BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8206

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU28752.1|  hypothetical protein MIMGU_mgv1a016482mg                194   3e-59   Erythranthe guttata [common monkey flower]
gb|EYU28751.1|  hypothetical protein MIMGU_mgv1a016464mg                194   3e-59   Erythranthe guttata [common monkey flower]
gb|EYU22419.1|  hypothetical protein MIMGU_mgv1a016469mg                194   4e-59   Erythranthe guttata [common monkey flower]
ref|XP_011070999.1|  PREDICTED: 60S ribosomal protein L34               193   5e-59   Sesamum indicum [beniseed]
ref|XP_012084696.1|  PREDICTED: 60S ribosomal protein L34               192   1e-58   Jatropha curcas
ref|XP_012080264.1|  PREDICTED: 60S ribosomal protein L34-like          192   1e-58   Jatropha curcas
ref|XP_010044743.1|  PREDICTED: 60S ribosomal protein L34               192   2e-58   Eucalyptus grandis [rose gum]
ref|XP_007139581.1|  hypothetical protein PHAVU_008G041700g             192   2e-58   Phaseolus vulgaris [French bean]
gb|ADR71242.1|  60S ribosomal protein L34B                              192   2e-58   Hevea brasiliensis [jebe]
ref|XP_010044733.1|  PREDICTED: 60S ribosomal protein L34-like          192   2e-58   Eucalyptus grandis [rose gum]
ref|XP_002522429.1|  60S ribosomal protein L34, putative                191   3e-58   Ricinus communis
ref|XP_012067636.1|  PREDICTED: 60S ribosomal protein L34               191   4e-58   Jatropha curcas
ref|XP_009376266.1|  PREDICTED: 60S ribosomal protein L34               191   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_009591909.1|  PREDICTED: 60S ribosomal protein L34-like          191   6e-58   Nicotiana tomentosiformis
gb|ADR71241.1|  60S ribosomal protein L34A                              191   6e-58   Hevea brasiliensis [jebe]
gb|EYU34076.1|  hypothetical protein MIMGU_mgv1a016461mg                191   6e-58   Erythranthe guttata [common monkey flower]
ref|XP_008341572.1|  PREDICTED: 60S ribosomal protein L34-like          191   7e-58   Malus domestica [apple tree]
ref|XP_010066914.1|  PREDICTED: 60S ribosomal protein L34-like          191   7e-58   Eucalyptus grandis [rose gum]
ref|XP_010096548.1|  60S ribosomal protein L34                          190   9e-58   Morus notabilis
ref|XP_002324052.1|  ribosomal protein L34                              190   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011040278.1|  PREDICTED: 60S ribosomal protein L34-like          190   1e-57   Populus euphratica
ref|XP_002534058.1|  60S ribosomal protein L34, putative                190   1e-57   Ricinus communis
gb|EPS67435.1|  hypothetical protein M569_07339                         190   1e-57   Genlisea aurea
gb|EPS63651.1|  hypothetical protein M569_11133                         190   1e-57   Genlisea aurea
ref|XP_002318779.1|  ribosomal protein L34                              190   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010105633.1|  60S ribosomal protein L34                          190   1e-57   Morus notabilis
ref|XP_007209770.1|  hypothetical protein PRUPE_ppa013459mg             190   1e-57   Prunus persica
ref|XP_006374574.1|  hypothetical protein POPTR_0015s11780g             190   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004299366.1|  PREDICTED: 60S ribosomal protein L34               190   2e-57   Fragaria vesca subsp. vesca
ref|XP_004241579.1|  PREDICTED: 60S ribosomal protein L34               189   2e-57   Solanum lycopersicum
ref|XP_006354783.1|  PREDICTED: 60S ribosomal protein L34-like          189   2e-57   Solanum tuberosum [potatoes]
ref|NP_001236831.1|  uncharacterized protein LOC100305798               189   2e-57   Glycine max [soybeans]
ref|XP_004147322.1|  PREDICTED: 60S ribosomal protein L34               189   3e-57   Cucumis sativus [cucumbers]
ref|XP_010527899.1|  PREDICTED: 60S ribosomal protein L34-like          189   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_004138175.2|  PREDICTED: 60S ribosomal protein L34               189   3e-57   Cucumis sativus [cucumbers]
gb|AFK36300.1|  unknown                                                 189   3e-57   Lotus japonicus
ref|XP_004490057.1|  PREDICTED: 60S ribosomal protein L34-like          189   3e-57   Cicer arietinum [garbanzo]
ref|XP_004509966.1|  PREDICTED: 60S ribosomal protein L34-like          189   4e-57   Cicer arietinum [garbanzo]
ref|XP_007217809.1|  hypothetical protein PRUPE_ppb011184mg             189   4e-57   Prunus persica
ref|XP_004491784.1|  PREDICTED: 60S ribosomal protein L34-like          189   4e-57   Cicer arietinum [garbanzo]
ref|XP_008379348.1|  PREDICTED: 60S ribosomal protein L34               189   4e-57   
sp|P40590.1|RL34_PEA  RecName: Full=60S ribosomal protein L34           189   4e-57   Pisum sativum [garden pea]
ref|XP_006439596.1|  hypothetical protein CICLE_v10022900mg             189   4e-57   Citrus clementina [clementine]
ref|XP_008393151.1|  PREDICTED: 60S ribosomal protein L34-like          189   5e-57   Malus domestica [apple tree]
ref|XP_006431140.1|  hypothetical protein CICLE_v10013131mg             189   5e-57   Citrus clementina [clementine]
ref|XP_009600693.1|  PREDICTED: 60S ribosomal protein L34-like          188   5e-57   Nicotiana tomentosiformis
ref|XP_004238799.1|  PREDICTED: 60S ribosomal protein L34               188   7e-57   Solanum lycopersicum
ref|XP_010693235.1|  PREDICTED: 60S ribosomal protein L34               188   8e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004138165.2|  PREDICTED: 60S ribosomal protein L34-like          188   8e-57   Cucumis sativus [cucumbers]
gb|AFK47541.1|  unknown                                                 188   9e-57   Lotus japonicus
ref|XP_010091511.1|  60S ribosomal protein L34                          187   1e-56   Morus notabilis
emb|CDP00331.1|  unnamed protein product                                187   1e-56   Coffea canephora [robusta coffee]
ref|XP_003518726.1|  PREDICTED: 60S ribosomal protein L34-like          187   1e-56   
ref|XP_007037334.1|  Ribosomal protein L34e superfamily protein         187   2e-56   
ref|XP_008339902.1|  PREDICTED: 60S ribosomal protein L34               187   2e-56   Malus domestica [apple tree]
ref|XP_008389476.1|  PREDICTED: 60S ribosomal protein L34-like          187   2e-56   Malus domestica [apple tree]
ref|XP_007157628.1|  hypothetical protein PHAVU_002G085600g             187   2e-56   Phaseolus vulgaris [French bean]
ref|XP_002273676.1|  PREDICTED: 60S ribosomal protein L34               187   2e-56   Vitis vinifera
ref|XP_011005519.1|  PREDICTED: 60S ribosomal protein L34-like          187   2e-56   Populus euphratica
ref|XP_007227514.1|  hypothetical protein PRUPE_ppa013472mg             187   2e-56   Prunus persica
ref|XP_007046106.1|  Ribosomal protein L34e superfamily protein         187   2e-56   Theobroma cacao [chocolate]
ref|XP_009785300.1|  PREDICTED: 60S ribosomal protein L34-like          187   3e-56   Nicotiana sylvestris
ref|XP_009602105.1|  PREDICTED: 60S ribosomal protein L34               187   3e-56   Nicotiana tomentosiformis
ref|XP_006482587.1|  PREDICTED: 60S ribosomal protein L34-like          187   3e-56   Citrus sinensis [apfelsine]
ref|XP_006438683.1|  hypothetical protein CICLE_v10033093mg             187   3e-56   Citrus clementina [clementine]
ref|XP_010683191.1|  PREDICTED: 60S ribosomal protein L34               186   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004232223.1|  PREDICTED: 60S ribosomal protein L34               186   3e-56   Solanum lycopersicum
ref|XP_010551541.1|  PREDICTED: 60S ribosomal protein L34-1             186   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_006338455.1|  PREDICTED: 60S ribosomal protein L34-like          186   3e-56   Solanum tuberosum [potatoes]
ref|XP_003613762.1|  60S ribosomal protein L34                          186   3e-56   Medicago truncatula
ref|XP_003621181.1|  60S ribosomal protein L34                          186   4e-56   Medicago truncatula
ref|XP_011098620.1|  PREDICTED: 60S ribosomal protein L34-like          186   4e-56   Sesamum indicum [beniseed]
ref|XP_010552577.1|  PREDICTED: 60S ribosomal protein L34-1-like        186   4e-56   Tarenaya hassleriana [spider flower]
emb|CDP02228.1|  unnamed protein product                                186   5e-56   Coffea canephora [robusta coffee]
