BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8221

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07224.1|  unnamed protein product                                238   2e-70   Coffea canephora [robusta coffee]
ref|XP_009609900.1|  PREDICTED: retinoblastoma-binding protein 5 ...    233   4e-69   Nicotiana tomentosiformis
ref|XP_009609898.1|  PREDICTED: retinoblastoma-binding protein 5 ...    233   8e-69   Nicotiana tomentosiformis
ref|XP_009609899.1|  PREDICTED: retinoblastoma-binding protein 5 ...    232   1e-68   Nicotiana tomentosiformis
ref|XP_009779737.1|  PREDICTED: retinoblastoma-binding protein 5 ...    229   2e-67   Nicotiana sylvestris
ref|XP_011655820.1|  PREDICTED: protein RBL                             229   3e-67   Cucumis sativus [cucumbers]
ref|XP_009779738.1|  PREDICTED: retinoblastoma-binding protein 5 ...    228   4e-67   Nicotiana sylvestris
ref|XP_008446711.1|  PREDICTED: retinoblastoma-binding protein 5        229   4e-67   Cucumis melo [Oriental melon]
emb|CBI16678.3|  unnamed protein product                                228   6e-67   Vitis vinifera
ref|XP_002271886.1|  PREDICTED: retinoblastoma-binding protein 5 ...    228   9e-67   Vitis vinifera
emb|CAN70287.1|  hypothetical protein VITISV_003927                     227   2e-66   Vitis vinifera
ref|XP_002522890.1|  nucleotide binding protein, putative               227   3e-66   
ref|XP_012074485.1|  PREDICTED: protein RBL                             224   3e-65   Jatropha curcas
ref|XP_002300221.2|  hypothetical protein POPTR_0001s31290g             221   3e-64   Populus trichocarpa [western balsam poplar]
gb|KCW65158.1|  hypothetical protein EUGRSUZ_G02654                     218   4e-64   Eucalyptus grandis [rose gum]
ref|XP_007010539.1|  Transducin/WD40 repeat-like superfamily protein    221   6e-64   
ref|XP_011012485.1|  PREDICTED: retinoblastoma-binding protein 5 ...    220   9e-64   Populus euphratica
ref|XP_006370892.1|  transducin family protein                          220   9e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011000114.1|  PREDICTED: retinoblastoma-binding protein 5 ...    219   3e-63   Populus euphratica
ref|XP_010067087.1|  PREDICTED: retinoblastoma-binding protein 5 ...    218   7e-63   Eucalyptus grandis [rose gum]
ref|XP_010696132.1|  PREDICTED: retinoblastoma-binding protein 5 ...    217   1e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010103982.1|  Retinoblastoma-binding protein 5                   215   8e-62   
ref|XP_006369773.1|  hypothetical protein POPTR_0001s31290g             214   1e-61   
ref|XP_006347717.1|  PREDICTED: retinoblastoma-binding protein 5-...    214   1e-61   Solanum tuberosum [potatoes]
ref|XP_006347718.1|  PREDICTED: retinoblastoma-binding protein 5-...    214   1e-61   Solanum tuberosum [potatoes]
gb|KCW65157.1|  hypothetical protein EUGRSUZ_G02654                     210   5e-61   Eucalyptus grandis [rose gum]
ref|XP_008238384.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...    210   3e-60   
ref|XP_010936566.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...    211   3e-60   Elaeis guineensis
ref|XP_008787133.1|  PREDICTED: retinoblastoma-binding protein 5 ...    211   3e-60   
ref|XP_006445680.1|  hypothetical protein CICLE_v10014800mg             210   5e-60   Citrus clementina [clementine]
ref|XP_010277148.1|  PREDICTED: retinoblastoma-binding protein 5 ...    209   1e-59   
ref|XP_010277147.1|  PREDICTED: retinoblastoma-binding protein 5 ...    209   3e-59   Nelumbo nucifera [Indian lotus]
ref|XP_004290312.1|  PREDICTED: protein RBL                             206   6e-59   Fragaria vesca subsp. vesca
ref|XP_007209915.1|  hypothetical protein PRUPE_ppa004402mg             206   8e-59   Prunus persica
ref|XP_011091979.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   2e-58   
ref|XP_008790627.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   3e-58   Phoenix dactylifera
ref|XP_010271571.1|  PREDICTED: retinoblastoma-binding protein 5 ...    206   4e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009394337.1|  PREDICTED: retinoblastoma-binding protein 5 ...    204   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939085.1|  PREDICTED: retinoblastoma-binding protein 5 ...    201   2e-56   Elaeis guineensis
ref|XP_006578413.1|  PREDICTED: retinoblastoma-binding protein 5-...    200   2e-56   Glycine max [soybeans]
ref|XP_004230069.1|  PREDICTED: retinoblastoma-binding protein 5 ...    200   3e-56   Solanum lycopersicum
ref|XP_003522878.1|  PREDICTED: retinoblastoma-binding protein 5-...    200   3e-56   
gb|KHN48493.1|  Retinoblastoma-binding protein 5                        200   3e-56   Glycine soja [wild soybean]
ref|XP_006578412.1|  PREDICTED: retinoblastoma-binding protein 5-...    200   3e-56   Glycine max [soybeans]
ref|XP_004230070.1|  PREDICTED: retinoblastoma-binding protein 5 ...    199   4e-56   Solanum lycopersicum
ref|XP_006578411.1|  PREDICTED: retinoblastoma-binding protein 5-...    201   4e-56   Glycine max [soybeans]
ref|XP_006579836.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   4e-56   
ref|XP_008363218.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   7e-56   
ref|XP_006594025.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   7e-56   
ref|XP_006582400.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   7e-56   
ref|XP_003524594.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   7e-56   
ref|XP_006594026.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   8e-56   
ref|XP_006579833.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   8e-56   
ref|XP_006579835.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   8e-56   
ref|XP_006594027.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   8e-56   
ref|XP_006582402.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   9e-56   
ref|XP_006582403.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   9e-56   
ref|XP_006594024.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   9e-56   
ref|XP_006579834.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   9e-56   Glycine max [soybeans]
ref|XP_006579832.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   9e-56   Glycine max [soybeans]
ref|XP_006582399.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   1e-55   
ref|XP_003541356.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   1e-55   Glycine max [soybeans]
ref|XP_006582401.1|  PREDICTED: retinoblastoma-binding protein 5-...    199   1e-55   
gb|KJB78514.1|  hypothetical protein B456_013G003300                    197   5e-55   Gossypium raimondii
ref|XP_009341586.1|  PREDICTED: retinoblastoma-binding protein 5 ...    196   9e-55   Pyrus x bretschneideri [bai li]
ref|XP_007141031.1|  hypothetical protein PHAVU_008G161500g             196   1e-54   Phaseolus vulgaris [French bean]
ref|XP_004490570.1|  PREDICTED: retinoblastoma-binding protein 5-...    196   2e-54   Cicer arietinum [garbanzo]
ref|XP_007156314.1|  hypothetical protein PHAVU_003G276000g             195   3e-54   Phaseolus vulgaris [French bean]
ref|XP_004498849.1|  PREDICTED: retinoblastoma-binding protein 5-...    192   8e-54   Cicer arietinum [garbanzo]
gb|KHN26444.1|  Retinoblastoma-binding protein 5                        191   1e-53   Glycine soja [wild soybean]
ref|XP_011091980.1|  PREDICTED: retinoblastoma-binding protein 5 ...    192   2e-53   Sesamum indicum [beniseed]
ref|XP_003531795.1|  PREDICTED: retinoblastoma-binding protein 5-...    193   2e-53   Glycine max [soybeans]
gb|KHN38141.1|  Retinoblastoma-binding protein 5                        193   2e-53   Glycine soja [wild soybean]
gb|AFK42526.1|  unknown                                                 191   7e-53   Lotus japonicus
ref|XP_003628195.1|  WD repeat-containing protein                       189   3e-52   Medicago truncatula
ref|XP_003628041.1|  WD repeat-containing protein                       188   8e-52   Medicago truncatula
gb|EYU26868.1|  hypothetical protein MIMGU_mgv1a004535mg                185   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_011012484.1|  PREDICTED: retinoblastoma-binding protein 5 ...    186   1e-50   Populus euphratica
ref|XP_010527302.1|  PREDICTED: retinoblastoma-binding protein 5 ...    182   2e-49   Tarenaya hassleriana [spider flower]
dbj|BAH20231.1|  AT3G21060                                              171   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347048.1|  PREDICTED: retinoblastoma-binding protein 5-...    171   6e-47   
dbj|BAB01449.1|  retinoblastoma-binding protein-like                    174   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KDO52247.1|  hypothetical protein CISIN_1g0088442mg                  171   6e-46   Citrus sinensis [apfelsine]
ref|XP_006485526.1|  PREDICTED: retinoblastoma-binding protein 5-...    171   1e-45   Citrus sinensis [apfelsine]
ref|NP_188743.3|  COMPASS-like H3K4 histone methylation complex c...    171   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42218.1|  putative G-protein beta subunit                         171   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466323.1|  PREDICTED: retinoblastoma-binding protein 5 ...    170   6e-45   Camelina sativa [gold-of-pleasure]
gb|KEH19268.1|  retinoblastoma-binding-like protein                     169   6e-45   Medicago truncatula
ref|XP_003628198.1|  Retinoblastoma-binding protein                     169   6e-45   
ref|XP_006297362.1|  hypothetical protein CARUB_v10013382mg             169   6e-45   Capsella rubella
ref|XP_006829296.1|  PREDICTED: protein RBL                             169   1e-44   Amborella trichopoda
ref|XP_010509632.1|  PREDICTED: retinoblastoma-binding protein 5 ...    168   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010488090.1|  PREDICTED: retinoblastoma-binding protein 5 ...    168   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006406323.1|  hypothetical protein EUTSA_v10020461mg             168   3e-44   
emb|CDY27548.1|  BnaC01g32310D                                          167   6e-44   Brassica napus [oilseed rape]
ref|XP_009109937.1|  PREDICTED: retinoblastoma-binding protein 5 ...    166   8e-44   Brassica rapa
emb|CDY37319.1|  BnaA01g25390D                                          166   1e-43   Brassica napus [oilseed rape]
ref|XP_002883282.1|  hypothetical protein ARALYDRAFT_318845             166   1e-43   
ref|XP_006406324.1|  hypothetical protein EUTSA_v10020461mg             165   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_009109949.1|  PREDICTED: retinoblastoma-binding protein 5 ...    164   1e-42   Brassica rapa
ref|XP_004985264.1|  PREDICTED: retinoblastoma-binding protein 5-...    155   1e-39   Setaria italica
ref|XP_003561921.1|  PREDICTED: retinoblastoma-binding protein 5 ...    154   3e-39   Brachypodium distachyon [annual false brome]
ref|XP_006649601.1|  PREDICTED: retinoblastoma-binding protein 5-...    152   2e-38   Oryza brachyantha
dbj|BAJ94837.1|  predicted protein                                      151   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25536.1|  hypothetical protein F775_27533                         150   8e-38   
gb|EMS61733.1|  Retinoblastoma-binding protein 5                        149   2e-37   Triticum urartu
ref|NP_001049328.1|  Os03g0207900                                       147   9e-37   
gb|EAY88980.1|  hypothetical protein OsI_10465                          147   9e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_002465668.1|  hypothetical protein SORBIDRAFT_01g043410          144   5e-36   Sorghum bicolor [broomcorn]
tpg|DAA43873.1|  TPA: retinoblastoma-binding protein-like protein       140   1e-34   
ref|NP_001146889.1|  LOC100280497                                       140   1e-34   Zea mays [maize]
ref|XP_008673444.1|  PREDICTED: LOC100280497 isoform X2                 140   2e-34   Zea mays [maize]
ref|XP_008673440.1|  PREDICTED: LOC100280497 isoform X1                 140   2e-34   
tpg|DAA43874.1|  TPA: hypothetical protein ZEAMMB73_120366              122   4e-28   
ref|XP_004958908.1|  PREDICTED: retinoblastoma-binding protein 5-...    122   1e-27   Setaria italica
gb|EPS71151.1|  hypothetical protein M569_03609                         115   8e-26   Genlisea aurea
ref|XP_002975565.1|  hypothetical protein SELMODRAFT_103410             110   9e-24   
ref|XP_001764783.1|  WD40 repeat protein, COMPASS complex protein       106   1e-22   
ref|XP_002973538.1|  hypothetical protein SELMODRAFT_413979           97.1    6e-19   
gb|KFH72296.1|  hypothetical protein MVEG_02587                       71.6    8e-11   Mortierella verticillata NRRL 6337
gb|KCW65156.1|  hypothetical protein EUGRSUZ_G02654                   70.9    1e-10   Eucalyptus grandis [rose gum]
gb|AAR88785.1|  transducin/WD-40 repeat family-like protein           64.7    1e-09   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002862673.1|  predicted protein                                67.4    2e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_007133504.1|  hypothetical protein PHAVU_011G184500g           67.4    2e-09   Phaseolus vulgaris [French bean]
gb|EIE78735.1|  hypothetical protein RO3G_03440                       65.5    3e-09   Rhizopus delemar RA 99-880
gb|KEH33484.1|  retinoblastoma-binding-like protein, putative         60.8    7e-09   Medicago truncatula
ref|XP_004339591.1|  WD40 repeat protein, COMPASS complex protein     64.3    2e-08   Acanthamoeba castellanii str. Neff
ref|XP_005112726.1|  PREDICTED: retinoblastoma-binding protein 5-...  62.4    1e-07   Aplysia californica
ref|XP_011611869.1|  PREDICTED: retinoblastoma-binding protein 5 ...  61.2    3e-07   Takifugu rubripes [tiger puffer]
ref|XP_003973044.1|  PREDICTED: retinoblastoma-binding protein 5 ...  61.2    3e-07   Takifugu rubripes [tiger puffer]
ref|XP_010743859.1|  PREDICTED: retinoblastoma-binding protein 5 ...  61.2    3e-07   
ref|XP_010743858.1|  PREDICTED: retinoblastoma-binding protein 5 ...  61.2    3e-07   
gb|AEG78353.1|  retinoblastoma-binding protein 5                      60.5    3e-07   Epinephelus coioides [estuary cod]
ref|XP_005815581.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.8    3e-07   Xiphophorus maculatus
ref|XP_008407090.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.8    3e-07   Poecilia reticulata
ref|XP_007542354.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.8    3e-07   Poecilia formosa
ref|XP_011611870.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.8    3e-07   Takifugu rubripes [tiger puffer]
ref|XP_007542355.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.8    3e-07   Poecilia formosa
ref|XP_008407092.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.8    3e-07   Poecilia reticulata
ref|XP_005749526.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.8    4e-07   Pundamilia nyererei
ref|XP_003447710.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.8    4e-07   Oreochromis niloticus
ref|XP_008297322.1|  PREDICTED: retinoblastoma-binding protein 5      60.8    4e-07   Stegastes partitus
ref|XP_006783028.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.8    4e-07   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004547441.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.8    4e-07   Maylandia zebra
ref|XP_005749525.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.8    4e-07   Pundamilia nyererei
ref|XP_005917850.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.8    4e-07   Haplochromis burtoni
ref|XP_010743860.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.5    5e-07   
ref|XP_011471087.1|  PREDICTED: retinoblastoma-binding protein 5      60.5    5e-07   
ref|XP_005112725.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.5    5e-07   Aplysia californica
ref|XP_005894730.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.1    5e-07   Bos mutus
ref|XP_005112727.1|  PREDICTED: retinoblastoma-binding protein 5-...  60.5    5e-07   Aplysia californica
ref|XP_008318918.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.5    5e-07   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008318917.1|  PREDICTED: retinoblastoma-binding protein 5 ...  60.5    5e-07   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006711540.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.7    6e-07   
emb|CEG72737.1|  hypothetical protein RMATCC62417_08238               60.1    6e-07   Rhizopus microsporus
emb|CEJ02518.1|  hypothetical protein RMCBS344292_16519               60.1    7e-07   Rhizopus microsporus
ref|XP_008697752.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.7    9e-07   Ursus maritimus [white bear]
ref|XP_006628495.1|  PREDICTED: retinoblastoma-binding protein 5-...  59.7    9e-07   
ref|XP_004425182.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   
ref|XP_006628496.1|  PREDICTED: retinoblastoma-binding protein 5-...  59.7    9e-07   Lepisosteus oculatus
ref|XP_009271059.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Aptenodytes forsteri
ref|XP_008642959.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Corvus brachyrhynchos
ref|XP_004610136.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Sorex araneus [Eurasian shrew]
ref|XP_004392878.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Odobenus rosmarus divergens
ref|XP_009708190.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Cariama cristata
ref|NP_001180202.1|  retinoblastoma-binding protein 5 isoform 3       59.3    9e-07   Homo sapiens [man]
ref|XP_010879199.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.7    9e-07   Esox lucius
ref|XP_008642958.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Corvus brachyrhynchos
ref|XP_008697751.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Ursus maritimus [white bear]
ref|XP_010122765.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    9e-07   Chlamydotis macqueenii
ref|XP_008152431.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_011221931.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_004641172.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_004282502.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_008936958.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Merops nubicus
ref|XP_004578776.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Ochotona princeps [southern American pika]
ref|XP_010122773.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Chlamydotis macqueenii
ref|XP_009325638.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Pygoscelis adeliae
ref|XP_010007517.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Nestor notabilis
ref|XP_005140905.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Melopsittacus undulatus
gb|AAH57632.1|  Rbbp5 protein                                         59.3    1e-06   Mus musculus [mouse]
gb|EFX77720.1|  hypothetical protein DAPPUDRAFT_321168                59.3    1e-06   Daphnia pulex
ref|XP_006834151.1|  PREDICTED: retinoblastoma-binding protein 5      59.3    1e-06   Chrysochloris asiatica
ref|XP_004663611.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Jaculus jaculus
ref|XP_010879198.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.7    1e-06   Esox lucius
ref|XP_005140904.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Melopsittacus undulatus
ref|XP_008936957.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Merops nubicus
ref|XP_008697750.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Ursus maritimus [white bear]
ref|XP_010221672.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Tinamus guttatus
ref|XP_010007515.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Nestor notabilis
ref|XP_005901478.1|  PREDICTED: retinoblastoma-binding protein 5      59.3    1e-06   Bos mutus
ref|XP_010221673.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Tinamus guttatus
ref|XP_010007516.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Nestor notabilis
ref|XP_008563508.1|  PREDICTED: retinoblastoma-binding protein 5-...  58.9    1e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010122781.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Chlamydotis macqueenii
ref|XP_005329571.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_009943308.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Opisthocomus hoazin [hoatzin]
gb|KFO55035.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Corvus brachyrhynchos
ref|XP_010221674.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Tinamus guttatus
ref|XP_008642960.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Corvus brachyrhynchos
gb|KFQ41668.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Nestor notabilis
ref|XP_006529421.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   Mus musculus [mouse]
ref|XP_007422783.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
emb|CDQ60421.1|  unnamed protein product                              59.3    1e-06   Oncorhynchus mykiss
gb|EDL39675.1|  retinoblastoma binding protein 5, isoform CRA_a       59.3    1e-06   Mus musculus [mouse]
ref|XP_005529368.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
gb|KFV06603.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Tauraco erythrolophus
gb|KFR03785.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Opisthocomus hoazin [hoatzin]
gb|KFQ28221.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Merops nubicus
gb|KGL83265.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Tinamus guttatus
gb|KFP34785.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Chlamydotis macqueenii
ref|XP_007182855.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_005667584.1|  PREDICTED: retinoblastoma-binding protein 5 ...  59.3    1e-06   
ref|XP_007897648.1|  PREDICTED: retinoblastoma-binding protein 5      59.3    1e-06   Callorhinchus milii [Australian ghost shark]
gb|ELK37228.1|  Retinoblastoma-binding protein 5                      59.3    1e-06   Myotis davidii
dbj|BAG59520.1|  unnamed protein product                              58.9    1e-06   Homo sapiens [man]
gb|KFU89506.1|  Retinoblastoma-binding protein 5                      58.9    1e-06   Chaetura pelagica
ref|XP_006737109.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Leptonychotes weddellii
emb|CAA59446.1|  RB protein binding protein                           58.9    1e-06   Homo sapiens [man]
ref|XP_006988867.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Peromyscus maniculatus bairdii
gb|KFV71163.1|  Retinoblastoma-binding protein 5                      58.9    1e-06   Picoides pubescens
ref|XP_009995810.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Chaetura pelagica
ref|XP_008697748.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Ursus maritimus [white bear]
ref|XP_004425180.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_766105.2|  retinoblastoma-binding protein 5                    58.9    1e-06   Mus musculus [mouse]
ref|NP_001126360.1|  retinoblastoma-binding protein 5                 58.9    1e-06   Pongo abelii [orang utan]
ref|XP_010347263.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Saimiri boliviensis boliviensis
ref|XP_011221929.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   
gb|EFB17067.1|  hypothetical protein PANDA_006675                     58.9    1e-06   Ailuropoda melanoleuca
gb|KFP28108.1|  Retinoblastoma-binding protein 5                      58.9    1e-06   Colius striatus
gb|EHH15635.1|  hypothetical protein EGK_01750                        58.9    1e-06   Macaca mulatta [rhesus macaque]
ref|XP_009903839.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Picoides pubescens
ref|XP_009566424.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Cuculus canorus
ref|XP_848552.1|  PREDICTED: retinoblastoma-binding protein 5 iso...  58.9    1e-06   Canis lupus familiaris [dogs]
ref|XP_005885325.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Myotis brandtii
ref|XP_005375402.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   
ref|XP_006062333.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   
ref|XP_006159302.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Tupaia chinensis
ref|XP_004610134.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Sorex araneus [Eurasian shrew]
ref|XP_004392877.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Odobenus rosmarus divergens
ref|XP_007130873.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Physeter catodon
ref|XP_002918261.2|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Ailuropoda melanoleuca
ref|XP_002717493.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008974819.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Pan paniscus [bonobo]
ref|XP_010139883.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Buceros rhinoceros silvestris
ref|XP_005375399.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   
ref|NP_005048.2|  retinoblastoma-binding protein 5 isoform 1          58.9    1e-06   Homo sapiens [man]
gb|KFO93126.1|  Retinoblastoma-binding protein 5                      58.9    1e-06   Buceros rhinoceros silvestris
ref|XP_009477547.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Pelecanus crispus
ref|XP_004788401.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   
ref|XP_005505390.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   
ref|XP_009708189.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Cariama cristata
ref|XP_009501632.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Phalacrocorax carbo [common cormorant]
dbj|BAE42295.1|  unnamed protein product                              58.9    1e-06   Mus musculus [mouse]
ref|XP_003767660.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Sarcophilus harrisii
ref|XP_001365126.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    1e-06   Monodelphis domestica
gb|EMC87434.1|  Retinoblastoma-binding protein 5                      58.9    1e-06   
ref|XP_008578955.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    1e-06   Galeopterus variegatus [Malayan flying lemur]
gb|ELR52304.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   Bos mutus
ref|XP_007640086.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Cricetulus griseus [Chinese hamsters]
ref|XP_010139882.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Buceros rhinoceros silvestris
ref|XP_004788403.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004641170.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Octodon degus
ref|XP_004578774.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Ochotona princeps [southern American pika]
ref|XP_004282500.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Orcinus orca [Orca]
ref|XP_004013603.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|KFQ23443.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   Mesitornis unicolor
ref|XP_003792376.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|XP_010155348.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Eurypyga helias
ref|XP_005087406.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|NP_001100644.1|  retinoblastoma-binding protein 5                 58.9    2e-06   Rattus norvegicus [brown rat]
gb|KFW10230.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   Eurypyga helias
gb|KFV79857.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   Struthio camelus australis
ref|XP_009670532.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   Struthio camelus australis
gb|KFO81495.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   Cuculus canorus
ref|XP_003410304.2|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_007481312.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   Monodelphis domestica
ref|XP_005885326.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|NP_001026085.1|  retinoblastoma-binding protein 5                 58.9    2e-06   Gallus gallus [bantam]
ref|XP_010184498.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|XP_005230402.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|XP_008266747.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005348400.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004885471.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004663609.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_010577801.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|KFW90279.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_007182854.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_010205345.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|XP_008107825.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_006062332.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005329568.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
dbj|BAC33635.1|  unnamed protein product                              58.9    2e-06   
ref|XP_008497706.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|XP_005375401.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005329569.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|KFQ65150.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_010577793.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_008821549.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
dbj|BAI45474.1|  retinoblastoma binding protein 5                     58.9    2e-06   
gb|KFQ88698.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
gb|KFM03208.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_006988866.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_006133124.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_009910139.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005348401.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|KGL95927.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
gb|KFP76474.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
dbj|BAF82826.1|  unnamed protein product                              58.9    2e-06   
ref|XP_006024827.1|  PREDICTED: retinoblastoma-binding protein 5      58.9    2e-06   
ref|XP_010155347.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_009583453.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_003220453.2|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_003364974.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|KFP61886.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_012042330.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004610135.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_010722515.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_007065170.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_008107829.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004885470.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_009069092.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005329570.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004282501.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|NP_001180201.1|  retinoblastoma-binding protein 5 isoform 2       58.9    2e-06   
ref|XP_006133123.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|KFP05265.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_008107828.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_008107826.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005245458.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_001489657.2|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_006529420.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_006273937.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004862178.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005306473.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_009069091.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_007422781.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_002808301.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...  58.9    2e-06   
ref|XP_010577808.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_007640087.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_003767661.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005529366.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005430891.1|  PREDICTED: retinoblastoma-binding protein 5      58.5    2e-06   
ref|XP_012042331.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_011221930.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005348402.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004578775.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004425181.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_003501248.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_007422780.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
gb|EPQ19629.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_005885327.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_005529367.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_004663610.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_007481313.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_004885473.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005640841.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_006273939.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005306472.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.9    2e-06   
ref|XP_006133125.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005306474.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_003340213.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
gb|KFO19612.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
gb|ELK03324.1|  Retinoblastoma-binding protein 5                      58.9    2e-06   
ref|XP_005640842.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_004477657.1|  PREDICTED: retinoblastoma-binding protein 5      58.5    2e-06   
ref|XP_006133126.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_006888047.1|  PREDICTED: retinoblastoma-binding protein 5      58.5    2e-06   
ref|XP_005168325.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_004641169.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_008170919.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
gb|AAH67666.1|  Retinoblastoma binding protein 5                      58.5    2e-06   
ref|XP_008072865.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_006988868.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|NP_001025680.1|  retinoblastoma binding protein 5                 58.5    2e-06   
ref|NP_956539.1|  retinoblastoma-binding protein 5                    58.5    2e-06   
gb|EQB78147.1|  retinoblastoma-binding protein 5 isoform 3            58.5    2e-06   
ref|XP_005014675.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_007422782.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005014674.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_011813143.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005014677.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_011845814.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005014676.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_009439553.1|  PREDICTED: retinoblastoma-binding protein 5      58.5    2e-06   
dbj|BAG59939.1|  unnamed protein product                              58.5    2e-06   
ref|XP_005245455.1|  PREDICTED: retinoblastoma-binding protein 5 ...  58.5    2e-06   
ref|XP_005059303.1|  PREDICTED: retinoblastoma-binding protein 5      58.2    2e-06   
ref|XP_001507579.2|  PREDICTED: retinoblastoma-binding protein 5      58.5    2e-06   
ref|NP_001086675.1|  retinoblastoma binding protein 5                 58.2    2e-06   
ref|XP_005787879.1|  hypothetical protein EMIHUDRAFT_433832           57.8    3e-06   
ref|XP_007256813.1|  PREDICTED: retinoblastoma-binding protein 5-...  57.8    4e-06   
gb|KFM81994.1|  Retinoblastoma-binding protein 5                      57.0    4e-06   
gb|ETE66247.1|  Retinoblastoma-binding protein 5                      57.8    4e-06   
ref|XP_001656334.1|  AAEL003140-PA                                    57.4    5e-06   
gb|ETN62412.1|  retinoblastoma-binding protein 5                      57.0    7e-06   
ref|XP_005839587.1|  hypothetical protein GUITHDRAFT_133657           56.2    9e-06   
ref|XP_011451298.1|  PREDICTED: retinoblastoma-binding protein 5-...  56.6    1e-05   
gb|KEH19267.1|  retinoblastoma-binding-like protein                   56.2    1e-05   
emb|CDH61504.1|  retinoblastoma-binding protein 5-like                56.2    1e-05   
ref|XP_011631649.1|  PREDICTED: retinoblastoma-binding protein 5 ...  56.2    1e-05   
ref|XP_011451297.1|  PREDICTED: retinoblastoma-binding protein 5 ...  56.2    1e-05   
emb|CDS04820.1|  hypothetical protein LRAMOSA07350                    56.2    1e-05   
ref|XP_006622476.1|  PREDICTED: retinoblastoma-binding protein 5-...  56.2    1e-05   
ref|XP_012061749.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.8    1e-05   
emb|CEG72738.1|  hypothetical protein RMATCC62417_08238               56.2    1e-05   
ref|XP_009645908.1|  PREDICTED: retinoblastoma-binding protein 5      56.2    1e-05   
ref|XP_006568237.1|  PREDICTED: retinoblastoma-binding protein 5-...  56.2    1e-05   
gb|KFP08920.1|  Retinoblastoma-binding protein 5                      56.2    1e-05   
ref|XP_394331.2|  PREDICTED: retinoblastoma-binding protein 5-lik...  56.2    1e-05   
ref|XP_003696838.1|  PREDICTED: retinoblastoma-binding protein 5      56.2    1e-05   
ref|XP_003702347.1|  PREDICTED: retinoblastoma-binding protein 5 ...  56.2    1e-05   
ref|XP_003393845.1|  PREDICTED: retinoblastoma-binding protein 5-...  56.2    1e-05   
ref|XP_314543.3|  AGAP010575-PA                                       55.8    2e-05   
ref|XP_001856893.1|  retinoblastoma-binding protein 5                 55.8    2e-05   
gb|EFN69569.1|  Retinoblastoma-binding protein 5                      55.5    2e-05   
ref|XP_011136194.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
ref|XP_011874786.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
ref|XP_011349613.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
gb|KFB38609.1|  hypothetical protein ZHAS_00005986                    55.8    2e-05   
ref|XP_011254466.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
gb|EZA47584.1|  Retinoblastoma-binding protein                        55.8    2e-05   
ref|XP_002738883.1|  PREDICTED: retinoblastoma-binding protein 5-...  55.1    2e-05   
ref|XP_011172153.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
ref|XP_011684913.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
ref|XP_011064252.1|  PREDICTED: retinoblastoma-binding protein 5 ...  55.5    2e-05   
ref|XP_002424873.1|  restnoblastoma-binding protein, putative         55.1    3e-05   
dbj|GAN08021.1|  hypothetical protein MAM1_0186c07527                 53.9    4e-05   
gb|EPB82204.1|  hypothetical protein HMPREF1544_11048                 54.7    4e-05   
ref|XP_011300070.1|  PREDICTED: retinoblastoma-binding protein 5 ...  54.3    4e-05   
ref|XP_011497888.1|  PREDICTED: retinoblastoma-binding protein 5 ...  54.3    5e-05   
ref|XP_001951127.1|  PREDICTED: retinoblastoma-binding protein 5      54.3    5e-05   
ref|XP_008551099.1|  PREDICTED: retinoblastoma-binding protein 5 ...  54.3    5e-05   
ref|XP_008468897.1|  PREDICTED: retinoblastoma-binding protein 5 ...  53.9    7e-05   
gb|KDR15310.1|  Retinoblastoma-binding protein 5                      53.5    8e-05   
ref|XP_011178496.1|  PREDICTED: retinoblastoma-binding protein 5 ...  53.5    9e-05   
ref|XP_005716222.1|  unnamed protein product                          53.5    9e-05   
ref|XP_007872780.1|  hypothetical protein PNEG_00870                  53.1    1e-04   
ref|XP_011205776.1|  PREDICTED: retinoblastoma-binding protein 5 ...  53.1    1e-04   
ref|XP_010402649.1|  PREDICTED: LOW QUALITY PROTEIN: retinoblasto...  52.8    1e-04   
ref|XP_011553834.1|  PREDICTED: retinoblastoma-binding protein 5 ...  52.8    1e-04   
emb|CEP17827.1|  hypothetical protein                                 52.4    2e-04   
ref|XP_001608301.1|  PREDICTED: retinoblastoma-binding protein 5      52.0    3e-04   
ref|XP_005188206.1|  PREDICTED: retinoblastoma-binding protein 5 ...  51.6    4e-04   
ref|XP_009018161.1|  hypothetical protein HELRODRAFT_185612           51.6    5e-04   
gb|ENN79844.1|  hypothetical protein YQE_03665                        51.6    5e-04   
ref|XP_002048140.1|  GJ13797                                          51.2    6e-04   
ref|XP_002040644.1|  GM22228                                          51.2    6e-04   
gb|KDO52248.1|  hypothetical protein CISIN_1g0088441mg                47.8    6e-04   
ref|XP_008266750.1|  PREDICTED: retinoblastoma-binding protein 5 ...  50.8    6e-04   
ref|XP_002008245.1|  GI11921                                          51.2    6e-04   
ref|XP_002021047.1|  GL25040                                          51.2    6e-04   
ref|XP_002085632.1|  GD12200                                          51.2    6e-04   
gb|ENN79845.1|  hypothetical protein YQE_03665                        51.2    6e-04   
ref|XP_001973466.1|  GG13327                                          50.8    6e-04   
ref|NP_649209.1|  Rbbp5                                               50.8    6e-04   
ref|XP_002095486.1|  GE22416                                          50.8    6e-04   
ref|XP_002095481.1|  GE22415                                          50.8    6e-04   
ref|XP_004924717.1|  PREDICTED: retinoblastoma-binding protein 5-...  50.8    6e-04   
ref|XP_002061876.1|  GK17232                                          50.4    8e-04   
emb|CAG14276.1|  unnamed protein product                              48.5    0.001   
ref|XP_005989299.1|  PREDICTED: retinoblastoma-binding protein 5      50.4    0.001   
ref|XP_011508136.1|  PREDICTED: retinoblastoma-binding protein 5 ...  50.4    0.001   



