I    + 
Sbjct  559  DPKGMKAFKFALVEIVKELLKPAWKEGGMNKDAYKNIVKKAVDKVTGAIQTGNIPQTQEK  618

Query  292  VKEYLSFAQPKLEKLVLGYVDKYGRS  215
            +  YLS ++PKL KLV  Y+ K  +S
Sbjct  619  IDHYLSASKPKLTKLVQAYISKVKKS  644



>ref|XP_006306863.1| hypothetical protein CARUB_v10008408mg [Capsella rubella]
 gb|EOA39761.1| hypothetical protein CARUB_v10008408mg [Capsella rubella]
Length=738

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D + ++ F+ A+VE +KELLKP W+EG ++ DAYK IVKK        +Q   I    +
Sbjct  652  KDPKGMRAFKFALVEVVKELLKPAWKEGGMNKDAYKNIVKKVVDKVTGAIQSGNIPQTQE  711

Query  295  SVKEYLSFAQPKLEKLVLGYVDKYGRS  215
             +  YLS ++PKL KLV  YV K  +S
Sbjct  712  KIDHYLSASKPKLTKLVQAYVSKVKKS  738



>ref|XP_006394549.1| hypothetical protein EUTSA_v10004428mg [Eutrema salsugineum]
 gb|ESQ31835.1| hypothetical protein EUTSA_v10004428mg [Eutrema salsugineum]
Length=370

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  469  SRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSV  290
            SR++K F+  + +F+K LLKP+WR+G +S +A+K IVK+T      +M+  ++  +   +
Sbjct  286  SRSMKLFQVELTKFVKGLLKPSWRQGNMSKEAFKTIVKRTVEKVSKSMEGRRVPKSRVKI  345

Query  289  KEYLSFAQPKLEKLVLGYVDKY  224
              Y++ +Q KL KLV+GYVDK+
Sbjct  346  DRYINTSQHKLTKLVMGYVDKH  367



>ref|XP_010522535.1| PREDICTED: flocculation protein FLO11 isoform X2 [Tarenaya hassleriana]
Length=552

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++ R+ + F+  + +F+K+LLKP+WR+G +S +A+K IVKKT    L +M+  +I  +  
Sbjct  466  KEPRSTRHFKVVLTQFVKDLLKPSWRQGNMSKEAFKTIVKKTVEKVLRSMEGRRIPKSRA  525

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             ++ Y+  ++ KL KLV GYV+KY
Sbjct  526  KIERYIDSSRHKLTKLVTGYVNKY  549



>gb|EEC79460.1| hypothetical protein OsI_20470 [Oryza sativa Indica Group]
Length=625

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  451  FESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSF  272
            F   +VE +KEL+KP W+EG LS +A+K IVKK+     ++++P Q+ +   ++  Y++ 
Sbjct  547  FRFHLVEHVKELVKPIWKEGNLSKEAHKLIVKKSVDKIFASLEPNQMPETEKAITTYITA  606

Query  271  AQPKLEKLVLGYVDKY  224
            + PK+EKLV  YVD+Y
Sbjct  607  SAPKIEKLVKAYVDRY  622



>ref|XP_010522527.1| PREDICTED: flocculation protein FLO11 isoform X1 [Tarenaya hassleriana]
Length=582

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            ++ R+ + F+  + +F+K+LLKP+WR+G +S +A+K IVKKT    L +M+  +I  +  
Sbjct  496  KEPRSTRHFKVVLTQFVKDLLKPSWRQGNMSKEAFKTIVKKTVEKVLRSMEGRRIPKSRA  555

Query  295  SVKEYLSFAQPKLEKLVLGYVDKY  224
             ++ Y+  ++ KL KLV GYV+KY
Sbjct  556  KIERYIDSSRHKLTKLVTGYVNKY  579



>sp|Q75K81.1|C3H36_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 36; 
Short=OsC3H36 [Oryza sativa Japonica Group]
 gb|AAT07585.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT44278.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE64229.1| hypothetical protein OsJ_19062 [Oryza sativa Japonica Group]
Length=703

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  451  FESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEYLSF  272
            F   +VE +KEL+KP W+EG LS +A+K IVKK+     ++++P Q+ +   ++  Y++ 
Sbjct  625  FRFHLVEHVKELVKPIWKEGNLSKEAHKLIVKKSVDKIFASLEPNQMPETEKAITTYITA  684

Query  271  AQPKLEKLVLGYVDKY  224
            + PK+EKLV  YVD+Y
Sbjct  685  SAPKIEKLVKAYVDRY  700



>ref|XP_001778840.1| predicted protein [Physcomitrella patens]
 gb|EDQ56290.1| predicted protein, partial [Physcomitrella patens]
Length=100

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -3

Query  466  RALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVK  287
            R L    +AV + +KE LKPTWREG +S +A+K I KK     LS ++P Q+ +  + V 
Sbjct  24   RGLTLLRTAVADHVKETLKPTWREGQMSKEAFKTIAKKAVDKVLSVIKPHQVPNTDEKVA  83

Query  286  EYLSFAQPKLEKLV  245
             Y+  A+PK+ KLV
Sbjct  84   VYMENARPKITKLV  97



>ref|XP_010258014.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Nelumbo 
nucifera]
 ref|XP_010258015.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Nelumbo 
nucifera]
 ref|XP_010258016.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Nelumbo 
nucifera]
 ref|XP_010258017.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Nelumbo 
nucifera]
 ref|XP_010258018.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Nelumbo 
nucifera]
Length=1774

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -3

Query  460   LKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSDSVKEY  281
             ++ F+ A+  F+KE+LKP+WR+G +S +A+K IVKKT       M+  QI  +   +  Y
Sbjct  1693  MRLFKIALANFVKEVLKPSWRQGNMSKEAFKTIVKKTVDKVSGAMKSHQIPKSQAKIDRY  1752

Query  280   LSFAQPKLEKLVLGYVDKY  224
             +  +Q KL KLV+GYVDKY
Sbjct  1753  VESSQRKLTKLVMGYVDKY  1771



>ref|XP_004503948.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X2 [Cicer arietinum]
Length=816

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D++  + F+ ++VE IKELLKPTW++G ++ + YKAIVKK       T+Q   I    +
Sbjct  730  KDAKGTRAFKISLVELIKELLKPTWKDGKITKEDYKAIVKKVTDKVTGTVQRVHIPQTQE  789

Query  295  SVKEYLSFAQPKLEKLVLGYVDK  227
             +  YLS ++PKL KLV  YV+K
Sbjct  790  KIDRYLSVSKPKLIKLVQAYVEK  812



>ref|XP_004503949.1| PREDICTED: zinc finger CCCH domain-containing protein 55-like 
isoform X3 [Cicer arietinum]
Length=786

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  475  QDSRALKQFESAVVEFIKELLKPTWREGLLSGDAYKAIVKKTKANFLSTMQPEQIRDNSD  296
            +D++  + F+ ++VE IKELLKPTW++G ++ + YKAIVKK       T+Q   I    +
Sbjct  700  KDAKGTRAFKISLVELIKELLKPTWKDGKITKEDYKAIVKKVTDKVTGTVQRVHIPQTQE  759

Query  295  SVKEYLSFAQPKLEKLVLGYVDK  227
             +  YLS ++PKL KLV  YV+K
Sbjct  760  KIDRYLSVSKPKLIKLVQAYVEK  782



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1552559699600