gb|ACJ84129.1|  unknown                                                 186   6e-56   Medicago truncatula
ref|XP_006366104.1|  PREDICTED: 60S ribosomal protein L34-like          186   7e-56   Solanum tuberosum [potatoes]
ref|NP_001238172.1|  uncharacterized protein LOC100499931               185   8e-56   Glycine max [soybeans]
gb|KFK44595.1|  hypothetical protein AALP_AA1G279200                    185   8e-56   Arabis alpina [alpine rockcress]
gb|KHG15025.1|  60S ribosomal L34-1 -like protein                       185   8e-56   Gossypium arboreum [tree cotton]
ref|XP_009771519.1|  PREDICTED: 60S ribosomal protein L34-like          185   8e-56   Nicotiana sylvestris
gb|KHN06860.1|  60S ribosomal protein L34                               185   9e-56   Glycine soja [wild soybean]
ref|XP_007032522.1|  Ribosomal protein L34e superfamily protein         185   9e-56   
ref|XP_010678528.1|  PREDICTED: 60S ribosomal protein L34-like          185   9e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB50912.1|  hypothetical protein B456_008G192800                    185   1e-55   Gossypium raimondii
gb|KJB50656.1|  hypothetical protein B456_008G181200                    185   1e-55   Gossypium raimondii
gb|KJB33557.1|  hypothetical protein B456_006G017600                    185   1e-55   Gossypium raimondii
ref|XP_004297304.1|  PREDICTED: 60S ribosomal protein L34-1             185   1e-55   Fragaria vesca subsp. vesca
ref|XP_002462376.1|  hypothetical protein SORBIDRAFT_02g024610          185   1e-55   Sorghum bicolor [broomcorn]
gb|EAZ09088.1|  hypothetical protein OsI_31355                          185   1e-55   Oryza sativa Indica Group [Indian rice]
gb|KHF99375.1|  60S ribosomal L34-1 -like protein                       185   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010532818.1|  PREDICTED: 60S ribosomal protein L34               185   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_010528334.1|  PREDICTED: 60S ribosomal protein L34-1             184   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_004956809.1|  PREDICTED: 60S ribosomal protein L34-like is...    184   2e-55   Setaria italica
ref|XP_010258364.1|  PREDICTED: 60S ribosomal protein L34               184   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008784145.1|  PREDICTED: 60S ribosomal protein L34               184   2e-55   Phoenix dactylifera
ref|NP_174010.1|  60S ribosomal protein L34-1                           184   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ83310.1|  unknown                                                 184   3e-55   Medicago truncatula
ref|XP_011085759.1|  PREDICTED: 60S ribosomal protein L34-like          184   3e-55   Sesamum indicum [beniseed]
ref|XP_008802610.1|  PREDICTED: 60S ribosomal protein L34               184   3e-55   Phoenix dactylifera
ref|XP_002445552.1|  hypothetical protein SORBIDRAFT_07g021410          184   3e-55   Sorghum bicolor [broomcorn]
ref|XP_010257345.1|  PREDICTED: 60S ribosomal protein L34-like          184   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006303006.1|  hypothetical protein CARUB_v10021161mg             184   4e-55   Capsella rubella
gb|KJB75747.1|  hypothetical protein B456_012G054700                    184   4e-55   Gossypium raimondii
gb|KFK41386.1|  hypothetical protein AALP_AA2G123500                    184   4e-55   Arabis alpina [alpine rockcress]
ref|NP_001132454.1|  60S ribosomal protein L34                          183   5e-55   Zea mays [maize]
ref|XP_002443887.1|  hypothetical protein SORBIDRAFT_07g003770          183   5e-55   Sorghum bicolor [broomcorn]
ref|NP_001061026.1|  Os08g0156800                                       183   6e-55   
ref|NP_001061890.1|  Os08g0436800                                       183   6e-55   
ref|XP_004975852.1|  PREDICTED: 60S ribosomal protein L34-like          183   6e-55   Setaria italica
ref|XP_004973530.1|  PREDICTED: 60S ribosomal protein L34-like          183   6e-55   Setaria italica
gb|AAM66030.1|  60s ribosomal protein L34                               183   7e-55   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33761.1|  hypothetical protein AALP_AA5G056900                    182   1e-54   Arabis alpina [alpine rockcress]
ref|XP_006415975.1|  hypothetical protein EUTSA_v10009127mg             182   1e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001237362.1|  uncharacterized protein LOC100499882               182   1e-54   Glycine max [soybeans]
gb|ACG48574.1|  60S ribosomal protein L34                               182   1e-54   Zea mays [maize]
ref|NP_001152634.1|  60S ribosomal protein L34                          184   1e-54   
ref|XP_002887248.1|  hypothetical protein ARALYDRAFT_894747             182   1e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_006660622.1|  PREDICTED: 60S ribosomal protein L34-like          182   1e-54   Oryza brachyantha
ref|XP_006652368.1|  PREDICTED: 60S ribosomal protein L34-like          182   1e-54   Oryza brachyantha
ref|XP_003573474.1|  PREDICTED: 60S ribosomal protein L34-like          182   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_006827229.1|  PREDICTED: 60S ribosomal protein L34               182   1e-54   Amborella trichopoda
gb|EMS57639.1|  60S ribosomal protein L34                               182   1e-54   Triticum urartu
ref|XP_003573475.1|  PREDICTED: 60S ribosomal protein L34               182   1e-54   Brachypodium distachyon [annual false brome]
ref|NP_001152435.1|  60S ribosomal protein L34                          182   2e-54   Zea mays [maize]
ref|NP_001152744.1|  60S ribosomal protein L34                          182   2e-54   
gb|EPS73949.1|  hypothetical protein M569_00807                         181   2e-54   Genlisea aurea
ref|NP_177120.1|  60S ribosomal protein L34-2                           181   2e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01360.1|  predicted protein                                      181   4e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010460258.1|  PREDICTED: 60S ribosomal protein L34-1-like        181   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006390992.1|  hypothetical protein EUTSA_v10019324mg             181   5e-54   Eutrema salsugineum [saltwater cress]
gb|ACG30531.1|  60S ribosomal protein L34                               181   5e-54   Zea mays [maize]
ref|XP_010937139.1|  PREDICTED: 60S ribosomal protein L34               181   5e-54   Elaeis guineensis
ref|XP_009385532.1|  PREDICTED: 60S ribosomal protein L34-like          181   6e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG45094.1|  60S ribosomal protein L34                               181   7e-54   Zea mays [maize]
ref|XP_010932825.1|  PREDICTED: 60S ribosomal protein L34-like          180   7e-54   Elaeis guineensis
ref|XP_009105516.1|  PREDICTED: 60S ribosomal protein L34-2             180   9e-54   Brassica rapa
emb|CDY68374.1|  BnaCnng58700D                                          180   1e-53   Brassica napus [oilseed rape]
ref|XP_009127750.1|  PREDICTED: 60S ribosomal protein L34-2-like        180   1e-53   Brassica rapa
pdb|3J61|GG  Chain g, Localization Of The Large Subunit Ribosomal...    180   1e-53   Triticum aestivum [Canadian hard winter wheat]
gb|ACG33498.1|  60S ribosomal protein L34                               180   1e-53   Zea mays [maize]
ref|XP_009111611.1|  PREDICTED: 60S ribosomal protein L34-2-like        180   1e-53   Brassica rapa
ref|XP_010235171.1|  PREDICTED: 60S ribosomal protein L34-like          179   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_010939495.1|  PREDICTED: 60S ribosomal protein L34               179   2e-53   Elaeis guineensis
ref|XP_008664659.1|  PREDICTED: 60S ribosomal protein L34               179   2e-53   
gb|KHG05667.1|  60S ribosomal protein L34-1                             179   2e-53   Gossypium arboreum [tree cotton]
ref|XP_009421274.1|  PREDICTED: 60S ribosomal protein L34-like          179   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN13622.1|  60S ribosomal protein L34                               193   3e-53   Glycine soja [wild soybean]