>emb|CDP07224.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+P+TEK KE DVNED+EVD
Sbjct  357  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLMPDTEKVKESDVNEDDEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD+ FSDS++S+EEI FLP DP PD  EQQDKCVGSTSKL DS QSGSP S+EA 
Sbjct  417  IMTVEKDSAFSDSDVSEEEICFLPADPTPDAPEQQDKCVGSTSKLADSAQSGSPLSDEAG  476

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK  289
            QNG   N  SSP+E +DNSAAEDT   RL+R+R+PS+KV+ELQ EKVKK  Q+
Sbjct  477  QNGHAVNQSSSPLEGMDNSAAEDTGGTRLKRRRRPSDKVMELQVEKVKKSSQR  529



>ref|XP_009609900.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Nicotiana 
tomentosiformis]
Length=505

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 148/179 (83%), Gaps = 8/179 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PE EK KE D NEDE++D
Sbjct  331  LAGVVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKESDANEDEDID  390

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV VEKD+TFSDS+MSQ+EI FLP DPIPD  EQQDKCVGSTSKLG+SNQSGSP SEEA 
Sbjct  391  IVGVEKDSTFSDSDMSQDEICFLPADPIPDAPEQQDKCVGSTSKLGESNQSGSPLSEEAG  450

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSGQ  274
            QNGQ  NHESSP E       EDT    L+RKRKPSEKVLELQAEKVKKP QK K SG+
Sbjct  451  QNGQ-VNHESSPFE------GEDTGTTCLKRKRKPSEKVLELQAEKVKKPSQKTKPSGK  502



>ref|XP_009609898.1| PREDICTED: retinoblastoma-binding protein 5 homolog {ECO:0000250|UniProtKB:Q15291} 
isoform X1 [Nicotiana tomentosiformis]
Length=530

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 148/179 (83%), Gaps = 8/179 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PE EK KE D NEDE++D
Sbjct  356  LAGVVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKESDANEDEDID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV VEKD+TFSDS+MSQ+EI FLP DPIPD  EQQDKCVGSTSKLG+SNQSGSP SEEA 
Sbjct  416  IVGVEKDSTFSDSDMSQDEICFLPADPIPDAPEQQDKCVGSTSKLGESNQSGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSGQ  274
            QNGQ  NHESSP E       EDT    L+RKRKPSEKVLELQAEKVKKP QK K SG+
Sbjct  476  QNGQ-VNHESSPFE------GEDTGTTCLKRKRKPSEKVLELQAEKVKKPSQKTKPSGK  527



>ref|XP_009609899.1| PREDICTED: retinoblastoma-binding protein 5 homolog {ECO:0000250|UniProtKB:Q15291} 
isoform X2 [Nicotiana tomentosiformis]
Length=529

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 148/179 (83%), Gaps = 9/179 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PE EK KE D NEDE++D
Sbjct  356  LAGVVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKESDANEDEDID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV VEKD+TFSDS+MSQ+EI FLP DPIPD  EQQDKCVGSTSKLG+SNQSGSP SEEA 
Sbjct  416  IVGVEKDSTFSDSDMSQDEICFLPADPIPDAPEQQDKCVGSTSKLGESNQSGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSGQ  274
            QNGQ  NHESSP E       EDT    L+RKRKPSEKVLELQAEKVKKP QK K SG+
Sbjct  476  QNGQ-VNHESSPFE-------EDTGTTCLKRKRKPSEKVLELQAEKVKKPSQKTKPSGK  526



>ref|XP_009779737.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Nicotiana sylvestris]
Length=526

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 145/178 (81%), Gaps = 8/178 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PE EK KE D NEDE++D
Sbjct  356  LAGVVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKESDANEDEDID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV VE D+TFSDS+MSQ EI FLP DPIPD  EQQDKCVGSTSKLG+SNQSGSP SEEA 
Sbjct  416  IVGVENDSTFSDSDMSQGEICFLPADPIPDAPEQQDKCVGSTSKLGESNQSGSPISEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSG  277
            QNGQ  NHESSP E       EDT    ++RKRKPSEKVLELQAEKVKKP QK K SG
Sbjct  476  QNGQ-VNHESSPFE------GEDTGTTCMKRKRKPSEKVLELQAEKVKKPSQKTKPSG  526