ref|XP_009381424.1|  PREDICTED: 60S ribosomal protein L34-like          179   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413520.1|  PREDICTED: 60S ribosomal protein L34-like          179   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404517.1|  PREDICTED: 60S ribosomal protein L34               179   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006291983.1|  hypothetical protein CARUB_v10018171mg             180   3e-53   
ref|XP_009110049.1|  PREDICTED: 60S ribosomal protein L34-1-like        178   4e-53   Brassica rapa
ref|XP_010514604.1|  PREDICTED: 60S ribosomal protein L34-3             178   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006439595.1|  hypothetical protein CICLE_v10022900mg             177   5e-53   
emb|CDY46432.1|  BnaA08g19980D                                          178   5e-53   Brassica napus [oilseed rape]
gb|AAT38711.2|  60S ribosomal protein L34, putative                     178   5e-53   Solanum demissum
ref|XP_006659440.1|  PREDICTED: 60S ribosomal protein L34-like          178   6e-53   Oryza brachyantha
gb|KHG05666.1|  60S ribosomal protein L34-1                             177   9e-53   Gossypium arboreum [tree cotton]
ref|XP_006395329.1|  hypothetical protein EUTSA_v10005142mg             177   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010523457.1|  PREDICTED: 60S ribosomal protein L34-like          177   1e-52   Tarenaya hassleriana [spider flower]
ref|NP_189532.1|  60S ribosomal protein L34-3                           177   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393697.1|  PREDICTED: 60S ribosomal protein L34-like          177   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009801519.1|  PREDICTED: 60S ribosomal protein L34-like          176   3e-52   Nicotiana sylvestris
gb|ABK21342.1|  unknown                                                 176   3e-52   Picea sitchensis
ref|XP_010502889.1|  PREDICTED: 60S ribosomal protein L34-3-like        176   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009410005.1|  PREDICTED: 60S ribosomal protein L34               176   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB50657.1|  hypothetical protein B456_008G181200                    176   8e-52   Gossypium raimondii
ref|NP_001077600.1|  60S ribosomal protein L34-1                        173   2e-51   
gb|KJB50913.1|  hypothetical protein B456_008G192800                    172   5e-51   Gossypium raimondii
ref|XP_003540043.1|  PREDICTED: 60S ribosomal protein L34-like          172   1e-50   
gb|ABD66516.1|  ribosomal protein                                       172   2e-50   Gymnadenia conopsea
ref|XP_009383241.1|  PREDICTED: 60S ribosomal protein L34-like          171   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW61205.1|  hypothetical protein ZEAMMB73_915933                    169   7e-50   
gb|AFW57302.1|  hypothetical protein ZEAMMB73_857117                    169   8e-50   
gb|AAT08730.1|  ribosomal protein L34                                   168   2e-49   Hyacinthus orientalis [common hyacinth]
gb|EMT23852.1|  60S ribosomal protein L34                               169   2e-49   
gb|EMS56163.1|  60S ribosomal protein L34                               169   3e-49   Triticum urartu
ref|XP_002877140.1|  hypothetical protein ARALYDRAFT_484659             167   8e-49   
ref|XP_006383986.1|  hypothetical protein POPTR_0004s02890g             167   1e-48   
ref|XP_004956808.1|  PREDICTED: 60S ribosomal protein L34-like is...    164   7e-47   
ref|XP_002318778.1|  hypothetical protein POPTR_0012s11010g             160   3e-46   
gb|EMS64887.1|  60S ribosomal protein L34                               161   9e-46   Triticum urartu
ref|XP_001762793.1|  predicted protein                                  157   9e-45   
ref|XP_001751741.1|  predicted protein                                  157   9e-45   
ref|XP_001765474.1|  predicted protein                                  156   2e-44   
ref|XP_010907733.1|  PREDICTED: 60S ribosomal protein L34-like          156   2e-44   Elaeis guineensis
gb|KJB50911.1|  hypothetical protein B456_008G192800                    155   3e-44   Gossypium raimondii
ref|XP_001759832.1|  predicted protein                                  155   6e-44   
ref|XP_001776049.1|  predicted protein                                  154   1e-43   
ref|XP_001759827.1|  predicted protein                                  154   1e-43   
gb|ABA27086.1|  TO121-23                                                148   7e-42   Taraxacum officinale [dandelion]
gb|AAO19740.1|  60S ribosomal protein L34                               144   8e-40   Orobanche cernua var. cumana
ref|XP_011468660.1|  PREDICTED: 60S ribosomal protein L34-like          144   4e-39   Fragaria vesca subsp. vesca
ref|XP_008804557.1|  PREDICTED: 60S ribosomal protein L34-like          138   1e-37   Phoenix dactylifera
gb|AFW62295.1|  hypothetical protein ZEAMMB73_590401                    135   7e-36   
ref|XP_007158654.1|  hypothetical protein PHAVU_002G171200g             132   1e-35   Phaseolus vulgaris [French bean]
ref|XP_006373970.1|  hypothetical protein POPTR_0016s11840g             126   4e-33   
ref|XP_002980840.1|  hypothetical protein SELMODRAFT_113433             124   2e-32   
ref|XP_011398868.1|  60S ribosomal protein L34                          122   2e-31   Auxenochlorella protothecoides
ref|XP_003621256.1|  60S ribosomal protein L34                          118   6e-30   
ref|XP_006361895.1|  PREDICTED: 60S ribosomal protein L34-like          115   5e-29   
ref|XP_005850425.1|  hypothetical protein CHLNCDRAFT_20596              116   2e-28   Chlorella variabilis
gb|ACO14672.1|  60S ribosomal protein L34                               114   2e-28   Caligus clemensi
gb|ACO13005.1|  60S ribosomal protein L34                               113   6e-28   Lepeophtheirus salmonis
ref|XP_001751736.1|  predicted protein                                  112   7e-28   
gb|AFK44937.1|  unknown                                                 113   9e-28   Lotus japonicus
gb|ACO10322.1|  60S ribosomal protein L34                               112   1e-27   Caligus rogercresseyi
ref|XP_005646616.1|  hypothetical protein COCSUDRAFT_16876              111   1e-26   Coccomyxa subellipsoidea C-169
gb|KDO82918.1|  hypothetical protein CISIN_1g0334121mg                  107   2e-26   Citrus sinensis [apfelsine]
gb|KIZ06472.1|  60S ribosomal protein L34                               108   3e-26   Monoraphidium neglectum
gb|EPB80124.1|  ribosomal protein L34e                                  108   5e-26   Ancylostoma ceylanicum
gb|EYC13581.1|  hypothetical protein Y032_0043g796                      108   1e-25   Ancylostoma ceylanicum
gb|EYC13582.1|  hypothetical protein Y032_0043g796                      108   2e-25   Ancylostoma ceylanicum
emb|CDJ80770.1|  Ribosomal protein L34e domain containing protein       106   3e-25   Haemonchus contortus [red stomach worm]
gb|ETN74517.1|  ribosomal protein L34e                                  107   4e-25   Necator americanus
emb|CBY09263.1|  unnamed protein product                                105   5e-25   Oikopleura dioica
emb|CAR63541.1|  putative Ribosomal Protein                             105   5e-25   Angiostrongylus cantonensis
tpg|DAA61430.1|  TPA: hypothetical protein ZEAMMB73_025341              104   6e-25   
gb|KIY98731.1|  hypothetical protein MNEG_9232                          110   8e-25   Monoraphidium neglectum
gb|AFW61204.1|  hypothetical protein ZEAMMB73_915933                    104   1e-24   
gb|ACC77573.1|  ribosomal protein L34                                   104   2e-24   Ceratitis capitata [medfly]
gb|AAY43421.1|  ribosomal protein L34                                   104   2e-24   Phytophthora infestans [potato late blight]
ref|XP_004536191.1|  PREDICTED: 60S ribosomal protein L34-like is...    105   2e-24   Ceratitis capitata [medfly]
gb|EAZ05646.1|  hypothetical protein OsI_27865                          102   3e-24   Oryza sativa Indica Group [Indian rice]
gb|EPX73799.1|  60S ribosomal protein L34                               103   4e-24   Schizosaccharomyces octosporus yFS286
ref|XP_008905063.1|  hypothetical protein PPTG_11487                    103   4e-24   Phytophthora parasitica INRA-310
gb|EPX70997.1|  60S ribosomal protein L34                               103   4e-24   Schizosaccharomyces octosporus yFS286