>ref|XP_011655820.1| PREDICTED: protein RBL [Cucumis sativus]
 gb|KGN52150.1| hypothetical protein Csa_5G612300 [Cucumis sativus]
Length=552

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 155/195 (79%), Gaps = 11/195 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PETEK KEPDVNEDEEVD
Sbjct  353  LTGLIYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPETEKVKEPDVNEDEEVD  412

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD+ FSDS+ SQ+E+ FLP  P PD ++QQDKCV  +SK+ D+N SGSP SEEA 
Sbjct  413  IITVEKDSAFSDSDASQDELCFLPSIPCPDVIDQQDKCVEISSKMIDNNNSGSPLSEEAG  472

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP--PQKKTSGQ  274
             NG+TTNH SSP+E +DN+  +D    R++RKRKPSEK LELQAEKVKKP  P  + S  
Sbjct  473  VNGRTTNHASSPMEVLDNT--DDAGGARMKRKRKPSEKGLELQAEKVKKPSKPSSRLS--  528

Query  273  WII*ARLKTRALYHQ  229
                 + KT+++ HQ
Sbjct  529  -----KFKTKSMVHQ  538



>ref|XP_009779738.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Nicotiana sylvestris]
Length=525

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 145/178 (81%), Gaps = 9/178 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PE EK KE D NEDE++D
Sbjct  356  LAGVVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKESDANEDEDID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV VE D+TFSDS+MSQ EI FLP DPIPD  EQQDKCVGSTSKLG+SNQSGSP SEEA 
Sbjct  416  IVGVENDSTFSDSDMSQGEICFLPADPIPDAPEQQDKCVGSTSKLGESNQSGSPISEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSG  277
            QNGQ  NHESSP E       EDT    ++RKRKPSEKVLELQAEKVKKP QK K SG
Sbjct  476  QNGQ-VNHESSPFE-------EDTGTTCMKRKRKPSEKVLELQAEKVKKPSQKTKPSG  525



>ref|XP_008446711.1| PREDICTED: retinoblastoma-binding protein 5 [Cucumis melo]
Length=552

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 154/195 (79%), Gaps = 11/195 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL PETEK KEPDVNEDEEVD
Sbjct  353  LTGLIYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNPETEKVKEPDVNEDEEVD  412

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD+ FSDS+ SQ+E+ FLP  P PD  EQQDKC+  +SK+ D+N SGSP SEEA 
Sbjct  413  IITVEKDSAFSDSDASQDELCFLPSIPCPDVTEQQDKCIEISSKMIDNNNSGSPLSEEAG  472

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP--PQKKTSGQ  274
             NG+TTNH SSP+E +DN+  +D    R++RKRKPSEK LELQAEKVKKP  P  + S  
Sbjct  473  VNGRTTNHASSPMEVLDNT--DDAGGARMKRKRKPSEKGLELQAEKVKKPSKPSSRLS--  528

Query  273  WII*ARLKTRALYHQ  229
                 + KT+++ HQ
Sbjct  529  -----KFKTKSMVHQ  538



>emb|CBI16678.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 147/179 (82%), Gaps = 8/179 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK K+ DVNED+EVD
Sbjct  331  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLMPETEKVKDTDVNEDDEVD  390

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVE ++ FSDS+MSQEE+ FLP  P PD  EQQDKCVGSTSKL DSN SGSP SEEA 
Sbjct  391  IMTVENESVFSDSDMSQEELCFLPAVPCPDVPEQQDKCVGSTSKLTDSNHSGSPLSEEAG  450

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQ-KKTSGQ  274
            QNGQ  NH SSPVE       EDT   RL+RKRKPSEK +ELQAEKV+KP +  K+SG+
Sbjct  451  QNGQAMNHASSPVE-------EDTGGTRLKRKRKPSEKGMELQAEKVRKPLKTMKSSGK  502



>ref|XP_002271886.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Vitis vinifera]
Length=554

 Score =   228 bits (582),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 147/179 (82%), Gaps = 8/179 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK K+ DVNED+EVD
Sbjct  355  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLMPETEKVKDTDVNEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVE ++ FSDS+MSQEE+ FLP  P PD  EQQDKCVGSTSKL DSN SGSP SEEA 
Sbjct  415  IMTVENESVFSDSDMSQEELCFLPAVPCPDVPEQQDKCVGSTSKLTDSNHSGSPLSEEAG  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQ-KKTSGQ  274
            QNGQ  NH SSPVE       EDT   RL+RKRKPSEK +ELQAEKV+KP +  K+SG+
Sbjct  475  QNGQAMNHASSPVE-------EDTGGTRLKRKRKPSEKGMELQAEKVRKPLKTMKSSGK  526



>emb|CAN70287.1| hypothetical protein VITISV_003927 [Vitis vinifera]
Length=543

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 141/170 (83%), Gaps = 7/170 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK K+ DVNED+EVD
Sbjct  355  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLMPETEKVKDTDVNEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVE ++ FSDS+MSQEE+ FLP  P PD  EQQDKCVGSTSKL DSN SGSP SEEA 
Sbjct  415  IMTVENESVFSDSDMSQEELCFLPAVPCPDVPEQQDKCVGSTSKLTDSNHSGSPLSEEAG  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP  298
            QNGQ  NH SSPVE       EDT   RL+RKRKPSEK +ELQAEKV+KP
Sbjct  475  QNGQAMNHASSPVE-------EDTGGTRLKRKRKPSEKGMELQAEKVRKP  517



>ref|XP_002522890.1| nucleotide binding protein, putative [Ricinus communis]
 gb|EEF39490.1| nucleotide binding protein, putative [Ricinus communis]
Length=551

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 145/179 (81%), Gaps = 9/179 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEK KE DVNEDEEVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEKVKESDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MSQEE+ FLP  P PD  EQQDKCVGS+SKL DSN SGSP SE A 
Sbjct  416  IVTVEKD-AFSDSDMSQEELCFLPAVPCPDASEQQDKCVGSSSKLMDSNHSGSPLSEGAG  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQ-KKTSGQ  274
            QNG   NH SSP+E       EDT   R++RKRKPSEK LELQAEKV+KP +  K+SG+
Sbjct  475  QNGMAMNHASSPLE-------EDTGGMRMKRKRKPSEKGLELQAEKVRKPLKPLKSSGR  526



>ref|XP_012074485.1| PREDICTED: protein RBL [Jatropha curcas]
 gb|KDP35987.1| hypothetical protein JCGZ_08382 [Jatropha curcas]
Length=551

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 144/178 (81%), Gaps = 10/178 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE  VNEDEEVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKELVVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MSQEE+ FLP  P PD LEQQDKCVGS+SKL DSN SGSP SE AE
Sbjct  416  IVTVEKD-AFSDSDMSQEEVCFLPAVPCPDILEQQDKCVGSSSKLMDSNHSGSPLSEGAE  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP--PQKKTS  280
            QNG   N ESSP+E       EDT   R++R+RKPSEK LELQAEKV+KP  P K +S
Sbjct  475  QNGLARNGESSPLE-------EDTGGTRMKRRRKPSEKGLELQAEKVRKPLKPLKSSS  525



>ref|XP_002300221.2| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
 gb|EEE85026.2| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
Length=547

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 145/178 (81%), Gaps = 10/178 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL+P TEK KE D+N+D+EVD
Sbjct  355  LTGLVYIWAKDHTENWSAFAPDFKELEENEEYVEREDEFDLIPGTEKVKESDINQDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS++SQEE+ FLP  P PD LEQQDKCVGS+SKL DSN SGSP SEEAE
Sbjct  415  IVTVEKDA-FSDSDVSQEELCFLPATPCPDVLEQQDKCVGSSSKLVDSNNSGSPLSEEAE  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQ  274
            QNGQ TNH SSP+E       EDT   R++RKRKPSEK L LQA KV KP   K+SG+
Sbjct  474  QNGQATNHASSPLE-------EDTGGTRMKRKRKPSEKGLVLQAGKVGKP--LKSSGR  522



>gb|KCW65158.1| hypothetical protein EUGRSUZ_G02654 [Eucalyptus grandis]
Length=423

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEK K  DV+ED+EVD
Sbjct  221  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEKVKGLDVHEDDEVD  280

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            ++TVE+D+ FSDS+MSQEE+ FLP  P  D  EQQDKCVGS SKL D N SGSP S EA 
Sbjct  281  VLTVERDSVFSDSDMSQEELCFLPAVPCLDIPEQQDKCVGSCSKLPDGNHSGSPLSVEAG  340

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
            QNG  +NH SSP+E ++NS A+DT   RL+RKRKPSEK LELQAE
Sbjct  341  QNGNASNHNSSPLEPMENSTADDTDGVRLKRKRKPSEKGLELQAE  385



>ref|XP_007010539.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY19349.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=552

 Score =   221 bits (562),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 146/179 (82%), Gaps = 9/179 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVE+EDEFDLVPETEK KE DVNED+EVD
Sbjct  355  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEQEDEFDLVPETEKVKESDVNEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTV+KD  FSDS+MSQEE+ FLP  P PD  EQQDKCVGS+SKL DSN SGSP SEE  
Sbjct  415  IVTVDKD-PFSDSDMSQEELCFLPAIPCPDVPEQQDKCVGSSSKLIDSNHSGSPLSEENG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQ-KKTSGQ  274
            QNGQ  N+ SSP+E       EDT   RL+RKRKPSEK LELQAEKV+KP +  K+SG+
Sbjct  474  QNGQAANNASSPLE-------EDTGGTRLKRKRKPSEKGLELQAEKVRKPLKPLKSSGR  525



>ref|XP_011012485.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Populus euphratica]
Length=547

 Score =   220 bits (561),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 140/170 (82%), Gaps = 8/170 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTG+ Y+WAKD+TENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE D+NED+EVD
Sbjct  355  LTGMVYVWAKDHTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKESDINEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MSQEEI FLP  P PD  EQQDKCVGS+SKL DSN SGSP SEEA 
Sbjct  415  IVTVEKDA-FSDSDMSQEEICFLPATPCPDVPEQQDKCVGSSSKLMDSNNSGSPLSEEAG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP  298
            QNGQ  NH SSP+E       EDT   R++RKRKPSEK LELQAEK +KP
Sbjct  474  QNGQAMNHASSPLE-------EDTGGTRMKRKRKPSEKGLELQAEKGRKP  516



>ref|XP_006370892.1| transducin family protein [Populus trichocarpa]
 gb|ERP48689.1| transducin family protein [Populus trichocarpa]
Length=547

 Score =   220 bits (561),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 140/170 (82%), Gaps = 8/170 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTG+ Y+WAKD+TENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE D+NED+EVD
Sbjct  355  LTGMVYVWAKDHTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKESDINEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MSQEEI FLP  P PD  EQQDKCVGS+SKL DSN SGSP SEEA 
Sbjct  415  IVTVEKDA-FSDSDMSQEEICFLPATPCPDVPEQQDKCVGSSSKLMDSNNSGSPLSEEAG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP  298
            QNGQ  NH SSP+E       EDT   R++RKRKPSEK LELQAEK +KP
Sbjct  474  QNGQAMNHASSPLE-------EDTGGTRMKRKRKPSEKGLELQAEKGRKP  516



>ref|XP_011000114.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Populus 
euphratica]
Length=547

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 144/178 (81%), Gaps = 10/178 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL+P TEK KE D+N+D+EVD
Sbjct  355  LTGLVYIWAKDHTENWSAFAPDFKELEENEEYVEREDEFDLIPGTEKVKESDINQDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS++SQEE+ FLP  P PD LEQQ KCVGS+SKL DSN SGSP SEEAE
Sbjct  415  IVTVEKDA-FSDSDVSQEELCFLPATPCPDVLEQQYKCVGSSSKLMDSNNSGSPLSEEAE  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQ  274
            QNGQ TNH SSP+E       EDT   R++RKRKPSEK L LQA KV KP   K+SG+
Sbjct  474  QNGQATNHASSPLE-------EDTGGTRMKRKRKPSEKGLVLQAGKVGKP--LKSSGR  522



>ref|XP_010067087.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Eucalyptus 
grandis]
Length=558

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEK K  DV+ED+EVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEKVKGLDVHEDDEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            ++TVE+D+ FSDS+MSQEE+ FLP  P  D  EQQDKCVGS SKL D N SGSP S EA 
Sbjct  416  VLTVERDSVFSDSDMSQEELCFLPAVPCLDIPEQQDKCVGSCSKLPDGNHSGSPLSVEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
            QNG  +NH SSP+E ++NS A+DT   RL+RKRKPSEK LELQAE
Sbjct  476  QNGNASNHNSSPLEPMENSTADDTDGVRLKRKRKPSEKGLELQAE  520



>ref|XP_010696132.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Beta vulgaris 
subsp. vulgaris]
Length=559

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFD++PETEK KE +VN++E+VD
Sbjct  355  LTGLIYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDIMPETEKVKESEVNQNEDVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVE D+TFSDS+MSQEE+ FLP  P PD  EQQDK +G++ KL +SN S SP S +A 
Sbjct  415  IITVEHDSTFSDSDMSQEELCFLPAMPCPDAPEQQDKSIGNSLKLVESNHSASPLSADAA  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
            QNGQ  NHESSPVE IDNS AEDTS  R +RKR+PSEKVLELQAE
Sbjct  475  QNGQ-ANHESSPVEGIDNSTAEDTSGGRFKRKRRPSEKVLELQAE  518



>ref|XP_010103982.1| Retinoblastoma-binding protein 5 [Morus notabilis]
 gb|EXB97685.1| Retinoblastoma-binding protein 5 [Morus notabilis]
Length=553

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 138/170 (81%), Gaps = 7/170 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEKAKE + NED+EVD
Sbjct  357  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKAKEINANEDDEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQ+E+ FLP  P PD  EQQ+KC+ S+SKL DSN SGSP SEE E
Sbjct  417  IVTVEKDSAFSDSDMSQDELCFLPAIPSPDMAEQQEKCIESSSKLVDSNNSGSPLSEEGE  476

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP  298
             NG   NH SSP+E       ED    RL+RKR+PSEK +ELQAEKV+KP
Sbjct  477  PNGGAMNHASSPLE-------EDAGVARLKRKRRPSEKGMELQAEKVRKP  519



>ref|XP_006369773.1| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
 gb|ERP66342.1| hypothetical protein POPTR_0001s31290g [Populus trichocarpa]
Length=531

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 145/187 (78%), Gaps = 19/187 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKA---------KEP  655
            LTGL YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL+P TEK          KE 
Sbjct  330  LTGLVYIWAKDHTENWSAFAPDFKELEENEEYVEREDEFDLIPGTEKVNTNRLVEQVKES  389

Query  654  DVNEDEEVDIVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQS  475
            D+N+D+EVDIVTVEKD  FSDS++SQEE+ FLP  P PD LEQQDKCVGS+SKL DSN S
Sbjct  390  DINQDDEVDIVTVEKDA-FSDSDVSQEELCFLPATPCPDVLEQQDKCVGSSSKLVDSNNS  448

Query  474  GSPHSEEAEQNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPP  295
            GSP SEEAEQNGQ TNH SSP+E       EDT   R++RKRKPSEK L LQA KV KP 
Sbjct  449  GSPLSEEAEQNGQATNHASSPLE-------EDTGGTRMKRKRKPSEKGLVLQAGKVGKP-  500

Query  294  QKKTSGQ  274
              K+SG+
Sbjct  501  -LKSSGR  506



>ref|XP_006347717.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Solanum 
tuberosum]
Length=531

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 142/174 (82%), Gaps = 8/174 (5%)
 Frame = -2

Query  792  YIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIVTVE  613
            YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL PE EK K  DVNEDE+VDI  +E
Sbjct  362  YIWAKDFTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKGSDVNEDEDVDIDGLE  421

Query  612  KDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAEQNGQT  433
             D+TFSDS++S +EI FLP DPIPD  EQQDKCVGS+SKLG+SNQSGSP SEEA QNGQ 
Sbjct  422  NDSTFSDSDLSGDEICFLPADPIPDAPEQQDKCVGSSSKLGESNQSGSPLSEEAGQNGQ-  480

Query  432  TNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSGQ  274
             NHESSP E       EDT    L+R+RKPSEKVLE QAEKVKKPPQK K SG+
Sbjct  481  VNHESSPFE------GEDTGTTGLKRRRKPSEKVLEQQAEKVKKPPQKTKPSGK  528



>ref|XP_006347718.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Solanum 
tuberosum]
Length=527

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 141/173 (82%), Gaps = 8/173 (5%)
 Frame = -2

Query  792  YIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIVTVE  613
            YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL PE EK K  DVNEDE+VDI  +E
Sbjct  362  YIWAKDFTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKGSDVNEDEDVDIDGLE  421

Query  612  KDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAEQNGQT  433
             D+TFSDS++S +EI FLP DPIPD  EQQDKCVGS+SKLG+SNQSGSP SEEA QNGQ 
Sbjct  422  NDSTFSDSDLSGDEICFLPADPIPDAPEQQDKCVGSSSKLGESNQSGSPLSEEAGQNGQ-  480

Query  432  TNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSG  277
             NHESSP E       EDT    L+R+RKPSEKVLE QAEKVKKPPQK K SG
Sbjct  481  VNHESSPFE------GEDTGTTGLKRRRKPSEKVLEQQAEKVKKPPQKTKPSG  527



>gb|KCW65157.1| hypothetical protein EUGRSUZ_G02654 [Eucalyptus grandis]
Length=433

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 137/175 (78%), Gaps = 10/175 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEK----------AKE  658
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEK           K 
Sbjct  221  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEKLTTIKCVCIQVKG  280

Query  657  PDVNEDEEVDIVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQ  478
             DV+ED+EVD++TVE+D+ FSDS+MSQEE+ FLP  P  D  EQQDKCVGS SKL D N 
Sbjct  281  LDVHEDDEVDVLTVERDSVFSDSDMSQEELCFLPAVPCLDIPEQQDKCVGSCSKLPDGNH  340

Query  477  SGSPHSEEAEQNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
            SGSP S EA QNG  +NH SSP+E ++NS A+DT   RL+RKRKPSEK LELQAE
Sbjct  341  SGSPLSVEAGQNGNASNHNSSPLEPMENSTADDTDGVRLKRKRKPSEKGLELQAE  395



>ref|XP_008238384.1| PREDICTED: LOW QUALITY PROTEIN: retinoblastoma-binding protein 
5 [Prunus mume]
Length=503

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 133/164 (81%), Gaps = 7/164 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE DVNED+EVD
Sbjct  347  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKESDVNEDDEVD  406

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQEE+ FLP  P PD  EQQDKC+ S+SKL DSN SGSP SEE  
Sbjct  407  IVTVEKDSAFSDSDMSQEELCFLPAIPYPDVPEQQDKCIESSSKLVDSNNSGSPISEEGR  466

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG+T NH SSP+E       ED  A RL+RKRKPSEK +E QA
Sbjct  467  PNGRTNNHASSPLE-------EDAGATRLKRKRKPSEKGMEFQA  503



>ref|XP_010936566.1| PREDICTED: LOW QUALITY PROTEIN: retinoblastoma-binding protein 
5 homolog [Elaeis guineensis]
Length=562

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 140/174 (80%), Gaps = 1/174 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PE+EK KE D+N+DEEVD
Sbjct  357  VAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPESEKVKELDINQDEEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDSE SQ+E+ FLP  P+PD  EQQDKC+GS+SKL DSN SGSP S EAE
Sbjct  417  IVTVEKDSAFSDSEASQDELCFLPAIPLPDIPEQQDKCLGSSSKLEDSNHSGSPFSIEAE  476

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAK-RLRRKRKPSEKVLELQAEKVKKPPQK  289
            QNGQ     SSP+E + NS AE+      L+RKRKPS K LELQAEK +KP  K
Sbjct  477  QNGQAMLPXSSPLEVMGNSTAEEAVGTPSLKRKRKPSAKGLELQAEKGRKPLTK  530



>ref|XP_008787133.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
 ref|XP_008787134.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
Length=574

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 139/174 (80%), Gaps = 1/174 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PE+EKAKE D+N+DEEVD
Sbjct  357  VAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPESEKAKELDINQDEEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVT+EKD+ FSDSE SQEE+ FLP  P+PD  EQQDKC GS+SKL DSN SGSP S EA 
Sbjct  417  IVTIEKDSAFSDSEASQEELCFLPAIPLPDIPEQQDKCFGSSSKLEDSNHSGSPFSIEAA  476

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKR-LRRKRKPSEKVLELQAEKVKKPPQK  289
            QNGQ     SSP+E + NS AE+      L+RKR+PS K LELQAEK +KP  K
Sbjct  477  QNGQAMLPTSSPLEVVGNSTAEEVMGTTGLKRKRRPSAKGLELQAEKGRKPLTK  530



>ref|XP_006445680.1| hypothetical protein CICLE_v10014800mg [Citrus clementina]
 ref|XP_006485525.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR58920.1| hypothetical protein CICLE_v10014800mg [Citrus clementina]
Length=551

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 140/178 (79%), Gaps = 10/178 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTG  YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL  ETEK KE +VNEDEEVD
Sbjct  356  LTGWVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNTETEKVKESNVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV V+KD  FSDS+MSQEE+ FLP  P PD  E+Q KC+GS+SKL D N SGSP SEEA 
Sbjct  416  IVAVDKDA-FSDSDMSQEELCFLPAIPCPDVPERQGKCMGSSSKLMDRNHSGSPLSEEAM  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQ  274
            QNGQ  NH SSP+E       EDT   RL+RKRKPSEK LELQAEKV+KP   K+SG+
Sbjct  475  QNGQAANHASSPLE-------EDTGGTRLKRKRKPSEKGLELQAEKVRKP--LKSSGR  523



>ref|XP_010277148.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Nelumbo nucifera]
Length=539

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
             +GL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK KE  VNEDEEVD
Sbjct  331  FSGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLMPETEKVKESVVNEDEEVD  390

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+ VE+D+ FSDS+MSQ E+ FLP  P PD + +Q+K + S SKL DSN SGS  SEEA 
Sbjct  391  IMMVERDSAFSDSDMSQGELCFLPAIPCPD-VPEQEKFIRSASKLADSNHSGSALSEEAG  449

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKK  301
            QNGQ TN  SSPVEAIDNS A+DT    L+RKRKPSEK LELQAEK +K
Sbjct  450  QNGQITNPASSPVEAIDNSIADDTGVTCLKRKRKPSEKGLELQAEKGRK  498



>ref|XP_010277147.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Nelumbo nucifera]
Length=564

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
             +GL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK KE  VNEDEEVD
Sbjct  356  FSGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLMPETEKVKESVVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+ VE+D+ FSDS+MSQ E+ FLP  P PD + +Q+K + S SKL DSN SGS  SEEA 
Sbjct  416  IMMVERDSAFSDSDMSQGELCFLPAIPCPD-VPEQEKFIRSASKLADSNHSGSALSEEAG  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKK  301
            QNGQ TN  SSPVEAIDNS A+DT    L+RKRKPSEK LELQAEK +K
Sbjct  475  QNGQITNPASSPVEAIDNSIADDTGVTCLKRKRKPSEKGLELQAEKGRK  523



>ref|XP_004290312.1| PREDICTED: protein RBL [Fragaria vesca subsp. vesca]
 ref|XP_011458299.1| PREDICTED: protein RBL [Fragaria vesca subsp. vesca]
Length=511

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 135/163 (83%), Gaps = 7/163 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEKAKE +VNED+EVD
Sbjct  355  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLIPETEKAKESNVNEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTV+KD+ FSDS+MSQEE+ FLP  P+PD  EQQDKC+ S+SKL +SN SGSP SEE  
Sbjct  415  IVTVDKDSAFSDSDMSQEELCFLPAIPLPDAPEQQDKCLESSSKLVESNNSGSPLSEEGR  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQ  319
             NG+T NH SSP+E       ED  A RL+RKRKPSEK L+LQ
Sbjct  475  PNGRTMNHASSPLE-------EDPGATRLKRKRKPSEKWLDLQ  510



>ref|XP_007209915.1| hypothetical protein PRUPE_ppa004402mg [Prunus persica]
 gb|EMJ11114.1| hypothetical protein PRUPE_ppa004402mg [Prunus persica]
Length=512

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 131/164 (80%), Gaps = 7/164 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE DVNED+EVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKESDVNEDDEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQEE+ FLP  P PD  EQQDKC+ S+SKL DSN SGSP SEE  
Sbjct  416  IVTVEKDSAFSDSDMSQEELCFLPAIPYPDVPEQQDKCIESSSKLVDSNNSGSPISEEGR  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG+  NH  SP+E       ED  A RL+RKRKPSEK +E QA
Sbjct  476  PNGRANNHALSPLE-------EDAGATRLKRKRKPSEKGMEFQA  512



>ref|XP_011091979.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Sesamum indicum]
Length=533

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 7/173 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPE EK K+ D+NEDEE+D
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPEAEKVKDSDINEDEEID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQ EI FLP DP PD  E QD  V STSKLG  +QS SP SEEA 
Sbjct  416  IVTVEKDSAFSDSDMSQNEIRFLPADPSPDIPELQDAHVLSTSKLGHGSQSLSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK  289
            QNG  TNHESSP+E       EDT   RL+R+RK SEKVL+ + E V+KP  K
Sbjct  476  QNGHLTNHESSPLE-------EDTGGTRLKRRRKSSEKVLDFEEENVRKPQSK  521



>ref|XP_008790627.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
 ref|XP_008790628.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Phoenix 
dactylifera]
Length=564

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAKD+TENWSAFAPDFKELEENEEY+EREDEFDL+PE+EKAK+ D+N+DEE+D
Sbjct  357  VAGLVYIWAKDHTENWSAFAPDFKELEENEEYIEREDEFDLMPESEKAKDLDINQDEEID  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVT+EKD+ FSDS+ SQEE+ FLP  P+PD  EQQDKC+GS+SKL DSN SGSP S EA 
Sbjct  417  IVTIEKDSAFSDSDASQEELCFLPAIPLPDVPEQQDKCLGSSSKLEDSNHSGSPFSIEAA  476

Query  447  QNGQTTNHESSPVEAIDNSAAED-TSAKRLRRKRKPSEKVLELQAEKVKKP  298
            QNGQ     SSP+E + NS AE+      L+RKRKPS K +ELQAEK +KP
Sbjct  477  QNGQAILPASSPLEVVGNSTAEEAVETSSLKRKRKPSAKGMELQAEKGRKP  527



>ref|XP_010271571.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Nelumbo 
nucifera]
Length=561

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  792  YIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIVTVE  613
            YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE D+NEDEEVDI+TVE
Sbjct  361  YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETEKVKESDINEDEEVDIMTVE  420

Query  612  KDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAEQNGQT  433
            KD++FSDS++S EE+ FLP  P PD  EQQDK +GS+SKL DSN SGSP SEE  QNGQ 
Sbjct  421  KDSSFSDSDISVEELCFLPAIPCPDVPEQQDKYIGSSSKLVDSNHSGSPLSEEGAQNGQV  480

Query  432  TNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
            TN  SSPVEAIDNS AEDT A RL+RKRKPSEK LELQAE
Sbjct  481  TNPASSPVEAIDNSIAEDTGAARLKRKRKPSEKGLELQAE  520



>ref|XP_009394337.1| PREDICTED: retinoblastoma-binding protein 5 homolog {ECO:0000250|UniProtKB:Q15291} 
[Musa acuminata subsp. malaccensis]
Length=564

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PE+EK KE  +N+DEEVD
Sbjct  357  VAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPESEKVKELVINQDEEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD+ FSDS+ SQEE+ FLP  P+PD  EQQDKC+GS+ KLGDSN +GSP S EA 
Sbjct  417  ILTVEKDSAFSDSDASQEELCFLPAVPLPDVPEQQDKCLGSSLKLGDSNHTGSPFSVEAA  476

Query  447  QNGQTTNHESSPVEAIDNSAAED-TSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSGQ  274
            QNGQ     SSP+E + NS  E+      ++RKRKPS K +ELQAEK +KP  K K SG+
Sbjct  477  QNGQAILPASSPLEVVGNSTPEEAVGTAGMKRKRKPSAKGMELQAEKGRKPQTKNKPSGK  536



>ref|XP_010939085.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Elaeis guineensis]
Length=563

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PE+EKAK+ D+N+DEEVD
Sbjct  357  VAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPESEKAKDLDINQDEEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVT+EKD+ FSDSE SQEE+ FLP  P+PD + +QDKC+GS+SKL DSN SGSP S EA 
Sbjct  417  IVTMEKDSAFSDSEASQEELCFLPAIPLPD-VPEQDKCLGSSSKLEDSNHSGSPFSIEAA  475

Query  447  QNGQTTNHESSPVEAIDNSAAED-TSAKRLRRKRKPSEKVLELQAEKVKKP  298
            Q+GQ     SSP+E + NS AE+      L+RKRKPS K +ELQAEK +KP
Sbjct  476  QDGQAILPASSPLEVVGNSTAEEAVETSSLKRKRKPSVKGMELQAEKGRKP  526



>ref|XP_006578413.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=543

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 130/165 (79%), Gaps = 9/165 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDVNEDEEVD
Sbjct  320  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVNEDEEVD  379

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  380  IITVEKDAAFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  439

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   NH SSP+E           A R++RKRKPSEKVLELQAE
Sbjct  440  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQAE  475



>ref|XP_004230069.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Solanum 
lycopersicum]
Length=528

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 138/174 (79%), Gaps = 11/174 (6%)
 Frame = -2

Query  792  YIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIVTVE  613
            YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL PE EK K  DVNEDE+VDI  +E
Sbjct  362  YIWAKDFTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKGSDVNEDEDVDIDGLE  421

Query  612  KDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAEQNGQT  433
             D+ FSDS++S++EI FLP DPIPD  EQQDKCVGS+SKLG   +SGSP SEEA QNG  
Sbjct  422  NDSAFSDSDLSEDEICFLPADPIPDAPEQQDKCVGSSSKLG---ESGSPFSEEAGQNGP-  477

Query  432  TNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSGQ  274
             NHESSP E       EDT    L+R+RKPSEKVLE QAEKVKKPPQK K SG+
Sbjct  478  ANHESSPFE------GEDTGTTGLKRRRKPSEKVLEQQAEKVKKPPQKTKPSGK  525



>ref|XP_003522878.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=549

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 130/165 (79%), Gaps = 9/165 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDVNEDEEVD
Sbjct  358  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVNEDEEVD  417

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  418  IITVEKDAAFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  477

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   NH SSP+E           A R++RKRKPSEKVLELQAE
Sbjct  478  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQAE  513



>gb|KHN48493.1| Retinoblastoma-binding protein 5 [Glycine soja]
Length=549

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 130/165 (79%), Gaps = 9/165 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDVNEDEEVD
Sbjct  358  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVNEDEEVD  417

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  418  IITVEKDAAFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  477

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   NH SSP+E           A R++RKRKPSEKVLELQAE
Sbjct  478  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQAE  513



>ref|XP_006578412.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=561

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 130/165 (79%), Gaps = 9/165 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDVNEDEEVD
Sbjct  358  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVNEDEEVD  417

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  418  IITVEKDAAFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  477

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   NH SSP+E           A R++RKRKPSEKVLELQAE
Sbjct  478  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQAE  513



>ref|XP_004230070.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Solanum 
lycopersicum]
Length=524

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 137/173 (79%), Gaps = 11/173 (6%)
 Frame = -2

Query  792  YIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIVTVE  613
            YIWAKD+TENWSAFAPDFKELEENEEYVEREDEFDL PE EK K  DVNEDE+VDI  +E
Sbjct  362  YIWAKDFTENWSAFAPDFKELEENEEYVEREDEFDLNPEIEKVKGSDVNEDEDVDIDGLE  421

Query  612  KDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAEQNGQT  433
             D+ FSDS++S++EI FLP DPIPD  EQQDKCVGS+SKLG   +SGSP SEEA QNG  
Sbjct  422  NDSAFSDSDLSEDEICFLPADPIPDAPEQQDKCVGSSSKLG---ESGSPFSEEAGQNGP-  477

Query  432  TNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK-KTSG  277
             NHESSP E       EDT    L+R+RKPSEKVLE QAEKVKKPPQK K SG
Sbjct  478  ANHESSPFE------GEDTGTTGLKRRRKPSEKVLEQQAEKVKKPPQKTKPSG  524



>ref|XP_006578411.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=581

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 130/165 (79%), Gaps = 9/165 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDVNEDEEVD
Sbjct  358  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVNEDEEVD  417

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  418  IITVEKDAAFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  477

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   NH SSP+E           A R++RKRKPSEKVLELQAE
Sbjct  478  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQAE  513



>ref|XP_006579836.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X6 [Glycine 
max]
Length=528

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  331  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  390

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  391  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  450

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  451  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  485



>ref|XP_008363218.1| PREDICTED: retinoblastoma-binding protein 5-like [Malus domestica]
Length=511

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 131/164 (80%), Gaps = 8/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PE EK K+ D+NED+EVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLIPEXEKVKDSDINEDDEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQEE+ FLP  P PD L+ QDKC+ S+SKL DSN SGSP SEE  
Sbjct  416  IVTVEKDSAFSDSDMSQEELCFLPAIPSPDVLDPQDKCIESSSKLVDSN-SGSPISEEGT  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG+  NH SSP+E       ED  A RL+RKRKPSEK LE QA
Sbjct  475  PNGRAINHASSPLE-------EDAGATRLKRKRKPSEKGLEFQA  511



>ref|XP_006594025.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=548

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006582400.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=548

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_003524594.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=537

 Score =   199 bits (506),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006594026.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=538

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006579833.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=548

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006579835.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X5 [Glycine 
max]
Length=543

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006594027.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X5 [Glycine 
max]
Length=537

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006582402.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=539

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006582403.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X5 [Glycine 
max]
Length=538

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006594024.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=565

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006579834.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X4 [Glycine 
max]
Length=547

 Score =   199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006579832.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Glycine 
max]
Length=553

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006582399.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=565

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_003541356.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Glycine 
max]
Length=547

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSHDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>ref|XP_006582401.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Glycine 
max]
Length=547

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 130/164 (79%), Gaps = 9/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IVTVEKDATFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSKLLDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  476  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  510



>gb|KJB78514.1| hypothetical protein B456_013G003300 [Gossypium raimondii]
Length=556

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 141/182 (77%), Gaps = 14/182 (8%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEK KE D+NED+EVD
Sbjct  355  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEKVKESDINEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEE--  454
            IVTVEKD  FSDS+MSQ+E+ FLP  P PD  +QQDK VGS+SKL DSN SGSP SEE  
Sbjct  415  IVTVEKD-PFSDSDMSQDELCFLPATPCPDDPQQQDKFVGSSSKLIDSNHSGSPLSEENG  473

Query  453  -AEQNGQTTNHESSPVEAIDNSAAEDTS-AKRLRRKRKPSEKVLELQAEKVKKP--PQKK  286
               QNGQ   + SSP+E       EDT+   +L+RKRK SEK LELQAEKV+KP  P K 
Sbjct  474  QNGQNGQAAQNASSPLE-------EDTAGGNQLKRKRKLSEKGLELQAEKVRKPMKPLKS  526

Query  285  TS  280
            T 
Sbjct  527  TG  528



>ref|XP_009341586.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Pyrus x 
bretschneideri]
Length=511

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 131/164 (80%), Gaps = 8/164 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK K+ D+NED+EVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLIPETEKVKDSDINEDDEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS++SQEE+ FLP  P PD  + QDKC+ S+SKL DSN SGSP SEE  
Sbjct  416  IVTVEKDSAFSDSDISQEELCFLPAIPSPDVPDPQDKCIESSSKLVDSN-SGSPISEEGT  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG+  NH SSP+E       ED  A RL+RKRKPSEK LE QA
Sbjct  475  PNGRAINHASSPLE-------EDAGATRLKRKRKPSEKGLEFQA  511



>ref|XP_007141031.1| hypothetical protein PHAVU_008G161500g [Phaseolus vulgaris]
 gb|ESW13025.1| hypothetical protein PHAVU_008G161500g [Phaseolus vulgaris]
Length=546

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 128/165 (78%), Gaps = 10/165 (6%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G  YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDVNEDEEVD
Sbjct  356  LNGFVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV+VEKD TFSDS+MSQEE+ FLP  P  D  EQQDKC  S+SKL DSN +GSP SEEA 
Sbjct  416  IVSVEKDATFSDSDMSQEELCFLPATPNRDPPEQQDKCAESSSKLLDSNNTGSP-SEEAG  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   NH SSP+E             R++RKRKPSEKVLELQAE
Sbjct  475  PNGLMMNHASSPLE---------DDVGRIKRKRKPSEKVLELQAE  510



>ref|XP_004490570.1| PREDICTED: retinoblastoma-binding protein 5-like [Cicer arietinum]
Length=552

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 7/167 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G  YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  D NEDEE+D
Sbjct  356  LNGTVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVFDFNEDEEID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKDTTFSDS+MS+EE+ FLP  PI D  EQQ+K + S+SKL D N SGSP SE+A 
Sbjct  416  IVTVEKDTTFSDSDMSEEELCFLPATPIRDVPEQQNKVLESSSKLVDRNNSGSPLSEDAI  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKV  307
             NG  T+H SSPV+       +D    R +RKRKPSEKVLELQAEKV
Sbjct  476  PNGHLTDHASSPVK-------DDAGGTRSKRKRKPSEKVLELQAEKV  515



>ref|XP_007156314.1| hypothetical protein PHAVU_003G276000g [Phaseolus vulgaris]
 gb|ESW28308.1| hypothetical protein PHAVU_003G276000g [Phaseolus vulgaris]
Length=550

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 128/165 (78%), Gaps = 7/165 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE DVNED+EVD
Sbjct  357  LNGIVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKESDVNEDDEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDSEMS+EE+ FLP  P  D  EQ DK + S+SKL DSN SGSP SEEA 
Sbjct  417  IVTVEKDPGFSDSEMSEEELCFLPATPTCDAPEQMDKFIESSSKLVDSNNSGSPLSEEAG  476

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             N  T NH SSP+E       +D    R +RKRKPSEKVLELQAE
Sbjct  477  PNEHTMNHNSSPLE-------DDAWGTRTKRKRKPSEKVLELQAE  514



>ref|XP_004498849.1| PREDICTED: retinoblastoma-binding protein 5-like [Cicer arietinum]
Length=465