gb|KFH63161.1|  50S ribosomal protein L34e, variant                     103   4e-24   Mortierella verticillata NRRL 6337
ref|XP_003702766.1|  PREDICTED: 60S ribosomal protein L34-like          102   6e-24   Megachile rotundata
emb|CEP60062.1|  LALA0S01e02168g1_1                                     103   6e-24   Lachancea lanzarotensis
ref|XP_011157318.1|  PREDICTED: 60S ribosomal protein L34-like          102   7e-24   Solenopsis invicta [imported red fire ant]
ref|XP_011269324.1|  PREDICTED: 60S ribosomal protein L34-like          102   7e-24   Camponotus floridanus
ref|XP_011150097.1|  PREDICTED: 60S ribosomal protein L34-like          102   7e-24   Harpegnathos saltator
ref|XP_011050156.1|  PREDICTED: 60S ribosomal protein L34-like          102   8e-24   Acromyrmex echinatior
ref|XP_011344554.1|  PREDICTED: 60S ribosomal protein L34-like          102   8e-24   Ooceraea biroi
ref|XP_003494912.1|  PREDICTED: 60S ribosomal protein L34-like          102   8e-24   
ref|XP_011297499.1|  PREDICTED: 60S ribosomal protein L34-like          102   8e-24   Fopius arisanus
ref|XP_003400365.1|  PREDICTED: 60S ribosomal protein L34-like          102   1e-23   
ref|XP_001121176.1|  PREDICTED: 60S ribosomal protein L34 isoformX1     102   1e-23   Apis mellifera [bee]
ref|XP_003694750.1|  PREDICTED: 60S ribosomal protein L34-like          102   1e-23   Apis florea [dwarf honeybee]
gb|EPY50643.1|  60S ribosomal protein L34                               102   1e-23   Schizosaccharomyces cryophilus OY26
ref|XP_001601949.1|  PREDICTED: 60S ribosomal protein L34-like          102   1e-23   Nasonia vitripennis
ref|XP_011870014.1|  PREDICTED: 60S ribosomal protein L34-like          102   1e-23   Vollenhovia emeryi
ref|XP_011500541.1|  PREDICTED: 60S ribosomal protein L34-like          102   2e-23   Ceratosolen solmsi marchali
ref|XP_459104.1|  60S ribosomal protein L34                             102   2e-23   Debaryomyces hansenii CBS767
ref|XP_011207015.1|  PREDICTED: 60S ribosomal protein L34               102   2e-23   Bactrocera dorsalis [papaya fruit fly]
gb|EPY51448.1|  60S ribosomal protein L34                               101   2e-23   Schizosaccharomyces cryophilus OY26
ref|NP_594438.1|  60S ribosomal protein L34                             101   2e-23   Schizosaccharomyces pombe
ref|XP_007842997.1|  60s ribosomal protein l34-b                        101   2e-23   
gb|KDR24050.1|  60S ribosomal protein L34                               101   2e-23   Zootermopsis nevadensis
ref|XP_002898364.1|  ribosomal protein L34                              101   3e-23   Phytophthora infestans T30-4
ref|XP_011190028.1|  PREDICTED: 60S ribosomal protein L34               102   3e-23   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_007511369.1|  predicted protein                                  102   4e-23   Bathycoccus prasinos
ref|XP_011566007.1|  PREDICTED: 60S ribosomal protein L34-like          101   4e-23   Plutella xylostella [cabbage moth]
ref|XP_009518381.1|  hypothetical protein PHYSODRAFT_310652             100   5e-23   Phytophthora sojae
gb|ADT80682.1|  ribosomal protein L34                                   100   5e-23   Euphydryas aurinia [marsh fritillary]
ref|NP_001093076.1|  ribosomal protein L34                              100   6e-23   Bombyx mori [silk moth]
gb|KGG51330.1|  60S ribosomal protein L34                             99.8    7e-23   Mitosporidium daphniae
ref|XP_309993.2|  AGAP009324-PA                                         100   7e-23   Anopheles gambiae str. PEST
dbj|BAM19023.1|  ribosomal protein L34b                                 100   8e-23   Papilio polytes
gb|AAL62471.1|  ribosomal protein L34                                   100   9e-23   Spodoptera frugiperda
ref|XP_001954320.1|  GF18218                                            101   9e-23   Drosophila ananassae
gb|ACY95368.1|  ribosomal protein L34                                   100   9e-23   Manduca sexta [Carolina sphinx]
gb|AEL28862.1|  ribosomal protein L34                                   100   9e-23   Heliconius melpomene cythera
ref|XP_461331.1|  60S ribosomal protein L34                             100   1e-22   Debaryomyces hansenii CBS767
dbj|BAM17808.1|  ribosomal protein L34b                               99.8    1e-22   Papilio xuthus [Chinese swallowtail]
ref|XP_005186523.1|  PREDICTED: 60S ribosomal protein L34               100   1e-22   Musca domestica
dbj|GAA96860.1|  hypothetical protein E5Q_03533                       99.4    1e-22   Mixia osmundae IAM 14324
ref|XP_008670748.1|  PREDICTED: uncharacterized protein LOC103648026    100   1e-22   Zea mays [maize]
gb|AEE62629.1|  unknown                                               99.4    1e-22   Dendroctonus ponderosae
ref|XP_002173091.1|  60S ribosomal protein L34                        99.4    1e-22   Schizosaccharomyces japonicus yFS275
ref|NP_588143.1|  60S ribosomal protein L34                           99.0    2e-22   Schizosaccharomyces pombe
gb|KHO01151.1|  60S ribosomal protein L34                             99.4    2e-22   Metarhizium album ARSEF 1941
ref|XP_007808009.1|  60S ribosomal protein L34                        99.0    2e-22   Metarhizium acridum CQMa 102
tpg|DAA42039.1|  TPA: hypothetical protein ZEAMMB73_205664            98.2    2e-22   
gb|AAX62460.1|  ribosomal protein L34 isoform A                       99.4    2e-22   Lysiphlebus testaceipes
ref|XP_001697940.1|  ribosomal protein L34, component of cytosoli...  99.0    2e-22   Chlamydomonas reinhardtii
ref|XP_001990635.1|  GH18140                                            100   2e-22   Drosophila grimshawi
ref|XP_002053490.1|  GJ23314                                            100   2e-22   Drosophila virilis
ref|XP_002551639.1|  60S ribosomal protein L34                        99.0    2e-22   
emb|CCI47383.1|  unnamed protein product                              99.0    2e-22   
gb|ELU42944.1|  ribosomal l34e domain-containing protein                101   2e-22   
ref|XP_004995571.1|  60S ribosomal protein L34                        99.4    3e-22   
gb|EUC61523.1|  60S ribosomal protein L34                             98.6    3e-22   
gb|KJK84097.1|  hypothetical protein H634G_00460                      98.6    3e-22   
ref|XP_001999753.1|  GI22901                                          99.8    3e-22   
ref|XP_002074099.1|  GK12799                                            100   3e-22   
gb|ADV03019.1|  ribosomal protein L34                                 99.0    3e-22   
ref|XP_002424339.1|  mitochondrial 50S ribosomal protein L34, put...  99.0    3e-22   
gb|AAX62395.1|  ribosomal protein L34 isoform B                       98.6    3e-22   
gb|KIY53842.1|  putative ribosomal protein L34.e                      98.2    3e-22   
gb|KDR72773.1|  hypothetical protein GALMADRAFT_252028                98.2    4e-22   
ref|XP_002172346.1|  60S ribosomal protein L34                        98.2    4e-22   
ref|XP_001953439.1|  GF17768                                          99.8    4e-22   
ref|XP_002070581.1|  GK12136                                          99.8    4e-22   
gb|KJA21318.1|  hypothetical protein HYPSUDRAFT_42176                 98.2    4e-22   
ref|XP_002764968.1|  60S ribosomal protein L34, putative              98.2    4e-22   
emb|CCA37150.1|  60S ribosomal protein L34-A                          98.2    5e-22   
emb|CCE27558.1|  probable ribosomal protein L34.e                     97.8    5e-22   
ref|XP_003044825.1|  60S ribosomal protein L34                        97.8    6e-22   
gb|KDB16525.1|  60S ribosomal protein L34                             97.8    6e-22   
gb|ACY71288.1|  ribosomal protein L34                                 97.8    7e-22   
gb|KKA64454.1|  ribosomal protein                                     97.4    7e-22   
ref|XP_010759830.1|  60S ribosomal protein L34-A                      97.8    7e-22   
ref|XP_007870671.1|  ribosomal protein L34e                           97.4    7e-22   
emb|CEL53255.1|  60S ribosomal protein L34-A OS=Saccharomyces cer...  99.0    7e-22   
ref|XP_002504814.1|  predicted protein                                97.4    7e-22   
emb|CCO34051.1|  60S ribosomal protein L34-A                          99.0    7e-22   
ref|XP_005707418.1|  60S ribosomal protein L34e                       97.4    8e-22   
ref|XP_001630483.1|  predicted protein                                97.4    8e-22   
ref|XP_001940651.1|  60S ribosomal protein L34                        97.4    8e-22   
ref|XP_637722.1|  S60 ribosomal protein L34                           97.4    1e-21   
gb|KDQ56591.1|  hypothetical protein JAAARDRAFT_36074                 97.1    1e-21   
ref|XP_002045084.1|  GM23916                                          97.4    1e-21   
ref|XP_003855902.1|  60S ribosomal protein L34                        97.1    1e-21   
emb|CDO68605.1|  hypothetical protein BN946_scf184996.g36             97.1    1e-21   
ref|XP_002016888.1|  GL22011                                          98.2    1e-21   
gb|EMS26041.1|  60S ribosomal protein l34                             97.1    1e-21   
ref|XP_002020125.1|  GL13673                                          98.2    1e-21   
ref|XP_006455118.1|  hypothetical protein AGABI2DRAFT_138389          96.7    1e-21   
ref|XP_002949673.1|  component of cytosolic 80S ribosome and 60S ...  96.7    1e-21   
ref|XP_006963707.1|  ribosomal protein L34                            96.7    1e-21   
gb|KJZ76215.1|  60S ribosomal protein L34-B                           96.7    1e-21   
emb|CCA69918.1|  probable ribosomal protein L34.e                     96.7    1e-21   
gb|EQL00230.1|  Ribosomal protein L34Ae                               96.7    1e-21   
ref|XP_007339672.1|  60s ribosomal protein l34-b                      96.7    1e-21   
gb|KDQ32628.1|  hypothetical protein PLEOSDRAFT_1051587               96.7    2e-21   
gb|ESZ98403.1|  60S ribosomal protein L34                             96.3    2e-21   
dbj|BAN20256.1|  ribosomal protein L34b                               96.7    2e-21   
ref|XP_006677070.1|  hypothetical protein BATDEDRAFT_86291            96.3    2e-21   
ref|XP_452572.1|  60S ribosomal protein L34                           96.7    2e-21   
gb|KIM20413.1|  hypothetical protein M408DRAFT_333990                 95.9    2e-21   
ref|XP_007379591.1|  60s ribosomal protein l34-b                      95.9    2e-21   
gb|KJY00752.1|  60s ribosomal protein l34                             96.3    2e-21   
ref|XP_008560304.1|  PREDICTED: 60S ribosomal protein L34-like        96.3    3e-21   
gb|EPZ35250.1|  60S ribosomal protein L34-B                           95.9    3e-21   
gb|KKA18206.1|  Ribosomal protein L34 protein                         96.3    3e-21   
gb|KIJ94094.1|  hypothetical protein K443DRAFT_684042                 95.9    3e-21   
gb|EJT53291.1|  60s ribosomal protein l34-b                           95.9    3e-21   
dbj|BAO42038.1|  60S ribosomal protein L34-B                          96.3    3e-21   
ref|XP_002624786.1|  60S ribosomal protein L34                        95.9    3e-21   
ref|XP_007394494.1|  hypothetical protein PHACADRAFT_253897           95.9    3e-21   
ref|XP_003289701.1|  ribosomal protein L34                            95.9    3e-21   
ref|XP_002379313.1|  60S ribosomal protein L34                        95.9    3e-21   
dbj|GAM23347.1|  hypothetical protein SAMD00019534_065220             95.9    3e-21   
ref|XP_008043695.1|  60s ribosomal protein l34-b                      95.9    3e-21   
ref|XP_001885202.1|  60S ribosomal protein L34                        95.9    3e-21   
ref|XP_002791247.1|  60S ribosomal protein L34                        95.9    3e-21   
gb|EMD36952.1|  hypothetical protein CERSUDRAFT_114864                95.9    3e-21   
ref|XP_007416368.1|  hypothetical protein MELLADRAFT_50435            95.9    3e-21   
ref|XP_567178.1|  60s ribosomal protein l34-b                         95.5    4e-21   
ref|XP_003233223.1|  60S ribosomal protein L34                        95.5    4e-21   
gb|ACT99619.1|  60S ribosomal protein L34                             95.5    4e-21   
dbj|GAM22302.1|  hypothetical protein SAMD00019534_054770             95.5    4e-21   
ref|XP_001540721.1|  60S ribosomal protein L34                        95.5    4e-21   
gb|AAL49199.1|  RE63456p                                              96.7    4e-21   
gb|EEH11038.1|  60S ribosomal protein L34B                            95.5    4e-21   
ref|XP_011270028.1|  50S ribosomal protein L34e                       95.1    4e-21   
ref|XP_008606511.1|  50S ribosomal protein L34e                       95.5    5e-21   
ref|XP_007365476.1|  60s ribosomal protein l34-b                      95.1    5e-21   
gb|KIM41242.1|  hypothetical protein M413DRAFT_445280                 95.5    5e-21   
ref|XP_003171534.1|  60S ribosomal protein L34                        95.5    5e-21   
gb|KIL86746.1|  50s ribosomal protein l34e                            95.1    5e-21   
ref|XP_008025187.1|  hypothetical protein SETTUDRAFT_162779           95.1    5e-21   
ref|XP_002596148.1|  hypothetical protein BRAFLDRAFT_276109           95.1    5e-21   
ref|XP_001554613.1|  60S ribosomal protein L34                        95.1    5e-21   
gb|ETN62888.1|  Ribosomal protein L34b                                95.9    5e-21   
gb|KII62124.1|  60S ribosomal protein L34                             95.1    5e-21   
gb|ADV03059.1|  ribosomal protein L34                                 95.1    6e-21   
ref|XP_001744042.1|  hypothetical protein                             94.7    6e-21   
gb|KIJ55112.1|  hypothetical protein M422DRAFT_199213                 95.1    6e-21   
gb|KFH42585.1|  60S ribosomal protein L34-B-like protein              95.1    6e-21   
ref|NP_651460.2|  ribosomal protein L34a, isoform A                   96.3    7e-21   
ref|XP_001265868.1|  60S ribosomal protein L34                        94.7    7e-21   
ref|XP_002096932.1|  GE24782                                          96.3    7e-21   
emb|CCE43248.1|  hypothetical protein CPAR2_208930                    94.7    8e-21   
ref|XP_662126.1|  hypothetical protein AN4522.2                       94.7    8e-21   
ref|XP_002104134.1|  GD20801                                          95.9    8e-21   
gb|KIN04283.1|  hypothetical protein OIDMADRAFT_18280                 94.7    9e-21   
gb|EYE98053.1|  ribosomal protein L34 protein                         94.7    9e-21   
sp|P45842.2|RL34_AEDAL  RecName: Full=60S ribosomal protein L34; ...  95.1    9e-21   
ref|XP_003191786.1|  60s ribosomal protein l34-b                      94.4    9e-21   
ref|XP_002846025.1|  60S ribosomal protein L34                        94.7    1e-20   
ref|NP_649887.1|  ribosomal protein L34b, isoform A                   95.9    1e-20   
sp|Q9NB34.3|RL34_OCHTR  RecName: Full=60S ribosomal protein L34       95.1    1e-20   
ref|XP_001981699.1|  GG12199                                          95.5    1e-20   
ref|XP_002105023.1|  GD18147                                          95.5    1e-20   
gb|KIR51551.1|  50S small subunit ribosomal protein L34e              94.4    1e-20   
emb|CAJ17416.1|  ribosomal protein L34e                               94.4    1e-20   
ref|XP_002041350.1|  GM10197                                          95.5    1e-20   
emb|CEG69068.1|  Putative 60S ribosomal protein L34-B                 94.0    1e-20   
ref|NP_502330.1|  Protein RPL-34                                      94.0    1e-20   
gb|KDE05995.1|  60S ribosomal protein L34-B                           94.0    1e-20   
ref|XP_007289829.1|  60S ribosomal protein L34                        94.0    1e-20   
gb|EHK48716.1|  hypothetical protein TRIATDRAFT_298082                94.0    2e-20   
gb|EKV07821.1|  Ribosomal protein L34 protein, putative               94.0    2e-20   
emb|CEI87011.1|  Putative 60S ribosomal protein L34-B                 93.6    2e-20   
gb|EMF14803.1|  ribosomal protein L34 protein                         94.0    2e-20   
ref|XP_009551050.1|  hypothetical protein HETIRDRAFT_411721           93.6    2e-20   
ref|XP_007925939.1|  hypothetical protein MYCFIDRAFT_70900            94.0    2e-20   
ref|XP_001838050.1|  60S ribosomal protein L34                        93.6    2e-20   
emb|CEF70400.1|  60S ribosomal protein L34                            93.6    2e-20   
ref|XP_001653796.1|  AAEL009341-PA                                    94.0    2e-20   
gb|KIL66647.1|  hypothetical protein M378DRAFT_191885                 93.6    2e-20   