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 128/165 (78%), Gaps = 7/165 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  D NEDEE+D
Sbjct  272  LNGIVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGTDGNEDEEID  331

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MSQEE+ FLP  P  D  EQQDK + S+SKL DSN SGS  SEEA 
Sbjct  332  IVTVEKDPAFSDSDMSQEELCFLPASPRYDVPEQQDKFLESSSKLVDSNNSGSTFSEEAV  391

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   +H SSP+E       +D  A R++RKRKPSEKVLELQAE
Sbjct  392  VNGHMMSHASSPLE-------DDAGATRIKRKRKPSEKVLELQAE  429



>gb|KHN26444.1| Retinoblastoma-binding protein 5 [Glycine soja]
Length=442

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 128/164 (78%), Gaps = 11/164 (7%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K PDV+EDEEVD
Sbjct  253  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGPDVDEDEEVD  312

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD TFSDS+MSQEE+ +LP  P  D  EQQ+KCV S+S   DSN +GSP SEEA 
Sbjct  313  IVTVEKDATFSDSDMSQEELCYLPSTPSRDVPEQQEKCVESSSL--DSNNTGSPLSEEAG  370

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQA  316
             NG   NH SSP+E           A R++RKRKPSEKVLELQA
Sbjct  371  PNGHMMNHASSPLE---------DDAGRMKRKRKPSEKVLELQA  405



>ref|XP_011091980.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Sesamum indicum]
Length=510

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 125/158 (79%), Gaps = 7/158 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPE EK K+ D+NEDEE+D
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPEAEKVKDSDINEDEEID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQ EI FLP DP PD  E QD  V STSKLG  +QS SP SEEA 
Sbjct  416  IVTVEKDSAFSDSDMSQNEIRFLPADPSPDIPELQDAHVLSTSKLGHGSQSLSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEK  334
            QNG  TNHESSP+E       EDT   RL+R+RK SEK
Sbjct  476  QNGHLTNHESSPLE-------EDTGGTRLKRRRKSSEK  506



>ref|XP_003531795.1| PREDICTED: retinoblastoma-binding protein 5-like [Glycine max]
Length=550

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 129/167 (77%), Gaps = 7/167 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNED+E+D
Sbjct  357  LNGIVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGSDVNEDDEID  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MS+EE+ FLP  P  D  EQ DK V S+SKL DSN SGSP SEEA 
Sbjct  417  IVTVEKDPAFSDSDMSEEELCFLPATPSCDAPEQPDKFVNSSSKLVDSNNSGSPLSEEAG  476

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKV  307
             N  T NH SSPVE       +D    R++RK KPSEKVLELQAEK+
Sbjct  477  PNENTMNHNSSPVE-------DDAGGTRIKRKWKPSEKVLELQAEKM  516



>gb|KHN38141.1| Retinoblastoma-binding protein 5 [Glycine soja]
Length=564

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 129/167 (77%), Gaps = 7/167 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNED+E+D
Sbjct  371  LNGIVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGSDVNEDDEID  430

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MS+EE+ FLP  P  D  EQ DK V S+SKL DSN SGSP SEEA 
Sbjct  431  IVTVEKDPAFSDSDMSEEELCFLPATPSCDAPEQPDKFVNSSSKLVDSNNSGSPLSEEAG  490

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKV  307
             N  T NH SSPVE       +D    R++RK KPSEKVLELQAEK+
Sbjct  491  PNENTMNHNSSPVE-------DDAGGTRIKRKWKPSEKVLELQAEKM  530



>gb|AFK42526.1| unknown [Lotus japonicus]
Length=548

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 127/165 (77%), Gaps = 8/165 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  D+NEDEEVD
Sbjct  356  LNGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKGSDINEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+  +KD  FSDS+MSQEE+ FLP  P  D  EQQ+KCV S+SKL DSN +GSP SEEA 
Sbjct  416  IMEFDKDAAFSDSDMSQEELCFLPATPSRDSPEQQEKCVESSSKLVDSNNTGSPLSEEAG  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAE  313
             NG   +H SSP+         D +  R++RKRKPSEKVLELQAE
Sbjct  476  PNGHAMDHASSPL--------ADDAGGRMKRKRKPSEKVLELQAE  512



>ref|XP_003628195.1| WD repeat-containing protein [Medicago truncatula]
 gb|AET02671.1| retinoblastoma-binding-like protein [Medicago truncatula]
Length=550

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 135/181 (75%), Gaps = 13/181 (7%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAK+Y ENWSAFAPDFKE+EENEEYVEREDEFDL P+T+  K  DVNEDE+VD
Sbjct  356  LCGIVYIWAKEYIENWSAFAPDFKEIEENEEYVEREDEFDLNPDTDNVKGSDVNEDEDVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MS+EE+ +LPV PIPD  EQ+D+ + S+SK+GDSN SGSP SEE  
Sbjct  416  IVTVEKDPNFSDSDMSEEELRYLPVSPIPDVPEQEDRLLDSSSKIGDSNNSGSPFSEEVV  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEK------VKKPPQKK  286
             NG   +H SSP+E       +D    R++R+RKPSEKVLELQAE+        KP + K
Sbjct  476  ANGHMMSHASSPLE-------DDAVGTRIKRRRKPSEKVLELQAERDNKTSNSSKPSRTK  528

Query  285  T  283
            T
Sbjct  529  T  529



>ref|XP_003628041.1| WD repeat-containing protein [Medicago truncatula]
 gb|ABE88086.1| hypothetical protein MtrDRAFT_AC147431g31v2 [Medicago truncatula]
 gb|AET02517.1| retinoblastoma-binding-like protein [Medicago truncatula]
Length=549

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 138/190 (73%), Gaps = 13/190 (7%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L+G+ YIWAKDY ENWSAFAPDFKE+EENEEYVEREDEFDL  ET+K K  DVNEDE+VD
Sbjct  356  LSGIVYIWAKDYIENWSAFAPDFKEIEENEEYVEREDEFDLNTETDKVKGSDVNEDEDVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS+EE+ +LP  P  D  EQ+D+ + S+SK+GDSN SGSP SEE  
Sbjct  416  IETVEKDPAFSDSDMSEEELCYLPASPCRDVPEQEDRFLESSSKIGDSNNSGSPFSEEVV  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
             NG   +H SSPVE       +D    R++RKRKPSEKVLELQAE+V K  +   S    
Sbjct  476  ANGHMMSHASSPVE-------DDAVGTRIKRKRKPSEKVLELQAERVDKTSESSKS----  524

Query  267  I*ARLKTRAL  238
              +R KT++L
Sbjct  525  --SRTKTKSL  532



>gb|EYU26868.1| hypothetical protein MIMGU_mgv1a004535mg [Erythranthe guttata]
Length=522

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 131/174 (75%), Gaps = 8/174 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K+  +NEDEEVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKDSGINEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQ-DKCVGSTSKLGDSNQSGSPHSEEA  451
            I+ VEKD+TFSDS++S +EI FLP DP PD  EQQ D+ V S S+L D + S SP SEEA
Sbjct  416  IMEVEKDSTFSDSDVSHDEIRFLPADPCPDVPEQQDDRLVLSNSQLADGSLSLSPLSEEA  475

Query  450  EQNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK  289
             QNG  +NHESSP E       +D    RL++KRK  EK L  QA+ VKK P K
Sbjct  476  VQNGHLSNHESSPFE-------DDMLGMRLKKKRKNPEKALSSQADNVKKTPPK  522



>ref|XP_011012484.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Populus euphratica]
Length=566

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTG+ Y+WAKD+TENWSAFAPDFKELEENEEYVEREDEFDL+PETEK KE D+NED+EVD
Sbjct  355  LTGMVYVWAKDHTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKESDINEDDEVD  414

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD  FSDS+MSQEEI FLP  P PD  EQQDKCVGS+SKL DSN SGSP SEEA 
Sbjct  415  IVTVEKDA-FSDSDMSQEEICFLPATPCPDVPEQQDKCVGSSSKLMDSNNSGSPLSEEAG  473

Query  447  QNGQTTNHESSPVEA  403
            QNGQ  NH SSP+E 
Sbjct  474  QNGQAMNHASSPLEG  488



>ref|XP_010527302.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Tarenaya 
hassleriana]
 ref|XP_010527303.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Tarenaya 
hassleriana]
 ref|XP_010527304.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Tarenaya 
hassleriana]
Length=547

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 130/170 (76%), Gaps = 9/170 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDE+VD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETEKVKVTDVNEDEDVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MS+EE+ FLP +PIPD   Q++K V ST KL ++  S S  SEEA 
Sbjct  416  ILTVEKD-PFSDSDMSEEELRFLPAEPIPDINGQKEKGVDST-KLLETRNSASLASEEAG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKP  298
            QNG   NH SSP+        ED    R RRKRKPSEK +ELQAEKV KP
Sbjct  474  QNGYAANHASSPIR-------EDAGETRPRRKRKPSEKGMELQAEKVGKP  516



>dbj|BAH20231.1| AT3G21060 [Arabidopsis thaliana]
Length=282

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 135/193 (70%), Gaps = 18/193 (9%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  91   LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  150

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  151  IDTVEKD-AFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESI-KLIEGQISASPASEEAG  208

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H SSP        AE+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  209  QNG---HHASSP-------QAEEMGETRGKRKRKPSEKAMELQAEKAKP---LKGSGKTV  255

Query  267  I*ARLKTRALYHQ  229
               R K RA + Q
Sbjct  256  ---RAKNRAAFDQ  265



>ref|XP_008347048.1| PREDICTED: retinoblastoma-binding protein 5-like [Malus domestica]
Length=344

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 113/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEY+EREDEFDL+PETEK K  D+NED+EVD
Sbjct  147  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYIEREDEFDLIPETEKVKGSDINEDDEVD  206

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IVTVEKD+ FSDS+MSQEE+ FLP  P PD  +QQDKC+ S+SKL DSN SGSP SEE  
Sbjct  207  IVTVEKDSAFSDSDMSQEELCFLPAIPSPDVPDQQDKCIESSSKLVDSN-SGSPISEEGT  265

Query  447  QNGQTTNHESSPVEA  403
             NG   +H SSP+EA
Sbjct  266  PNGCAIDHASSPLEA  280



>dbj|BAB01449.1| retinoblastoma-binding protein-like [Arabidopsis thaliana]
Length=561

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 138/200 (69%), Gaps = 18/200 (9%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  416  IDTVEKD-AFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESI-KLIEGQISASPASEEAG  473

Query  447  QNGQTTNHESSPVEAIDN-------SAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK  289
            QNG   +H SSP   ID        S AE+    R +RKRKPSEK +ELQAEK K     
Sbjct  474  QNG---HHASSPQADIDALVTNTWLSIAEEMGETRGKRKRKPSEKAMELQAEKAKP---L  527

Query  288  KTSGQWII*ARLKTRALYHQ  229
            K SG+ +   R K RA + Q
Sbjct  528  KGSGKTV---RAKNRAAFDQ  544



>gb|KDO52247.1| hypothetical protein CISIN_1g0088442mg, partial [Citrus sinensis]
Length=488

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTG  YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL  ETEK KE +VNEDEEVD
Sbjct  356  LTGWVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNTETEKVKESNVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV V+KD  FSDS+MSQEE+ FLP  P PD  E+Q KCVGS+SKL D N SGSP SEEA 
Sbjct  416  IVAVDKDA-FSDSDMSQEELCFLPAIPCPDVPERQGKCVGSSSKLMDRNHSGSPLSEEAM  474

Query  447  QNGQTTNHESSPVE  406
            QNGQ  NH SSP+E
Sbjct  475  QNGQAANHASSPLE  488



>ref|XP_006485526.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Citrus 
sinensis]
Length=496

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTG  YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL  ETEK KE +VNEDEEVD
Sbjct  356  LTGWVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLNTETEKVKESNVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            IV V+KD  FSDS+MSQEE+ FLP  P PD  E+Q KC+GS+SKL D N SGSP SEEA 
Sbjct  416  IVAVDKDA-FSDSDMSQEELCFLPAIPCPDVPERQGKCMGSSSKLMDRNHSGSPLSEEAM  474

Query  447  QNGQTTNHESSPVEA  403
            QNGQ  NH SSP+E 
Sbjct  475  QNGQAANHASSPLEV  489



>ref|NP_188743.3| COMPASS-like H3K4 histone methylation complex component [Arabidopsis 
thaliana]
 sp|Q5E915.1|RBBP_ARATH RecName: Full=Protein RBL; AltName: Full=COMPASS-like H3K4 histone 
methylation complex component RBL; AltName: Full=RBBP5-like 
protein; AltName: Full=Retinoblastoma-binding protein-like 
[Arabidopsis thaliana]
 gb|AAX12875.1| At3g21060 [Arabidopsis thaliana]
 gb|AEE76455.1| COMPASS-like H3K4 histone methylation complex component [Arabidopsis 
thaliana]
Length=547

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 135/193 (70%), Gaps = 18/193 (9%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  416  IDTVEKD-AFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESI-KLIEGQISASPASEEAG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H SSP        AE+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  474  QNG---HHASSP-------QAEEMGETRGKRKRKPSEKAMELQAEKAKP---LKGSGKTV  520

Query  267  I*ARLKTRALYHQ  229
               R K RA + Q
Sbjct  521  ---RAKNRAAFDQ  530



>gb|AAO42218.1| putative G-protein beta subunit [Arabidopsis thaliana]
Length=547

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 135/193 (70%), Gaps = 18/193 (9%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  416  IDTVEKD-AFSDSDMSVEELRYLPAEPIPDTNDQQDNLVESI-KLIEGQISASPASEEAG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H SSP        AE+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  474  QNG---HHASSP-------QAEEMGETRGKRKRKPSEKAMELQAEKAKP---LKGSGKTV  520

Query  267  I*ARLKTRALYHQ  229
               R K RA + Q
Sbjct  521  ---RAKNRAAFDQ  530



>ref|XP_010466323.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camelina 
sativa]
Length=551

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 132/189 (70%), Gaps = 15/189 (8%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+ S EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDTSVEELRYLPAEPIPDTNDQQDNLVESI-KLVEGQISASPASEEAI  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H  SP        AE+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  474  QNGHGADHVLSP-------QAEELGDTRGKRKRKPSEKAMELQAEKAKP---SKGSGRIV  523

Query  267  I*ARLKTRA  241
               R K+RA
Sbjct  524  ---RAKSRA  529



>gb|KEH19268.1| retinoblastoma-binding-like protein [Medicago truncatula]
 gb|AET02674.2| retinoblastoma-binding-like protein [Medicago truncatula]
Length=542

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 127/173 (73%), Gaps = 7/173 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L+G+ YIWAK+Y E+WSAFAPDF E+EENEEYVEREDEFDL P+T+  K  DVNEDE+VD
Sbjct  358  LSGIVYIWAKEYIESWSAFAPDFIEIEENEEYVEREDEFDLKPDTDNVKVSDVNEDEDVD  417

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MS+EE+ +LPV PIPD  EQ D+ + S+SK+GDSN SGSP SEE  
Sbjct  418  IITVEKDPAFSDSDMSEEELCYLPVSPIPDVPEQDDRLLDSSSKIGDSNNSGSPFSEEVV  477

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK  289
             NG   +  SSPVE       +   A +++R RKPSEKVL  +++K  +   K
Sbjct  478  ANGHMMSRASSPVE-------DGAVATQIKRNRKPSEKVLASKSDKSSRTRSK  523



>ref|XP_003628198.1| Retinoblastoma-binding protein [Medicago truncatula]
Length=542

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 127/173 (73%), Gaps = 7/173 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L+G+ YIWAK+Y E+WSAFAPDF E+EENEEYVEREDEFDL P+T+  K  DVNEDE+VD
Sbjct  358  LSGIVYIWAKEYIESWSAFAPDFIEIEENEEYVEREDEFDLKPDTDNVKVSDVNEDEDVD  417

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVEKD  FSDS+MS+EE+ +LPV PIPD  EQ D+ + S+SK+GDSN SGSP SEE  
Sbjct  418  IITVEKDPAFSDSDMSEEELCYLPVSPIPDVPEQDDRLLDSSSKIGDSNNSGSPFSEEVV  477

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQK  289
             NG   +  SSPVE       +   A +++R RKPSEKVL  +++K  +   K
Sbjct  478  ANGHMMSRASSPVE-------DGAVATQIKRNRKPSEKVLASKSDKSSRTRSK  523



>ref|XP_006297362.1| hypothetical protein CARUB_v10013382mg [Capsella rubella]
 gb|EOA30260.1| hypothetical protein CARUB_v10013382mg [Capsella rubella]
Length=550

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 132/193 (68%), Gaps = 16/193 (8%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGVVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  EQQD  V S  KL +   S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDMSVEELRYLPAEPIPDTNEQQDNLVESI-KLIEGQISASPASEEAG  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H S           E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  474  QNGHGADHAS--------PQGEEMGDTRGKRKRKPSEKAMELQAEKAKP---LKGSGRTV  522

Query  267  I*ARLKTRALYHQ  229
               R KTRA   Q
Sbjct  523  ---RAKTRAGVDQ  532



>ref|XP_006829296.1| PREDICTED: protein RBL [Amborella trichopoda]
 gb|ERM96712.1| hypothetical protein AMTR_s00001p00273050 [Amborella trichopoda]
Length=572

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 125/174 (72%), Gaps = 8/174 (5%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L+GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LSGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETEKVKATDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+TVE ++ FSDS+ S+EE+ FLP  P+ D  E QDK + S SKL DS  S SP SE   
Sbjct  416  IMTVEGNSAFSDSDTSEEELCFLPTVPVLDVPEDQDKYLESHSKLNDSTHSDSPLSEVGR  475

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAK-RLRRKRKPSEKVLELQAEKVKKPPQK  289
             NG   N  SSPVE       ED  +   L+RKRKPSEK   +QAEK +KP  K
Sbjct  476  VNGPDLNPGSSPVE-------EDVGSDFHLKRKRKPSEKWTVMQAEKCRKPITK  522



>ref|XP_010509632.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camelina 
sativa]
 ref|XP_010509639.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Camelina 
sativa]
Length=553

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 132/193 (68%), Gaps = 15/193 (8%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  357  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+ S EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  417  IETVEKD-AFSDSDTSVEELRYLPAEPIPDTNDQQDNLVESI-KLVEGQISASPASEEAV  474

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H  SP         E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  475  QNGHGADHVLSP-------QGEELGDTRGKRKRKPSEKAMELQAEKAKP---SKGSGRTV  524

Query  267  I*ARLKTRALYHQ  229
               R K+RA   Q
Sbjct  525  ---RAKSRAGIDQ  534



>ref|XP_010488090.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Camelina sativa]
 ref|XP_010488091.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Camelina sativa]
Length=552

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 132/193 (68%), Gaps = 15/193 (8%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+ S EE+ +LP +PIPD  +QQD  V S  KL +   S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDTSVEELRYLPAEPIPDTNDQQDNLVESI-KLVEGQISASPASEEAV  473

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H  SP         E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  474  QNGHGADHVLSP-------QGEELGDTRGKRKRKPSEKAMELQAEKAKP---SKGSGRTV  523

Query  267  I*ARLKTRALYHQ  229
               R K+RA   Q
Sbjct  524  ---RAKSRAGIDQ  533