ref|XP_003866644.1|  hypothetical protein CORT_0A08200                93.6    2e-20   
gb|KFB39053.1|  ribosomal protein L34, putative                       94.7    2e-20   
ref|XP_002130459.1|  PREDICTED: 60S ribosomal protein L34-like        93.2    2e-20   
ref|XP_002836605.1|  60S ribosomal protein L34                        93.6    2e-20   
ref|XP_002562247.1|  Pc18g04110                                       93.6    2e-20   
emb|CCK69913.1|  hypothetical protein KNAG_0D01610                    93.6    2e-20   
gb|ESA21050.1|  hypothetical protein GLOINDRAFT_343333                92.8    2e-20   
ref|XP_001908499.1|  hypothetical protein                             93.2    2e-20   
gb|KFY28724.1|  hypothetical protein V493_02784                       93.2    3e-20   
ref|XP_007317080.1|  hypothetical protein SERLADRAFT_368423           93.2    3e-20   
ref|XP_002098940.1|  GE10642                                          94.4    3e-20   
ref|XP_001245131.1|  60S ribosomal protein L34                        93.2    3e-20   
gb|KEQ72958.1|  ribosomal protein L34e                                93.2    3e-20   
ref|XP_001848599.1|  conserved hypothetical protein                   94.0    3e-20   
gb|KDN71984.1|  putative ribosomal protein L34e                       93.2    3e-20   
ref|XP_001391817.1|  60S ribosomal protein L34                        93.2    3e-20   
gb|ELR04864.1|  50S ribosomal protein L34e                            93.2    3e-20   
ref|XP_007770132.1|  60s ribosomal protein l34-b                      93.2    3e-20   
emb|CDM33603.1|  60S ribosomal protein L34-A                          93.2    3e-20   
ref|XP_007303393.1|  ribosomal protein L34e                           92.8    4e-20   
gb|ABQ18250.1|  ribosomal subunit L34                                 92.8    4e-20   
gb|KIJ16492.1|  hypothetical protein PAXINDRAFT_59655                 92.8    4e-20   
gb|KIP03288.1|  hypothetical protein PHLGIDRAFT_42239                 92.8    4e-20   
ref|XP_003350419.1|  60S ribosomal protein L34                        92.8    4e-20   
ref|XP_003662627.1|  hypothetical protein MYCTH_116020                92.8    4e-20   
ref|XP_001387393.1|  60S ribosomal protein L34                        92.8    4e-20   
gb|ERG79362.1|  60s ribosomal protein l34-b                           92.8    4e-20   
gb|EHK21409.1|  hypothetical protein TRIVIDRAFT_91260                 92.8    4e-20   
ref|XP_002483825.1|  60S ribosomal protein L34                        92.8    5e-20   
ref|XP_007688076.1|  hypothetical protein COCMIDRAFT_26405            92.4    5e-20   
ref|XP_002417304.1|  60S ribosomal protein L34                        92.8    5e-20   
gb|EPS96372.1|  hypothetical protein FOMPIDRAFT_1025397               92.4    5e-20   
gb|KII91556.1|  hypothetical protein PLICRDRAFT_105458                92.4    5e-20   
emb|CCK72764.1|  hypothetical protein KNAG_0L01440                    92.8    5e-20   
gb|EGT40093.1|  hypothetical protein CAEBREN_15301                    92.4    5e-20   
gb|KHJ33100.1|  putative 60s ribosomal protein l34                    92.4    5e-20   
gb|KFY11704.1|  hypothetical protein V492_04308                       92.4    5e-20   
gb|KGU15012.1|  60S ribosomal protein L34-B                           92.4    6e-20   
gb|KGQ91299.1|  60S ribosomal protein L34-B                           92.4    6e-20   
ref|XP_007790463.1|  putative 60s ribosomal protein l34 protein       92.4    6e-20   
ref|XP_963118.1|  60S ribosomal protein L34                           92.4    6e-20   
emb|CEJ92784.1|  Putative Ribosomal protein L34Ae                     92.4    6e-20   
ref|XP_970537.1|  PREDICTED: 60S ribosomal protein L34                92.4    6e-20   
ref|XP_797232.1|  PREDICTED: 60S ribosomal protein L34-B              92.0    6e-20   
gb|EFQ25255.1|  ribosomal protein L34e                                92.4    7e-20   
ref|XP_009842441.1|  hypothetical protein H257_15873                  92.4    7e-20   
ref|XP_003088517.1|  hypothetical protein CRE_07160                   92.0    7e-20   
emb|CDS11418.1|  Putative 60S ribosomal protein L34-B                 92.0    7e-20   
gb|KIY72209.1|  ribosomal protein L34e                                92.0    7e-20   
gb|ESW95952.1|  60S ribosomal protein L34-A                           92.0    8e-20   
gb|ABR87390.1|  large subunit ribosomal protein 34                    91.7    8e-20   
ref|XP_007276790.1|  60s ribosomal protein l34                        92.0    9e-20   
emb|CDS10203.1|  Putative 60S ribosomal protein L34-B                 91.7    9e-20   
gb|KEQ65632.1|  ribosomal protein L34e                                91.7    9e-20   
gb|KHC68853.1|  60S ribosomal protein L34-B                           92.0    9e-20   
gb|AAX48867.1|  L34                                                   91.7    9e-20   
emb|CCA17178.1|  ribosomal protein L34 putative                       91.7    9e-20   
gb|KDN37688.1|  60s ribosomal protein l34-b                           91.7    1e-19   
gb|KIM82730.1|  hypothetical protein PILCRDRAFT_454900                91.7    1e-19   
emb|CDP91742.1|  Protein BM-RPL-34, isoform a                         91.7    1e-19   
ref|XP_006697413.1|  ribosomal protein l34-like protein               91.7    1e-19   
dbj|GAM85179.1|  hypothetical protein ANO11243_031830                 91.7    1e-19   
ref|XP_007583931.1|  putative 60s ribosomal protein l34 protein       91.7    1e-19   
ref|XP_002150383.1|  60S ribosomal protein L34                        91.7    1e-19   
ref|XP_003655908.1|  60S ribosomal protein L34                        91.7    1e-19   
ref|XP_009217123.1|  60S ribosomal protein L34-B                      91.7    1e-19   
gb|EWG51330.1|  50S ribosomal protein L34e                            91.7    1e-19   
gb|KDQ14115.1|  hypothetical protein BOTBODRAFT_32905                 91.7    1e-19   
ref|XP_001897295.1|  60S ribosomal protein L34                        91.7    1e-19   
tpe|CAL69080.1|  TPA: putative 60S ribosomal protein L34 isoform 1    92.0    1e-19   
gb|KIK69600.1|  hypothetical protein GYMLUDRAFT_33972                 91.3    1e-19   
gb|KIW81394.1|  hypothetical protein Z517_04419                       91.7    1e-19   
tpe|CAL69081.1|  TPA: putative 60S ribosomal protein L34 isoform 2    92.0    1e-19   
gb|ELQ74099.1|  60s ribosomal protein L34                             91.3    1e-19   
ref|XP_007732416.1|  60S ribosomal protein L34-B                      91.7    1e-19   
ref|XP_003321861.1|  60S ribosomal protein L34                        91.3    1e-19   
emb|CCF46911.1|  60S ribosomal protein L34-B                          91.3    1e-19   
ref|XP_501460.2|  60S ribosomal protein L34                           91.3    1e-19   
ref|XP_008873001.1|  hypothetical protein H310_08870                  91.3    1e-19   
gb|EIF46815.1|  60s ribosomal protein                                 91.7    1e-19   
emb|CDR43248.1|  CYFA0S11e02410g1_1                                   91.7    2e-19   
ref|XP_004182658.1|  hypothetical protein TBLA_0J01430                91.7    2e-19   
ref|XP_007725987.1|  60S ribosomal protein L34-B                      91.3    2e-19   
emb|CDR43740.1|  CYFA0S12e03796g1_1                                   91.3    2e-19   
gb|EME46750.1|  hypothetical protein DOTSEDRAFT_70670                 91.3    2e-19   
ref|XP_003003048.1|  60S ribosomal protein L34                        91.3    2e-19   
gb|EPS30302.1|  hypothetical protein PDE_05253                        91.3    2e-19   
gb|EMD88396.1|  hypothetical protein COCHEDRAFT_1141965               90.9    2e-19   
ref|XP_001791136.1|  hypothetical protein SNOG_00451                  90.9    2e-19   
emb|CDP91741.1|  Protein BM-RPL-34, isoform b                         91.3    2e-19   
emb|CEP16585.1|  hypothetical protein                                 90.9    2e-19   
ref|XP_001218212.1|  60S ribosomal protein L34                        90.9    2e-19   
ref|XP_008719742.1|  60S ribosomal protein L34-B                      90.9    2e-19   
ref|XP_007003969.1|  hypothetical protein TREMEDRAFT_43478            90.9    2e-19   
gb|ENH86463.1|  60s ribosomal protein l34                             90.9    2e-19   
gb|KEY69003.1|  hypothetical protein S7711_03309                      90.9    2e-19   



>gb|EYU28752.1| hypothetical protein MIMGU_mgv1a016482mg [Erythranthe guttata]
Length=120

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  95



>gb|EYU28751.1| hypothetical protein MIMGU_mgv1a016464mg [Erythranthe guttata]
Length=120

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  95



>gb|EYU22419.1| hypothetical protein MIMGU_mgv1a016469mg [Erythranthe guttata]
Length=120

 Score =   194 bits (492),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  95



>ref|XP_011070999.1| PREDICTED: 60S ribosomal protein L34 [Sesamum indicum]
 ref|XP_011096271.1| PREDICTED: 60S ribosomal protein L34 [Sesamum indicum]
Length=120

 Score =   193 bits (491),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  95



>ref|XP_012084696.1| PREDICTED: 60S ribosomal protein L34 [Jatropha curcas]
 gb|KDP27143.1| hypothetical protein JCGZ_19842 [Jatropha curcas]
Length=120

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  95



>ref|XP_012080264.1| PREDICTED: 60S ribosomal protein L34-like [Jatropha curcas]
 gb|KDP31246.1| hypothetical protein JCGZ_11622 [Jatropha curcas]
Length=120

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  95



>ref|XP_010044743.1| PREDICTED: 60S ribosomal protein L34 [Eucalyptus grandis]
 gb|KCW86845.1| hypothetical protein EUGRSUZ_B03442 [Eucalyptus grandis]
Length=120

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_007139581.1| hypothetical protein PHAVU_008G041700g [Phaseolus vulgaris]
 gb|ESW11575.1| hypothetical protein PHAVU_008G041700g [Phaseolus vulgaris]
Length=120

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>gb|ADR71242.1| 60S ribosomal protein L34B [Hevea brasiliensis]
Length=120

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_010044733.1| PREDICTED: 60S ribosomal protein L34-like [Eucalyptus grandis]
 gb|KCW86836.1| hypothetical protein EUGRSUZ_B03433 [Eucalyptus grandis]
Length=120

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_002522429.1| 60S ribosomal protein L34, putative [Ricinus communis]
 gb|EEF39921.1| 60S ribosomal protein L34, putative [Ricinus communis]
Length=120

 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_012067636.1| PREDICTED: 60S ribosomal protein L34 [Jatropha curcas]
 gb|KDP41194.1| hypothetical protein JCGZ_15601 [Jatropha curcas]
Length=120

 Score =   191 bits (486),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG+PHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGVPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_009376266.1| PREDICTED: 60S ribosomal protein L34 [Pyrus x bretschneideri]
Length=123

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_009591909.1| PREDICTED: 60S ribosomal protein L34-like [Nicotiana tomentosiformis]
Length=120

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGSAVRERIIRAF  95



>gb|ADR71241.1| 60S ribosomal protein L34A [Hevea brasiliensis]
Length=120

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLARNRRTVNRAYGGVLSGGAVRERIIRAF  95



>gb|EYU34076.1| hypothetical protein MIMGU_mgv1a016461mg [Erythranthe guttata]
Length=120

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTT+KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTQKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGSAVRERIIRAF  95



>ref|XP_008341572.1| PREDICTED: 60S ribosomal protein L34-like [Malus domestica]
 ref|XP_009341009.1| PREDICTED: 60S ribosomal protein L34-like [Pyrus x bretschneideri]
Length=123

 Score =   191 bits (485),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_010066914.1| PREDICTED: 60S ribosomal protein L34-like [Eucalyptus grandis]
 gb|KCW64962.1| hypothetical protein EUGRSUZ_G02505 [Eucalyptus grandis]
Length=120

 Score =   191 bits (484),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS GAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSAGAVRERIIRAF  95



>ref|XP_010096548.1| 60S ribosomal protein L34 [Morus notabilis]
 gb|EXB64795.1| 60S ribosomal protein L34 [Morus notabilis]
Length=120

 Score =   190 bits (483),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY+RSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYQRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_002324052.1| ribosomal protein L34 [Populus trichocarpa]
 ref|XP_011010598.1| PREDICTED: 60S ribosomal protein L34 [Populus euphratica]
 gb|ABK94411.1| unknown [Populus trichocarpa]
 gb|EEF04185.1| ribosomal protein L34 [Populus trichocarpa]
Length=120

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_011040278.1| PREDICTED: 60S ribosomal protein L34-like [Populus euphratica]
 ref|XP_011040280.1| PREDICTED: 60S ribosomal protein L34-like [Populus euphratica]
Length=120

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_002534058.1| 60S ribosomal protein L34, putative [Ricinus communis]
 gb|EEF28324.1| 60S ribosomal protein L34, putative [Ricinus communis]
Length=120

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP+
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>gb|EPS67435.1| hypothetical protein M569_07339 [Genlisea aurea]
Length=120

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRRRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>gb|EPS63651.1| hypothetical protein M569_11133 [Genlisea aurea]
Length=120

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRRRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_002318779.1| ribosomal protein L34 [Populus trichocarpa]
 ref|XP_011042995.1| PREDICTED: 60S ribosomal protein L34 [Populus euphratica]
 gb|ABK92764.1| unknown [Populus trichocarpa]
 gb|EEE96999.1| ribosomal protein L34 [Populus trichocarpa]
Length=119

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010105633.1| 60S ribosomal protein L34 [Morus notabilis]
 gb|EXC05421.1| 60S ribosomal protein L34 [Morus notabilis]
Length=120

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_007209770.1| hypothetical protein PRUPE_ppa013459mg [Prunus persica]
 ref|XP_008239951.1| PREDICTED: 60S ribosomal protein L34-like [Prunus mume]
 gb|EMJ10969.1| hypothetical protein PRUPE_ppa013459mg [Prunus persica]
Length=121

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_006374574.1| hypothetical protein POPTR_0015s11780g [Populus trichocarpa]
 gb|ABK93580.1| unknown [Populus trichocarpa]
 gb|ABK94421.1| unknown [Populus trichocarpa]
 gb|ERP52371.1| hypothetical protein POPTR_0015s11780g [Populus trichocarpa]
Length=120

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_004299366.1| PREDICTED: 60S ribosomal protein L34 [Fragaria vesca subsp. vesca]
Length=120

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_004241579.1| PREDICTED: 60S ribosomal protein L34 [Solanum lycopersicum]
Length=120

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQTTKKRA+GPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRANGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIVRAF  95



>ref|XP_006354783.1| PREDICTED: 60S ribosomal protein L34-like [Solanum tuberosum]
Length=120

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQTTKKRA+GPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRANGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIVRAF  95



>ref|NP_001236831.1| uncharacterized protein LOC100305798 [Glycine max]
 ref|XP_003552522.1| PREDICTED: 60S ribosomal protein L34-like [Glycine max]
 gb|ACU13658.1| unknown [Glycine max]
 gb|KHN11599.1| 60S ribosomal protein L34 [Glycine soja]
Length=120

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_004147322.1| PREDICTED: 60S ribosomal protein L34 [Cucumis sativus]
 ref|XP_008453201.1| PREDICTED: 60S ribosomal protein L34 [Cucumis melo]
 ref|XP_008453217.1| PREDICTED: 60S ribosomal protein L34 [Cucumis melo]
 ref|XP_008460833.1| PREDICTED: 60S ribosomal protein L34 [Cucumis melo]
 gb|KGN62245.1| hypothetical protein Csa_2G338890 [Cucumis sativus]
Length=120