>ref|XP_006406323.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 ref|XP_006406325.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 gb|ESQ47776.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 gb|ESQ47778.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
Length=545

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 136/193 (70%), Gaps = 19/193 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  +VNEDEE+D
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVSNVNEDEEID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS++S EE+ +LP +PIPD  EQQD+      KL ++  S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDVSVEELRYLPAEPIPDTNEQQDEI-----KLIEAQISASPASEEAG  469

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H +SP+        E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  470  QNGHGADHAASPL-------GEEMGETRGKRKRKPSEKGMELQAEKAKP---LKASGRTV  519

Query  267  I*ARLKTRALYHQ  229
               R K++A+  Q
Sbjct  520  ---RTKSKAVVDQ  529



>emb|CDY27548.1| BnaC01g32310D [Brassica napus]
Length=544

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 134/193 (69%), Gaps = 19/193 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PET K K   VNEDEEVD
Sbjct  353  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETGKVKVSSVNEDEEVD  412

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  E+QD+      KL ++  S SP SEEA 
Sbjct  413  IETVEKD-AFSDSDMSVEELRYLPAEPIPDANEEQDEL-----KLIEARISASPASEEAG  466

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG  T+  SSP         E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  467  QNGHVTDLVSSP-------QGEEMGETRGKRKRKPSEKAMELQAEKAK---SSKASGRTV  516

Query  267  I*ARLKTRALYHQ  229
               R K+RA+  Q
Sbjct  517  ---REKSRAVGDQ  526



>ref|XP_009109937.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Brassica rapa]
 ref|XP_009109944.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X1 
[Brassica rapa]
Length=547

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 134/193 (69%), Gaps = 19/193 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PET K K   VNEDEEVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETGKVKVSSVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  E+QD+      KL ++  S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDMSVEELRYLPAEPIPDTNEEQDEL-----KLIEARISASPASEEAV  469

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG  T+  SSP         E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  470  QNGHVTDLVSSP-------QGEEMGETRGKRKRKPSEKAMELQAEKAK---ASKASGRTV  519

Query  267  I*ARLKTRALYHQ  229
               R K+RA+  Q
Sbjct  520  ---REKSRAVGDQ  529



>emb|CDY37319.1| BnaA01g25390D [Brassica napus]
Length=601

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 134/193 (69%), Gaps = 19/193 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PET K K   VNEDEEVD
Sbjct  410  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETGKVKVSSVNEDEEVD  469

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  E+QD+      KL ++  S SP SEEA 
Sbjct  470  IETVEKD-AFSDSDMSVEELRYLPAEPIPDTNEEQDEL-----KLIEARISASPASEEAV  523

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG  T+  SSP         E+    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  524  QNGHVTDLVSSP-------QGEEMGETRGKRKRKPSEKAMELQAEKAK---ASKASGRTV  573

Query  267  I*ARLKTRALYHQ  229
               R K+RA+  Q
Sbjct  574  ---REKSRAVGDQ  583



>ref|XP_002883282.1| hypothetical protein ARALYDRAFT_318845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59541.1| hypothetical protein ARALYDRAFT_318845 [Arabidopsis lyrata subsp. 
lyrata]
Length=560

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 136/194 (70%), Gaps = 16/194 (8%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  DVNEDEEVD
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVLDVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  +Q D  V S  KL +   S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDMSVEELRYLPAEPIPDTNDQLDNLVESI-KLIEGQISASPASEEAG  473

Query  447  QNGQTTNHESSPV--EAIDN---SAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKT  283
            QNG   +H SSP   + + N   S AE+    R +RKRKPSEK +ELQAEK K     K 
Sbjct  474  QNG---HHASSPQGDDVVTNAWLSIAEEMGETRGKRKRKPSEKAMELQAEKAKP---LKG  527

Query  282  SGQWII*ARLKTRA  241
            SG+ +   R K RA
Sbjct  528  SGRTV---RAKGRA  538



>ref|XP_006406324.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
 gb|ESQ47777.1| hypothetical protein EUTSA_v10020461mg [Eutrema salsugineum]
Length=544

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 136/193 (70%), Gaps = 20/193 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK K  +VNEDEE+D
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVKVSNVNEDEEID  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS++S EE+ +LP +PIPD  EQQD+      KL ++  S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDVSVEELRYLPAEPIPDTNEQQDEI-----KLIEAQISASPASEEAG  469

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG   +H +SP+  +  +        R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  470  QNGHGADHAASPLGEMGET--------RGKRKRKPSEKGMELQAEKAKP---LKASGRTV  518

Query  267  I*ARLKTRALYHQ  229
               R K++A+  Q
Sbjct  519  ---RTKSKAVVDQ  528



>ref|XP_009109949.1| PREDICTED: retinoblastoma-binding protein 5 homolog isoform X2 
[Brassica rapa]
Length=546

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 133/193 (69%), Gaps = 20/193 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PET K K   VNEDEEVD
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPETGKVKVSSVNEDEEVD  415

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I TVEKD  FSDS+MS EE+ +LP +PIPD  E+QD+      KL ++  S SP SEEA 
Sbjct  416  IETVEKD-AFSDSDMSVEELRYLPAEPIPDTNEEQDEL-----KLIEARISASPASEEAV  469

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRKPSEKVLELQAEKVKKPPQKKTSGQWI  268
            QNG  T+  SSP          +    R +RKRKPSEK +ELQAEK K     K SG+ +
Sbjct  470  QNGHVTDLVSSP--------QGEMGETRGKRKRKPSEKAMELQAEKAK---ASKASGRTV  518

Query  267  I*ARLKTRALYHQ  229
               R K+RA+  Q
Sbjct  519  ---REKSRAVGDQ  528



>ref|XP_004985264.1| PREDICTED: retinoblastoma-binding protein 5-like [Setaria italica]
Length=570

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 128/179 (72%), Gaps = 4/179 (2%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEYVEREDEFDL P  E+A+E  ++E+ E+D
Sbjct  357  VTGFVYIWAKEHVENWSAFAPDFVELEENEEYVEREDEFDLNPREEEAEEVVIDENAEID  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+  FSD E S +EI+FLP  P PD   EQ +KC+GS+SKL DSN SGSP S +A
Sbjct  417  IETYEKNAVFSDVEDSVDEIVFLPAIPSPDAPDEQPEKCLGSSSKLEDSNHSGSPSSMDA  476

Query  450  EQNGQTTNHESSPVEAIDNSAAEDTS-AKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
             QNGQ     SSP+E +DNS AED +     +RKR+ S K LEL Q EKVKKP  K  S
Sbjct  477  VQNGQAIPQASSPME-VDNSTAEDPAEGPNSKRKRRLSVKGLELQQTEKVKKPATKNKS  534



>ref|XP_003561921.1| PREDICTED: retinoblastoma-binding protein 5 homolog [Brachypodium 
distachyon]
Length=571

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 134/181 (74%), Gaps = 5/181 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAK++ ENWSAFAPDF+ELEEN EY+E+EDEFD+   TEKAK+  +NED ++D
Sbjct  358  VAGLIYIWAKEHVENWSAFAPDFEELEENVEYIEKEDEFDINAYTEKAKKTGINEDADID  417

Query  627  IVTVEKDTTFSDSE-MSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEE  454
            I T EK+++FSD E  S +EI++LP  P PD   EQ DKC+ S+SKL DSN SGSP S +
Sbjct  418  IETKEKNSSFSDLEDDSVDEIIYLPAIPSPDTPDEQPDKCLVSSSKLEDSNHSGSPSSMD  477

Query  453  AEQNGQTTNHESSPVEAIDNSAAEDTS-AKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
            A QNGQT    SSP+E +DNS AE+ + A   +RKRK S K LE+ QAEKVKKP  K ++
Sbjct  478  AVQNGQTIPPASSPLE-VDNSTAEEPAEAANSKRKRKLSAKGLEMQQAEKVKKPAIKISN  536

Query  279  G  277
            G
Sbjct  537  G  537



>ref|XP_006649601.1| PREDICTED: retinoblastoma-binding protein 5-like [Oryza brachyantha]
Length=568

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 130/180 (72%), Gaps = 5/180 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GLAYIWAK++ ENWSAFAPDF ELEENEEYVEREDEFDL    EKA+E  +NEDE VD
Sbjct  358  VAGLAYIWAKEHVENWSAFAPDFVELEENEEYVEREDEFDLNAYVEKAEEQLINEDEHVD  417

Query  627  IVTVEKDTTFSD-SEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEE  454
            I T +KD+TFSD  + +  E+++L   PIPD   EQ DKC+GS+SKL DSN SGSP S +
Sbjct  418  IETYDKDSTFSDLDDSTTMELIYLAAIPIPDTPDEQPDKCLGSSSKLEDSNHSGSPSSLD  477

Query  453  AEQNGQTTNHESSPVEAIDNSAAEDTS-AKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
            A QNGQ     SSP+E +DNS AE+ + A   +R+R+ S K LEL QAEK KKP  K  S
Sbjct  478  AVQNGQAIPPASSPME-VDNSTAEEPAEAANSKRRRRLSAKGLELQQAEKGKKPTTKNKS  536



>dbj|BAJ94837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=588

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 131/181 (72%), Gaps = 5/181 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAK++ ENWSAFAPDF ELEENEEYVEREDEFD+    E+ +E  +++D E+D
Sbjct  357  VAGLTYIWAKEHVENWSAFAPDFIELEENEEYVEREDEFDINAYAERVEELMIDQDAEID  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGS-PHSEE  454
            + T EK+++FSD E S +EI++LP  P PD   EQ DKC+ S+SKL DSN SGS P S +
Sbjct  417  VETCEKNSSFSDFEDSADEIIYLPAIPSPDAPDEQPDKCLVSSSKLEDSNHSGSPPSSMD  476

Query  453  AEQNGQTTNHESSPVEAIDNSAAEDTSAK--RLRRKRKPSEKVLEL-QAEKVKKPPQKKT  283
            A QNG      SSP+E +DNS AE+ SA+    +RKR+ S K LE+ QAEKVKKPP K +
Sbjct  477  AVQNGLAIPPASSPLEVVDNSMAEEPSAEAANAKRKRRLSAKGLEMQQAEKVKKPPMKMS  536

Query  282  S  280
            S
Sbjct  537  S  537



>gb|EMT25536.1| hypothetical protein F775_27533 [Aegilops tauschii]
Length=667

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 131/181 (72%), Gaps = 5/181 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAK++ ENWSAFAPDF ELEENEEYVEREDEFD+    E+ +E  +++D E+D
Sbjct  385  VAGLTYIWAKEHVENWSAFAPDFIELEENEEYVEREDEFDINAYAERVEELMIDQDAEID  444

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGS-PHSEE  454
            + T EK+++FSD E S +EI++LP  P PD   EQ DKC+ S+SKL DSN SGS P S +
Sbjct  445  VETCEKNSSFSDFEDSADEIIYLPAIPSPDAPDEQPDKCLVSSSKLEDSNHSGSPPSSMD  504

Query  453  AEQNGQTTNHESSPVEAIDNSAAEDTSAK--RLRRKRKPSEKVLEL-QAEKVKKPPQKKT  283
            A QNG      SSP+E +DNS AE+ SA+    +RKR+ S K LE+ QAEKVKKPP K +
Sbjct  505  AVQNGLAIPPASSPLEVVDNSMAEEPSAEAANAKRKRRLSAKGLEMQQAEKVKKPPIKMS  564

Query  282  S  280
            S
Sbjct  565  S  565



>gb|EMS61733.1| Retinoblastoma-binding protein 5 [Triticum urartu]
Length=711

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 5/181 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GL YIWAK++ ENWSAFAPDF ELEENEEYVEREDEFD+    E+ +E  +++D E+D
Sbjct  399  VAGLTYIWAKEHVENWSAFAPDFIELEENEEYVEREDEFDINAYAERVEELMIDQDAEID  458

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGS-PHSEE  454
            + T EK++ FSD E S +EI++LP  P PD   EQ DKC+ S+SKL DSN SGS P S +
Sbjct  459  VETCEKNSPFSDFEDSADEIIYLPAIPSPDAPDEQPDKCLVSSSKLEDSNHSGSPPSSMD  518

Query  453  AEQNGQTTNHESSPVEAIDNSAAEDTSAK--RLRRKRKPSEKVLEL-QAEKVKKPPQKKT  283
            A QNG      SSP+E +DNS AE+ SA+    +RKR+ S K LE+ QAEKVKKPP K +
Sbjct  519  AVQNGLAIPPASSPLEVVDNSMAEEPSAEAANAKRKRRLSAKGLEMQQAEKVKKPPIKMS  578

Query  282  S  280
            S
Sbjct  579  S  579



>ref|NP_001049328.1| Os03g0207900 [Oryza sativa Japonica Group]
 gb|AAN77305.1| Putative retinoblastoma-binding protein [Oryza sativa Japonica 
Group]
 gb|ABF94566.1| retinoblastoma-binding protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11242.1| Os03g0207900 [Oryza sativa Japonica Group]
 gb|EAZ26003.1| hypothetical protein OsJ_09856 [Oryza sativa Japonica Group]
Length=570

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 129/182 (71%), Gaps = 7/182 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GLAYIWAK++ ENWSAFAPDF ELEENEEYVEREDEFDL    EKA+E  VNEDE VD
Sbjct  358  VAGLAYIWAKEHVENWSAFAPDFVELEENEEYVEREDEFDLNAYVEKAEEQLVNEDEYVD  417

Query  627  IVTVEKDTTFSD---SEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHS  460
            I T +K++TFSD   S  +  E+++L   PIPD   EQ DKC+GS+SKL DSN S SP S
Sbjct  418  IETYDKNSTFSDLDDSSSTTMELIYLAAIPIPDTPDEQPDKCLGSSSKLEDSNHSDSPSS  477

Query  459  EEAEQNGQTTNHESSPVEAIDNSAAEDTS-AKRLRRKRKPSEKVLEL-QAEKVKKPPQKK  286
             +A QNGQ     SSP+E +DNS AE+ + A   +R+R+ S K LEL QAEK KKP  K 
Sbjct  478  LDAVQNGQAIPPASSPME-VDNSTAEEPAEAVNSKRRRRLSAKGLELQQAEKGKKPTTKN  536

Query  285  TS  280
             S
Sbjct  537  KS  538



>gb|EAY88980.1| hypothetical protein OsI_10465 [Oryza sativa Indica Group]
Length=570

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 129/182 (71%), Gaps = 7/182 (4%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            + GLAYIWAK++ ENWSAFAPDF ELEENEEYVEREDEFDL    EKA+E  VNEDE VD
Sbjct  358  VAGLAYIWAKEHVENWSAFAPDFVELEENEEYVEREDEFDLNAYVEKAEEQLVNEDEYVD  417

Query  627  IVTVEKDTTFSD---SEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHS  460
            I T +K++TFSD   S  +  E+++L   PIPD   EQ DKC+GS+SKL DSN S SP S
Sbjct  418  IETYDKNSTFSDLDDSSSTTMELIYLAAIPIPDTPDEQPDKCLGSSSKLEDSNHSDSPSS  477

Query  459  EEAEQNGQTTNHESSPVEAIDNSAAEDTS-AKRLRRKRKPSEKVLEL-QAEKVKKPPQKK  286
             +A QNGQ     SSP+E +DNS AE+ + A   +R+R+ S K LEL QAEK KKP  K 
Sbjct  478  LDAVQNGQAIPPASSPME-VDNSTAEEPAEAVNSKRRRRLSAKGLELQQAEKGKKPTTKN  536

Query  285  TS  280
             S
Sbjct  537  KS  538



>ref|XP_002465668.1| hypothetical protein SORBIDRAFT_01g043410 [Sorghum bicolor]
 gb|EER92666.1| hypothetical protein SORBIDRAFT_01g043410 [Sorghum bicolor]
Length=569

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEY EREDEFDL P  E+A+E  ++ED +VD
Sbjct  357  VTGYVYIWAKEHVENWSAFAPDFVELEENEEYAEREDEFDLNPREEQAEEVAIDEDADVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+T FSD E S +EI +LP  P PD   EQ +KC+GS SKL DSN SGSP S +A
Sbjct  417  IETCEKNTVFSDVEDSVDEICYLPAIPFPDSPDEQPEKCLGS-SKLEDSNHSGSPSSMDA  475

Query  450  EQNGQTTNHESSPVEAIDNSAAEDT-SAKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
             QNGQ     SSP+E +DNS AED       +RKR+ S K LEL Q+EK KK   K  S
Sbjct  476  VQNGQAIPPASSPME-VDNSTAEDPEEGPNSKRKRRLSVKGLELQQSEKGKKGSTKNKS  533



>tpg|DAA43873.1| TPA: retinoblastoma-binding protein-like protein [Zea mays]
Length=569

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEY EREDEFDL P  E+A++  ++ED +VD
Sbjct  357  VTGFVYIWAKEHVENWSAFAPDFVELEENEEYAEREDEFDLNPREEQAEKVVIDEDADVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+T FSD E S +EI +LP  P PD   EQ +KC+GS SKL DSN SGSP S +A
Sbjct  417  IETSEKNTVFSDVEDSVDEISYLPAIPYPDSPDEQPEKCLGS-SKLEDSNHSGSPSSMDA  475

Query  450  EQNGQTTNHESSPVEAIDNSAAEDT-SAKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
             QNGQ     SSP+E +DNS AED       +RKR+ S K LEL Q+EK KK   K  S
Sbjct  476  VQNGQAIPPASSPME-VDNSTAEDPEEGPNSKRKRRLSVKGLELQQSEKGKKGSTKNKS  533



>ref|NP_001146889.1| LOC100280497 [Zea mays]
 gb|ACG24214.1| retinoblastoma-binding protein-like [Zea mays]
Length=569

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEY EREDEFDL P  E+A++  ++ED +VD
Sbjct  357  VTGFVYIWAKEHVENWSAFAPDFVELEENEEYAEREDEFDLNPREEQAEKVVIDEDADVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+T FSD E S +EI +LP  P PD   EQ +KC+GS SKL DSN SGSP S +A
Sbjct  417  IETSEKNTVFSDVEDSVDEISYLPAIPYPDSPDEQPEKCLGS-SKLEDSNHSGSPSSMDA  475

Query  450  EQNGQTTNHESSPVEAIDNSAAEDT-SAKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
             QNGQ     SSP+E +DNS AED       +RKR+ S K LEL Q+EK KK   K  S
Sbjct  476  VQNGQAIPPASSPME-VDNSTAEDPEEGPNSKRKRRLSVKGLELQQSEKGKKGSTKNKS  533



>ref|XP_008673444.1| PREDICTED: LOC100280497 isoform X2 [Zea mays]
 tpg|DAA43875.1| TPA: hypothetical protein ZEAMMB73_120366 [Zea mays]
Length=589

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEY EREDEFDL P  E+A++  ++ED +VD
Sbjct  377  VTGFVYIWAKEHVENWSAFAPDFVELEENEEYAEREDEFDLNPREEQAEKVVIDEDADVD  436

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+T FSD E S +EI +LP  P PD   EQ +KC+GS SKL DSN SGSP S +A
Sbjct  437  IETSEKNTVFSDVEDSVDEISYLPAIPYPDSPDEQPEKCLGS-SKLEDSNHSGSPSSMDA  495

Query  450  EQNGQTTNHESSPVEAIDNSAAEDT-SAKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
             QNGQ     SSP+E +DNS AED       +RKR+ S K LEL Q+EK KK   K  S
Sbjct  496  VQNGQAIPPASSPME-VDNSTAEDPEEGPNSKRKRRLSVKGLELQQSEKGKKGSTKNKS  553



>ref|XP_008673440.1| PREDICTED: LOC100280497 isoform X1 [Zea mays]
Length=594

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEY EREDEFDL P  E+A++  ++ED +VD
Sbjct  382  VTGFVYIWAKEHVENWSAFAPDFVELEENEEYAEREDEFDLNPREEQAEKVVIDEDADVD  441

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+T FSD E S +EI +LP  P PD   EQ +KC+GS SKL DSN SGSP S +A
Sbjct  442  IETSEKNTVFSDVEDSVDEISYLPAIPYPDSPDEQPEKCLGS-SKLEDSNHSGSPSSMDA  500

Query  450  EQNGQTTNHESSPVEAIDNSAAEDT-SAKRLRRKRKPSEKVLEL-QAEKVKKPPQKKTS  280
             QNGQ     SSP+E +DNS AED       +RKR+ S K LEL Q+EK KK   K  S
Sbjct  501  VQNGQAIPPASSPME-VDNSTAEDPEEGPNSKRKRRLSVKGLELQQSEKGKKGSTKNKS  558



>tpg|DAA43874.1| TPA: hypothetical protein ZEAMMB73_120366, partial [Zea mays]
Length=507

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TG  YIWAK++ ENWSAFAPDF ELEENEEY EREDEFDL P  E+A++  ++ED +VD
Sbjct  357  VTGFVYIWAKEHVENWSAFAPDFVELEENEEYAEREDEFDLNPREEQAEKVVIDEDADVD  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+T FSD E S +EI +LP  P PD   EQ +KC+GS SKL DSN SGSP S +A
Sbjct  417  IETSEKNTVFSDVEDSVDEISYLPAIPYPDSPDEQPEKCLGS-SKLEDSNHSGSPSSMDA  475

Query  450  EQNGQTTNHESSPVEA  403
             QNGQ     SSP+E 
Sbjct  476  VQNGQAIPPASSPMEG  491



>ref|XP_004958908.1| PREDICTED: retinoblastoma-binding protein 5-like [Setaria italica]
Length=611

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 125/179 (70%), Gaps = 4/179 (2%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            +TGL YIWAK++ ENWSAFAPDF+ELEENEEYVEREDEFDL P  E+A+E  ++ED ++D
Sbjct  357  VTGLVYIWAKEHVENWSAFAPDFEELEENEEYVEREDEFDLNPREEEAEEVSIDEDADID  416

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHL-EQQDKCVGSTSKLGDSNQSGSPHSEEA  451
            I T EK+  FSD E S +EI+FLP  P PD   EQ  KC+ S+SKL DS+ SGSP S  A
Sbjct  417  IETFEKNAMFSDVEDSVDEIVFLPAIPSPDVPDEQPVKCLESSSKLEDSSHSGSPSSMAA  476

Query  450  EQNGQTTNHESSPVEAIDNSAAEDTSAKRL-RRKRKPSEKVLE-LQAEKVKKPPQKKTS  280
             Q+GQ     SSP+E ++ SAAED +   + +R R+ S K LE LQ EK K P  K  S
Sbjct  477  VQDGQAIPMASSPME-VNYSAAEDPAELPISKRVRRLSMKGLESLQFEKDKTPATKSKS  534



>gb|EPS71151.1| hypothetical protein M569_03609, partial [Genlisea aurea]
Length=452

 Score =   115 bits (287),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            LTGLAYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVP+TEK ++ D+ E+++VD
Sbjct  360  LTGLAYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPQTEKVRDSDICEEDDVD  419

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLE  529
            ++TVEKD+ FSD++MS++EI FLP +P  D  E
Sbjct  420  VITVEKDSAFSDTDMSEDEIRFLPAEPSSDFSE  452



>ref|XP_002975565.1| hypothetical protein SELMODRAFT_103410, partial [Selaginella 
moellendorffii]
 gb|EFJ23194.1| hypothetical protein SELMODRAFT_103410, partial [Selaginella 
moellendorffii]
Length=553

 Score =   110 bits (274),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 113/185 (61%), Gaps = 18/185 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            ++GL YIWAKDYTENWSAFAPDF+ELEENEEYVEREDEFDL  E EKAK    + D ++D
Sbjct  333  MSGLIYIWAKDYTENWSAFAPDFRELEENEEYVEREDEFDLNAEAEKAKPVQADNDADID  392

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDH--LEQQDKCVGSTSKLGDSNQS---GSPH  463
            I T EK   FSDS+ SQ+ + FLP  P PD    E+  +   S  K+  S+ S    SP 
Sbjct  393  ITTTEKVAVFSDSDESQDNLYFLPTVPQPDSPVPEEPSQAPASPPKVQASHPSESNDSPE  452

Query  462  SEEAEQNGQTT--NHESSPVEAIDNSAAEDTSAK-RLRRKRKPSEKVLELQAEKVKKPPQ  292
            SEE  Q   TT     +SP E       E+  A  R++RKRK SEK  ELQAE  +K   
Sbjct  453  SEEQNQIELTTIVQQSASPPE-------EEVGANGRIKRKRKLSEKAAELQAEIGRK---  502

Query  291  KKTSG  277
             KT G
Sbjct  503  SKTKG  507



>ref|XP_001764783.1| WD40 repeat protein, COMPASS complex protein [Physcomitrella 
patens]
 gb|EDQ70482.1| WD40 repeat protein, COMPASS complex protein [Physcomitrella 
patens]
Length=522

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 110/183 (60%), Gaps = 31/183 (17%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            ++G+ YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFD++PET+K K   V+ED +VD
Sbjct  353  MSGIIYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDIMPETDKVKPTRVDEDADVD  412

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHSEEAE  448
            I+T EK   FSDS+ S++ + FLP   +PD                D++    P S  A 
Sbjct  413  IMTTEKVAAFSDSDESEDGLYFLPT--VPDR---------------DASPPRPPSSPVAS  455

Query  447  QNGQTTNHESSPVEAIDNSAAEDTSA-------KRLRRKRKPSEKVLELQAEKVKKPPQK  289
             N       ++ V  +D S     SA        R++R+RK S+K  ELQAE+ +K   K
Sbjct  456  PN-------TASVPKVDGSMTPSNSADDEVGANGRIKRRRKLSKKAAELQAERGRKVSVK  508

Query  288  KTS  280
            K+ 
Sbjct  509  KSG  511



>ref|XP_002973538.1| hypothetical protein SELMODRAFT_413979 [Selaginella moellendorffii]
 gb|EFJ25198.1| hypothetical protein SELMODRAFT_413979 [Selaginella moellendorffii]
Length=767

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 114/185 (62%), Gaps = 18/185 (10%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVD  628
            ++GL YIWAKDYTENWSAFAPDF+ELEENEEYVEREDEFDL  E EKAK    ++D ++D
Sbjct  257  MSGLIYIWAKDYTENWSAFAPDFRELEENEEYVEREDEFDLNAEAEKAKPVQADDDADID  316

Query  627  IVTVEKDTTFSDSEMSQEEILFLPVDPIPDH--LEQQDKCVGSTSKLGDSNQS---GSPH  463
            I T EK   FSDS+ SQ+ + FLP  P PD    E+  +   S  K+  S+ S    SP 
Sbjct  317  ITTTEKVAVFSDSDESQDNLYFLPTVPQPDSPVPEEPSQAPASPPKVQASHPSESNDSPE  376

Query  462  SEEAEQNGQTT--NHESSPVEAIDNSAAEDTSAK-RLRRKRKPSEKVLELQAEKVKKPPQ  292
            SEE  Q   TT     +SP E       E+  A  R++RKRK SEK  ELQAE  +K   
Sbjct  377  SEEQNQIELTTIVQQSASPPE-------EEVGANGRIKRKRKLSEKAAELQAEIGRK---  426

Query  291  KKTSG  277
             KT G
Sbjct  427  SKTKG  431



>gb|KFH72296.1| hypothetical protein MVEG_02587 [Mortierella verticillata NRRL 
6337]
Length=617

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -2

Query  801  GLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIV  622
            G  +IWA +Y ENWSAFAPDFKELEEN +Y EREDEFD+VPE E +K    +ED  +D+ 
Sbjct  321  GTIHIWATNYQENWSAFAPDFKELEENIDYEEREDEFDIVPEEEASKRKHDDEDVVIDVT  380

Query  621  TVEKDTTFSDSEM-SQEEILFLPVDP  547
             +EK   F+DS+   +EE+ +LP+ P
Sbjct  381  NIEKINPFNDSDSEDEEEMFYLPLLP  406



>gb|KCW65156.1| hypothetical protein EUGRSUZ_G02654 [Eucalyptus grandis]
Length=416

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKE  658
            LTGL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEK  E
Sbjct  356  LTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLVPETEKVNE  405



>gb|AAR88785.1| transducin/WD-40 repeat family-like protein [Musa acuminata AAA 
Group]
Length=121

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKE  658
            + GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PE+EK KE
Sbjct  71   VAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPESEKVKE  120



>ref|XP_002862673.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAK  661
            L GL YIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDL+PETEK +
Sbjct  356  LAGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLIPETEKVR  404



>ref|XP_007133504.1| hypothetical protein PHAVU_011G184500g, partial [Phaseolus vulgaris]
 gb|ESW05498.1| hypothetical protein PHAVU_011G184500g, partial [Phaseolus vulgaris]
Length=480

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 72/138 (52%), Gaps = 20/138 (14%)
 Frame = -2

Query  807  LTGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDL-VPETEK-AKEPDVNEDEE  634
            L G  ++WAKD +EN S F P  +  +E          FDL  PETEK  K    +E EE
Sbjct  355  LAGKIHVWAKDVSENCSVFVPFVEREDE----------FDLKSPETEKEVKRSKGDEVEE  404

Query  633  VDIV----TVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSP  466
             +IV     VEK   FSDS+MSQEE+ FLP  P  +  E  DK + S+ +  DSN S   
Sbjct  405  GEIVENVENVEKGLDFSDSDMSQEELCFLPASPTYNVPELTDKLIRSSPESVDSNNS---  461

Query  465  HSEEAEQNGQTTNHESSP  412
             S   + +G+ TN   +P
Sbjct  462  -SPSGDTSGEGTNRRRTP  478



>gb|EIE78735.1| hypothetical protein RO3G_03440 [Rhizopus delemar RA 99-880]
Length=246

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  801  GLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIV  622
            G  YIWA  + ENWSAFAPDF ELEEN EY E+EDEFD+VP+ EK+K+  V+ED  VD+ 
Sbjct  115  GNIYIWATKHEENWSAFAPDFIELEENLEYEEKEDEFDVVPDDEKSKQKQVDEDVLVDVT  174

Query  621  TVEKDTTFSDSEMSQEEILFLP  556
            T +    F +S   ++E+ +LP
Sbjct  175  TCDAIQAFIESSDEEDEVFYLP  196



>gb|KEH33484.1| retinoblastoma-binding-like protein, putative [Medicago truncatula]
Length=61

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  645  EDEEVDIVTVEKDTTFSDSEMSQEEILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQS  475
            +DEE+DIV +E+ T FSDS++S+EE+ F+P   I D LEQQDKC+ S+  L  +N S
Sbjct  5    DDEEIDIVKMEEGTVFSDSDISREELCFIPTTHIQDFLEQQDKCLESSLNLVVNNNS  61



>ref|XP_004339591.1| WD40 repeat protein, COMPASS complex protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17578.1| WD40 repeat protein, COMPASS complex protein [Acanthamoeba castellanii 
str. Neff]
Length=427

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETE----KAKEPDVNEDE  637
            +G+ YIWA +YTENWSAFAPDF EL+ENEEY EREDEFD+  + +      K   V+E  
Sbjct  311  SGVVYIWATNYTENWSAFAPDFTELQENEEYEEREDEFDIAEDEDDQGPGKKRKRVDEPG  370

Query  636  EVDIVTVEKDTTFSDSEMSQEEILFLPV  553
            EVDI+T++K T +S  E  ++E+ F+P+
Sbjct  371  EVDIMTIDKVTAYSSGE--EDELWFIPI  396



>ref|XP_005112726.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Aplysia 
californica]
Length=551

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 86/165 (52%), Gaps = 19/165 (12%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDL---VPETEKAKEPDVNEDEE  634
            +GL  IWA++  ENWSAFAPDFKEL+EN EY ERE EFDL     E E++K P V ED E
Sbjct  314  SGLVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDLEDEDKEKEESKAP-VEEDVE  372

Query  633  VDIVTVEKDTTFSDSEMSQEE---ILFLPVDPIPD------HLEQQDKCVGSTSKLGDSN  481
            VD+ T+E    F  S+  +E+   +LFLPV P  +        E Q K          S 
Sbjct  373  VDVSTIEPIQAFVSSDEDEEDANALLFLPVSPEVEEPEDGWQGENQQKRPPPPPSSAVSR  432

Query  480  QSGSPHSEEAEQNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRK  346
             SG  H+   E+   T      P   ++    +DTS+   RR ++
Sbjct  433  ISGEDHAVHTEKKKDT------PSSGVEKRTRQDTSSSDRRRGQQ  471



>ref|XP_011611869.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Takifugu 
rubripes]
Length=556

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_003973044.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Takifugu 
rubripes]
Length=510

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_010743859.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Larimichthys 
crocea]
Length=511

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_010743858.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Larimichthys 
crocea]
Length=560

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  406



>gb|AEG78353.1| retinoblastoma-binding protein 5, partial [Epinephelus coioides]
Length=298

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  147  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  204

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  205  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  238



>ref|XP_005815581.1| PREDICTED: retinoblastoma-binding protein 5-like [Xiphophorus 
maculatus]
Length=511

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQMGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_008407090.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Poecilia 
reticulata]
Length=563

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_007542354.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Poecilia 
formosa]
Length=563

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_011611870.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Takifugu 
rubripes]
Length=524

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_007542355.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Poecilia 
formosa]
Length=511

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_008407092.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Poecilia 
reticulata]
Length=511

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDNKALLYLPIAP  406



>ref|XP_005749526.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005917851.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Haplochromis 
burtoni]
Length=510

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIAAFCSSDEELEDHKALLYLPIAP  406



>ref|XP_003447710.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Oreochromis 
niloticus]
 ref|XP_004547442.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Maylandia 
zebra]
 ref|XP_006783029.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Neolamprologus 
brichardi]
Length=510

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIAAFCSSDEELEDHKALLYLPIAP  406



>ref|XP_008297322.1| PREDICTED: retinoblastoma-binding protein 5 [Stegastes partitus]
Length=564

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_006783028.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Neolamprologus 
brichardi]
Length=569

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIAAFCSSDEELEDHKALLYLPIAP  406



>ref|XP_004547441.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Maylandia 
zebra]
 ref|XP_005469750.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Oreochromis 
niloticus]
Length=570

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIAAFCSSDEELEDHKALLYLPIAP  406



>ref|XP_005749525.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Pundamilia 
nyererei]
Length=570

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIAAFCSSDEELEDHKALLYLPIAP  406



>ref|XP_005917850.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Haplochromis 
burtoni]
Length=571

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIAAFCSSDEELEDHKALLYLPIAP  406



>ref|XP_010743860.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Larimichthys 
crocea]
Length=510

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_011471087.1| PREDICTED: retinoblastoma-binding protein 5 [Oryzias latipes]
Length=501

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEEMEDCKALLYLPIAP  406



>ref|XP_005112725.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Aplysia 
californica]
Length=557

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 7/92 (8%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDL---VPETEKAKEPDVNEDEE  634
            +GL  IWA++  ENWSAFAPDFKEL+EN EY ERE EFDL     E E++K P V ED E
Sbjct  314  SGLVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDLEDEDKEKEESKAP-VEEDVE  372

Query  633  VDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            VD+ T+E    F  S+  +E+   +LFLPV P
Sbjct  373  VDVSTIEPIQAFVSSDEDEEDANALLFLPVSP  404



>ref|XP_005894730.1| PREDICTED: retinoblastoma-binding protein 5-like [Bos mutus]
Length=328

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  143  SGVVSIWAQNQVENWSAFAPDFKELDENIEYEERESEFDI--EDEDKSEPEQTGADAAED  200

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  201  EEVDVTSVDPIVAFCSSDEELEDSKALLYLPIAP  234



>ref|XP_005112727.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X3 [Aplysia 
californica]
Length=534

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 85/159 (53%), Gaps = 24/159 (15%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDL---VPETEKAKEPDVNEDEE  634
            +GL  IWA++  ENWSAFAPDFKEL+EN EY ERE EFDL     E E++K P V ED E
Sbjct  314  SGLVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDLEDEDKEKEESKAP-VEEDVE  372

Query  633  VDIVTVEKDTTFSDSEMSQEE---ILFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPH  463
            VD+ T+E    F  S+  +E+   +LFLPV P  +  E            G   ++G  H
Sbjct  373  VDVSTIEPIQAFVSSDEDEEDANALLFLPVSPEVEEPED-----------GWQGENGEDH  421

Query  462  SEEAEQNGQTTNHESSPVEAIDNSAAEDTSAKRLRRKRK  346
            +   E+   T      P   ++    +DTS+   RR ++
Sbjct  422  AVHTEKKKDT------PSSGVEKRTRQDTSSSDRRRGQQ  454



>ref|XP_008318918.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Cynoglossus 
semilaevis]
Length=511

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGGDAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_008318917.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Cynoglossus 
semilaevis]
Length=561

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGGDAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ TV+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTTVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_006711540.1| PREDICTED: retinoblastoma-binding protein 5 isoform X5 [Homo 
sapiens]
Length=297

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  74   SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  131

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  132  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  165



>emb|CEG72737.1| hypothetical protein RMATCC62417_08238 [Rhizopus microsporus]
 emb|CEI89400.1| hypothetical protein RMCBS344292_03761 [Rhizopus microsporus]
Length=453

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = -2

Query  801  GLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIV  622
            G  YIWA  + ENWSAFAPDF EL+EN EY E+EDEFD++P+ EK K+  V+ED  VD+ 
Sbjct  319  GNIYIWATKHQENWSAFAPDFIELQENVEYEEQEDEFDVMPDAEKTKQKQVDEDVIVDVT  378

Query  621  TVEKDTTF--SDSEMSQEEILFLPVDPIPD  538
            T +    F  S  E  ++E+L+LP  P  D
Sbjct  379  TCDTIQAFIESSDEEDEDEVLYLPNLPFED  408



>emb|CEJ02518.1| hypothetical protein RMCBS344292_16519 [Rhizopus microsporus]
Length=453

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = -2

Query  801  GLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEPDVNEDEEVDIV  622
            G  YIWA  + ENWSAFAPDF EL+EN EY E+EDEFD++P+ EK K+  V+ED  VD+ 
Sbjct  319  GNIYIWATKHQENWSAFAPDFIELQENVEYEEQEDEFDVMPDAEKTKQKQVDEDVIVDVT  378

Query  621  TVEKDTTF--SDSEMSQEEILFLPVDPIPD  538
            T +    F  S  E  ++E+L+LP  P  D
Sbjct  379  TCDTIQAFIESSDEEEEDEVLYLPNLPFED  408



>ref|XP_008697752.1| PREDICTED: retinoblastoma-binding protein 5 isoform X6 [Ursus 
maritimus]
Length=411

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_006628495.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X1 [Lepisosteus 
oculatus]
Length=539

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_004425182.1| PREDICTED: retinoblastoma-binding protein 5 isoform 3 [Ceratotherium 
simum simum]
Length=410

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_006628496.1| PREDICTED: retinoblastoma-binding protein 5-like isoform X2 [Lepisosteus 
oculatus]
Length=513

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIVAFCSSDEELEDYKALLYLPIAP  406



>ref|XP_009271059.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Aptenodytes 
forsteri]
 ref|XP_009325637.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Pygoscelis 
adeliae]
 ref|XP_009943306.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Opisthocomus 
hoazin]
 ref|XP_009990233.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Tauraco 
erythrolophus]
 ref|XP_009971460.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Tyto 
alba]
Length=412

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 28/150 (19%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPV------------DPIPDHLEQQ--DKCV  511
            EEVD+ +V+    F  S+   E+   +L+LP+             P PD ++    D+ +
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQSSLTDEGI  305

Query  510  GSTSKLGDSNQSGSPHSEEAEQNGQTTNHE  421
            GS  K     QS S   +  ++  +TTN E
Sbjct  306  GSEKK----RQSSSDGPQAPKKKPKTTNIE  331



>ref|XP_008642959.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Corvus 
brachyrhynchos]
Length=412

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_004610136.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Sorex 
araneus]
 ref|XP_004685601.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Condylura 
cristata]
 ref|XP_007523199.1| PREDICTED: retinoblastoma-binding protein 5 [Erinaceus europaeus]
Length=410

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_004392878.1| PREDICTED: retinoblastoma-binding protein 5 isoform 2 [Odobenus 
rosmarus divergens]
Length=410

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_009708190.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Cariama 
cristata]
Length=412

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 28/150 (19%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPV------------DPIPDHLEQQ--DKCV  511
            EEVD+ +V+    F  S+   E+   +L+LP+             P PD ++    D+ +
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQSSLTDEGI  305

Query  510  GSTSKLGDSNQSGSPHSEEAEQNGQTTNHE  421
            GS  K     QS S   +  ++  +TTN E
Sbjct  306  GSEKK----RQSSSDGPQAPKKKPKTTNIE  331



>ref|NP_001180202.1| retinoblastoma-binding protein 5 isoform 3 [Homo sapiens]
 ref|XP_003273214.1| PREDICTED: retinoblastoma-binding protein 5 isoform 3 [Nomascus 
leucogenys]
 ref|XP_004375293.1| PREDICTED: retinoblastoma-binding protein 5 isoform 3 [Trichechus 
manatus latirostris]
 ref|XP_005962700.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Pantholops 
hodgsonii]
 ref|XP_006182352.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Camelus 
ferus]
 ref|XP_006215551.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Vicugna 
pacos]
 ref|XP_011845817.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Mandrillus 
leucophaeus]
 ref|XP_011813147.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Colobus 
angolensis palliatus]
Length=410

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_010879199.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Esox 
lucius]
Length=513

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIVAFCSSDEELEDFKALLYLPIAP  406



>ref|XP_008642958.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Corvus 
brachyrhynchos]
Length=411

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_008697751.1| PREDICTED: retinoblastoma-binding protein 5 isoform X5 [Ursus 
maritimus]
Length=423

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  200  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  257

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  258  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  291



>ref|XP_010122765.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Chlamydotis 
macqueenii]
Length=412

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 28/150 (19%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPV------------DPIPDHLEQQ--DKCV  511
            EEVD+ +V+    F  S+   E+   +L+LP+             P PD ++    D+ +
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQSSLTDEGI  305

Query  510  GSTSKLGDSNQSGSPHSEEAEQNGQTTNHE  421
            GS  K     QS S   +  ++  +TTN E
Sbjct  306  GSEKK----RQSSSDGPQAPKKKPKTTNVE  331



>ref|XP_008152431.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Eptesicus 
fuscus]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_011221931.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Ailuropoda 
melanoleuca]
Length=411

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_004641172.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Octodon 
degus]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_004282502.1| PREDICTED: retinoblastoma-binding protein 5 isoform 3 [Orcinus 
orca]
 ref|XP_004332411.1| PREDICTED: LOW QUALITY PROTEIN: retinoblastoma binding protein 
5 [Tursiops truncatus]
 ref|XP_007470741.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Lipotes 
vexillifer]
 ref|XP_007951688.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Orycteropus 
afer afer]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_008936958.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Merops 
nubicus]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_004578776.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Ochotona 
princeps]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_010122773.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Chlamydotis 
macqueenii]
Length=411

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 28/150 (19%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPV------------DPIPDHLEQQ--DKCV  511
            EEVD+ +V+    F  S+   E+   +L+LP+             P PD ++    D+ +
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQSSLTDEGI  305

Query  510  GSTSKLGDSNQSGSPHSEEAEQNGQTTNHE  421
            GS  K     QS S   +  ++  +TTN E
Sbjct  306  GSEKK----RQSSSDGPQAPKKKPKTTNVE  331



>ref|XP_009325638.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Pygoscelis 
adeliae]
 ref|XP_009943307.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Opisthocomus 
hoazin]
 ref|XP_009990234.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Tauraco 
erythrolophus]
 ref|XP_009971461.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Tyto 
alba]
Length=411

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 28/150 (19%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPV------------DPIPDHLEQQ--DKCV  511
            EEVD+ +V+    F  S+   E+   +L+LP+             P PD ++    D+ +
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPPDAVQSSLTDEGI  305

Query  510  GSTSKLGDSNQSGSPHSEEAEQNGQTTNHE  421
            GS  K     QS S   +  ++  +TTN E
Sbjct  306  GSEKK----RQSSSDGPQAPKKKPKTTNIE  331



>ref|XP_010007517.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Nestor 
notabilis]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_005140905.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Melopsittacus 
undulatus]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>gb|AAH57632.1| Rbbp5 protein [Mus musculus]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>gb|EFX77720.1| hypothetical protein DAPPUDRAFT_321168 [Daphnia pulex]
Length=503

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 75/125 (60%), Gaps = 8/125 (6%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKA--KEPDVNEDEEV  631
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFDL  E +     E +V +D EV
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDLGDEDKSVTQNEREVEDDLEV  374

Query  630  DIVTVEKDTTF--SDSEMSQEEI-LFLPVDPIPDHLEQQDKCVGSTSKLGDSNQSGSPHS  460
            D+ TV+  + +  SD E   E+I L+LP+ P    +E+ +      ++L D   SG+  S
Sbjct  375  DVTTVQPISAYYSSDEEKDDEDILLYLPIAP---EVEEPEDGWNPAAELEDGTTSGTKRS  431

Query  459  EEAEQ  445
               +Q
Sbjct  432  SHQDQ  436



>ref|XP_006834151.1| PREDICTED: retinoblastoma-binding protein 5 [Chrysochloris asiatica]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_004663611.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Jaculus 
jaculus]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_010879198.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Esox 
lucius]
Length=557

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIVAFCSSDEELEDFKALLYLPIAP  406



>ref|XP_005140904.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Melopsittacus 
undulatus]
Length=412

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_008936957.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Merops 
nubicus]
Length=412

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_008697750.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Ursus 
maritimus]
Length=433

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  210  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  267

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  268  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  301



>ref|XP_010221672.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Tinamus 
guttatus]
Length=412

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_010007515.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Nestor 
notabilis]
Length=412

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_005901478.1| PREDICTED: retinoblastoma-binding protein 5 [Bos mutus]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENIEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_010221673.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Tinamus 
guttatus]
Length=411

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_010007516.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Nestor 
notabilis]
Length=411

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_008563508.1| PREDICTED: retinoblastoma-binding protein 5-like, partial [Galeopterus 
variegatus]
Length=291

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  141  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  198

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  199  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  232



>ref|XP_010122781.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Chlamydotis 
macqueenii]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_005329571.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Ictidomys 
tridecemlineatus]
Length=410

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_009943308.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Opisthocomus 
hoazin]
 ref|XP_009990235.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Tauraco 
erythrolophus]
 ref|XP_009971462.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Tyto 
alba]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>gb|KFO55035.1| Retinoblastoma-binding protein 5, partial [Corvus brachyrhynchos]
Length=463

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  249  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  306

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  307  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  340



>ref|XP_010221674.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Tinamus 
guttatus]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>ref|XP_008642960.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Corvus 
brachyrhynchos]
Length=373

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>gb|KFQ41668.1| Retinoblastoma-binding protein 5, partial [Nestor notabilis]
Length=460

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  245  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  302

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  303  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  336



>ref|XP_006529421.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Mus musculus]
Length=499

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  276  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  333

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  334  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  367



>ref|XP_007422783.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Python 
bivittatus]
Length=412

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>emb|CDQ60421.1| unnamed protein product [Oncorhynchus mykiss]
Length=513

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  316  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  373

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  374  EEVDVTSVDPIVAFCSSDEELEDFKALLYLPIAP  407



>gb|EDL39675.1| retinoblastoma binding protein 5, isoform CRA_a, partial [Mus 
musculus]
Length=452

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  267  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  324

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  325  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  358



>ref|XP_005529368.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Pseudopodoces 
humilis]
Length=411

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSRALLYLPIAP  279



>gb|KFV06603.1| Retinoblastoma-binding protein 5, partial [Tauraco erythrolophus]
Length=457

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  242  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  299

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  300  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  333



>gb|KFR03785.1| Retinoblastoma-binding protein 5, partial [Opisthocomus hoazin]
 gb|KFW69466.1| Retinoblastoma-binding protein 5, partial [Pygoscelis adeliae]
Length=457

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  242  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  299

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  300  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  333



>gb|KFQ28221.1| Retinoblastoma-binding protein 5, partial [Merops nubicus]
Length=457

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  242  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  299

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  300  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  333



>gb|KGL83265.1| Retinoblastoma-binding protein 5, partial [Tinamus guttatus]
Length=460

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  246  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  303

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  304  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  337



>gb|KFP34785.1| Retinoblastoma-binding protein 5, partial [Chlamydotis macqueenii]
Length=492

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  277  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  334

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  335  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  368



>ref|XP_007182855.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Balaenoptera 
acutorostrata scammoni]
Length=474

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  251  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  308

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  309  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  342



>ref|XP_005667584.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Sus scrofa]
Length=471

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  248  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  305

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  306  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  339



>ref|XP_007897648.1| PREDICTED: retinoblastoma-binding protein 5 [Callorhinchus milii]
Length=499

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEEFEDCKALLYLPISP  406



>gb|ELK37228.1| Retinoblastoma-binding protein 5 [Myotis davidii]
Length=589

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  330  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  387

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  388  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  421



>dbj|BAG59520.1| unnamed protein product [Homo sapiens]
Length=410

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  188  SGVISIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  245

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  246  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  279



>gb|KFU89506.1| Retinoblastoma-binding protein 5, partial [Chaetura pelagica]
Length=516

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  301  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  358

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  359  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  392



>ref|XP_006737109.1| PREDICTED: retinoblastoma-binding protein 5 [Leptonychotes weddellii]
Length=485

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  262  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  319

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  320  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  353



>emb|CAA59446.1| RB protein binding protein [Homo sapiens]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 59/94 (63%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE  FD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESGFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_006988867.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>gb|KFV71163.1| Retinoblastoma-binding protein 5, partial [Picoides pubescens]
Length=523

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  308  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  365

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  366  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  399



>ref|XP_009995810.1| PREDICTED: retinoblastoma-binding protein 5 [Chaetura pelagica]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_008697748.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Ursus 
maritimus]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_004425180.1| PREDICTED: retinoblastoma-binding protein 5 isoform 1 [Ceratotherium 
simum simum]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|NP_766105.2| retinoblastoma-binding protein 5 [Mus musculus]
 sp|Q8BX09.2|RBBP5_MOUSE RecName: Full=Retinoblastoma-binding protein 5; Short=RBBP-5 
[Mus musculus]
 dbj|BAE32825.1| unnamed protein product [Mus musculus]
 gb|EDL39676.1| retinoblastoma binding protein 5, isoform CRA_b [Mus musculus]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|NP_001126360.1| retinoblastoma-binding protein 5 [Pongo abelii]
 emb|CAH92319.1| hypothetical protein [Pongo abelii]
Length=405

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  182  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEEREPEFDI--EDEDKSEPEQTGADAAED  239

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  240  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  273



>ref|XP_010347263.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=512

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_011221929.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Ailuropoda 
melanoleuca]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>gb|EFB17067.1| hypothetical protein PANDA_006675, partial [Ailuropoda melanoleuca]
Length=526

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  300  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  357

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  358  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  391



>gb|KFP28108.1| Retinoblastoma-binding protein 5, partial [Colius striatus]
Length=516

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  301  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  358

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  359  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  392



>gb|EHH15635.1| hypothetical protein EGK_01750, partial [Macaca mulatta]
 gb|EHH64549.1| hypothetical protein EGM_17794, partial [Macaca fascicularis]
Length=534

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  311  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  368

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  369  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  402



>ref|XP_009903839.1| PREDICTED: retinoblastoma-binding protein 5 [Picoides pubescens]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_009566424.1| PREDICTED: retinoblastoma-binding protein 5 [Cuculus canorus]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_848552.1| PREDICTED: retinoblastoma-binding protein 5 isoformX2 [Canis 
lupus familiaris]
 ref|XP_004756479.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Mustela 
putorius furo]
 ref|XP_004788402.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Mustela 
putorius furo]
 ref|XP_008697747.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Ursus 
maritimus]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_005885325.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Myotis 
brandtii]
 ref|XP_006094887.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Myotis 
lucifugus]
 ref|XP_006754467.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Myotis 
davidii]
 ref|XP_008152429.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Eptesicus 
fuscus]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_005375402.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Chinchilla 
lanigera]
Length=533

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  310  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  367

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  368  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  401



>ref|XP_006062333.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Bubalus 
bubalis]
 ref|XP_010347262.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_011991077.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Ovis 
aries musimon]
 gb|EAW91536.1| retinoblastoma binding protein 5, isoform CRA_a [Homo sapiens]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_006159302.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Tupaia 
chinensis]
 ref|XP_010588553.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Loxodonta 
africana]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_004610134.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Sorex 
araneus]
 ref|XP_004685599.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Condylura 
cristata]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_004392877.1| PREDICTED: retinoblastoma-binding protein 5 isoform 1 [Odobenus 
rosmarus divergens]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_007130873.1| PREDICTED: retinoblastoma-binding protein 5 isoform X3 [Physeter 
catodon]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_002918261.2| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Ailuropoda 
melanoleuca]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_002717493.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Oryctolagus 
cuniculus]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_008974819.1| PREDICTED: retinoblastoma-binding protein 5 isoform X4 [Pan paniscus]
Length=517

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|XP_010139883.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Buceros 
rhinoceros silvestris]
Length=513

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  290  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  347

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  348  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  381



>ref|XP_005375399.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Chinchilla 
lanigera]
Length=549

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>ref|NP_005048.2| retinoblastoma-binding protein 5 isoform 1 [Homo sapiens]
 ref|NP_001076871.1| retinoblastoma-binding protein 5 [Bos taurus]
 ref|XP_002760751.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Callithrix 
jacchus]
 ref|XP_003273212.1| PREDICTED: retinoblastoma-binding protein 5 isoform 1 [Nomascus 
leucogenys]
 ref|XP_003482703.1| PREDICTED: retinoblastoma-binding protein 5 isoformX2 [Sus scrofa]
 ref|XP_003823005.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Pan paniscus]
 ref|XP_003893283.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Papio 
anubis]
 ref|XP_003999456.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Felis 
catus]
 ref|XP_004028289.1| PREDICTED: retinoblastoma-binding protein 5 [Gorilla gorilla 
gorilla]
 ref|XP_004375291.1| PREDICTED: retinoblastoma-binding protein 5 isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_005540631.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Macaca 
fascicularis]
 ref|XP_005690451.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Capra 
hircus]
 ref|XP_005962698.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Pantholops 
hodgsonii]
 ref|XP_006182350.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Camelus 
ferus]
 ref|XP_006215549.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Vicugna 
pacos]
 ref|XP_007086599.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Panthera 
tigris altaica]
 ref|XP_006062331.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Bubalus 
bubalis]
 ref|XP_007986952.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_008072866.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Tarsius 
syrichta]
 ref|XP_009237062.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Pongo 
abelii]
 ref|XP_010363732.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010852466.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Bison 
bison bison]
 ref|XP_010967604.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Camelus 
bactrianus]
 ref|XP_010989676.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Camelus 
dromedarius]
 ref|XP_011371304.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Pteropus 
vampyrus]
 ref|XP_011845815.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Mandrillus 
leucophaeus]
 ref|XP_011813144.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Colobus 
angolensis palliatus]
 ref|XP_011745107.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Macaca 
nemestrina]
 ref|XP_011991075.1| PREDICTED: retinoblastoma-binding protein 5 isoform X2 [Ovis 
aries musimon]
 sp|Q15291.2|RBBP5_HUMAN RecName: Full=Retinoblastoma-binding protein 5; Short=RBBP-5; 
AltName: Full=Retinoblastoma-binding protein RBQ-3 [Homo sapiens]
 gb|AAH53856.1| Retinoblastoma binding protein 5 [Homo sapiens]
 gb|AAH75059.1| Retinoblastoma binding protein 5 [Homo sapiens]
 gb|AAH75060.1| Retinoblastoma binding protein 5 [Homo sapiens]
 gb|EAW91537.1| retinoblastoma binding protein 5, isoform CRA_b [Homo sapiens]
 gb|EAW91539.1| retinoblastoma binding protein 5, isoform CRA_b [Homo sapiens]
 gb|AAI14754.1| RBBP5 protein [Bos taurus]
 tpg|DAA21492.1| TPA: retinoblastoma binding protein 5 [Bos taurus]
 gb|AIC55023.1| RBBP5, partial [synthetic construct]
Length=538

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



>gb|KFO93126.1| Retinoblastoma-binding protein 5, partial [Buceros rhinoceros 
silvestris]
Length=517

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  302  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  359

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  360  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  393



>ref|XP_009477547.1| PREDICTED: retinoblastoma-binding protein 5, partial [Pelecanus 
crispus]
Length=528

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  302  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  359

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  360  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  393



>ref|XP_004788401.1| PREDICTED: retinoblastoma-binding protein 5 isoform X1 [Mustela 
putorius furo]
Length=552

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 10/94 (11%)
 Frame = -2

Query  804  TGLAYIWAKDYTENWSAFAPDFKeleeneeyveredEFDLVPETEKAKEP-----DVNED  640
            +G+  IWA++  ENWSAFAPDFKEL+EN EY ERE EFD+  E E   EP     D  ED
Sbjct  315  SGVVSIWAQNQVENWSAFAPDFKELDENVEYEERESEFDI--EDEDKSEPEQTGADAAED  372

Query  639  EEVDIVTVEKDTTFSDSEMSQEE---ILFLPVDP  547
            EEVD+ +V+    F  S+   E+   +L+LP+ P
Sbjct  373  EEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAP  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688