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLARNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010527899.1| PREDICTED: 60S ribosomal protein L34-like [Tarenaya hassleriana]
Length=120

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPH+RPA
Sbjct  1    MVQRLTYRGRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHMRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGSAVRERIIRAF  95



>ref|XP_004138175.2| PREDICTED: 60S ribosomal protein L34 [Cucumis sativus]
 gb|KGN63682.1| hypothetical protein Csa_1G009860 [Cucumis sativus]
Length=106

 Score =   189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLARNRRTVNRAYGGVLSGGAVRERIIRAF  95



>gb|AFK36300.1| unknown [Lotus japonicus]
 gb|AFK45568.1| unknown [Lotus japonicus]
Length=120

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_004490057.1| PREDICTED: 60S ribosomal protein L34-like [Cicer arietinum]
Length=120

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_004509966.1| PREDICTED: 60S ribosomal protein L34-like [Cicer arietinum]
Length=120

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_007217809.1| hypothetical protein PRUPE_ppb011184mg [Prunus persica]
 ref|XP_008230761.1| PREDICTED: 60S ribosomal protein L34 [Prunus mume]
 gb|EMJ19008.1| hypothetical protein PRUPE_ppb011184mg [Prunus persica]
Length=120

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_004491784.1| PREDICTED: 60S ribosomal protein L34-like [Cicer arietinum]
Length=120

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_008379348.1| PREDICTED: 60S ribosomal protein L34 [Malus domestica]
Length=123

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAV ERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVXERIIRAF  95



>sp|P40590.1|RL34_PEA RecName: Full=60S ribosomal protein L34 [Pisum sativum]
 gb|AAA86953.1| ribosomal protein L34 homolog [Pisum sativum]
Length=120

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_006439596.1| hypothetical protein CICLE_v10022900mg [Citrus clementina]
 ref|XP_006476605.1| PREDICTED: 60S ribosomal protein L34-like [Citrus sinensis]
 gb|ESR52836.1| hypothetical protein CICLE_v10022900mg [Citrus clementina]
 gb|KDO76131.1| hypothetical protein CISIN_1g033398mg [Citrus sinensis]
Length=120

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_008393151.1| PREDICTED: 60S ribosomal protein L34-like [Malus domestica]
 ref|XP_009369308.1| PREDICTED: 60S ribosomal protein L34-like [Pyrus x bretschneideri]
Length=121

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQT+KKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRIVKTPGGKLVYQTSKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_006431140.1| hypothetical protein CICLE_v10013131mg [Citrus clementina]
 gb|ESR44380.1| hypothetical protein CICLE_v10013131mg [Citrus clementina]
Length=120

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRN RTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNHRTVNRTYGGVLSGGAVRERIIRAF  95



>ref|XP_009600693.1| PREDICTED: 60S ribosomal protein L34-like [Nicotiana tomentosiformis]
Length=120

 Score =   188 bits (478),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_004238799.1| PREDICTED: 60S ribosomal protein L34 [Solanum lycopersicum]
Length=120

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQTTKKRA+GPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRANGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010693235.1| PREDICTED: 60S ribosomal protein L34 [Beta vulgaris subsp. vulgaris]
Length=120

 Score =   188 bits (477),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAFlveeqkivkkvlkiqkakekqAGKS  411
            EYKRSRL RNRRTVNRPYGGVLSG AVRERIIRAFLVEEQKIVKKVLKIQK KEKQAGKS
Sbjct  61   EYKRSRLPRNRRTVNRPYGGVLSGSAVRERIIRAFLVEEQKIVKKVLKIQKTKEKQAGKS  120



>ref|XP_004138165.2| PREDICTED: 60S ribosomal protein L34-like [Cucumis sativus]
 gb|KGN63665.1| hypothetical protein Csa_1G009690 [Cucumis sativus]
Length=120

 Score =   188 bits (477),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RNRRTVNR YGGV+SG AVRERIIRAF
Sbjct  61   EYKRSRLARNRRTVNRAYGGVVSGSAVRERIIRAF  95



>gb|AFK47541.1| unknown [Lotus japonicus]
Length=120

 Score =   188 bits (477),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_010091511.1| 60S ribosomal protein L34 [Morus notabilis]
 gb|EXB44681.1| 60S ribosomal protein L34 [Morus notabilis]
Length=120

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIHGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>emb|CDP00331.1| unnamed protein product [Coffea canephora]
Length=120

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MAQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLARNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_003518726.1| PREDICTED: 60S ribosomal protein L34-like [Glycine max]
 gb|KHN01221.1| 60S ribosomal protein L34 [Glycine soja]
 gb|KHN12211.1| 60S ribosomal protein L34 [Glycine soja]
Length=120

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_007037334.1| Ribosomal protein L34e superfamily protein [Theobroma cacao]
 gb|EOY21835.1| Ribosomal protein L34e superfamily protein [Theobroma cacao]
Length=120

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_008339902.1| PREDICTED: 60S ribosomal protein L34 [Malus domestica]
Length=121

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRARHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAV+ERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVKERIIRAF  95



>ref|XP_008389476.1| PREDICTED: 60S ribosomal protein L34-like [Malus domestica]
 ref|XP_009360342.1| PREDICTED: 60S ribosomal protein L34 [Pyrus x bretschneideri]
Length=121

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRARHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAV+ERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVKERIIRAF  95



>ref|XP_007157628.1| hypothetical protein PHAVU_002G085600g [Phaseolus vulgaris]
 gb|ESW29622.1| hypothetical protein PHAVU_002G085600g [Phaseolus vulgaris]
Length=120

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_002273676.1| PREDICTED: 60S ribosomal protein L34 [Vitis vinifera]
 ref|XP_002283595.1| PREDICTED: 60S ribosomal protein L34 [Vitis vinifera]
 emb|CAN75201.1| hypothetical protein VITISV_010664 [Vitis vinifera]
 emb|CBI22221.3| unnamed protein product [Vitis vinifera]
 emb|CBI31959.3| unnamed protein product [Vitis vinifera]
Length=120

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQ+TKKRA+GPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQSTKKRANGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_011005519.1| PREDICTED: 60S ribosomal protein L34-like [Populus euphratica]
Length=119

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRK HSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKCHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_007227514.1| hypothetical protein PRUPE_ppa013472mg [Prunus persica]
 ref|XP_008221620.1| PREDICTED: 60S ribosomal protein L34 [Prunus mume]
 gb|EMJ28713.1| hypothetical protein PRUPE_ppa013472mg [Prunus persica]
Length=120

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AV+ERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGAAVKERIIRAF  95



>ref|XP_007046106.1| Ribosomal protein L34e superfamily protein [Theobroma cacao]
 gb|EOY01938.1| Ribosomal protein L34e superfamily protein [Theobroma cacao]
Length=120

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_009785300.1| PREDICTED: 60S ribosomal protein L34-like [Nicotiana sylvestris]
Length=120

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQ+TKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQSTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009602105.1| PREDICTED: 60S ribosomal protein L34 [Nicotiana tomentosiformis]
 ref|XP_009782168.1| PREDICTED: 60S ribosomal protein L34 [Nicotiana sylvestris]
 ref|XP_009782773.1| PREDICTED: 60S ribosomal protein L34 [Nicotiana sylvestris]
 sp|P41098.1|RL34_TOBAC RecName: Full=60S ribosomal protein L34 [Nicotiana tabacum]
 gb|AAA57158.1| 60S ribosomal protein L34 [Nicotiana tabacum]
 gb|AAA57159.1| 60S ribosomal protein L34 [Nicotiana tabacum]
Length=120

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQ+TKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQSTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_006482587.1| PREDICTED: 60S ribosomal protein L34-like [Citrus sinensis]
Length=120

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKS+QHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSSQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGG VRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRTYGGVLSGGVVRERIIRAF  95



>ref|XP_006438683.1| hypothetical protein CICLE_v10033093mg [Citrus clementina]
 ref|XP_006483159.1| PREDICTED: 60S ribosomal protein L34-like [Citrus sinensis]
 gb|ESR51923.1| hypothetical protein CICLE_v10033093mg [Citrus clementina]
Length=120

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGAAVRERIIRAF  95



>ref|XP_010683191.1| PREDICTED: 60S ribosomal protein L34 [Beta vulgaris subsp. vulgaris]
Length=120

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAFlveeqkivkkvlkiqkakekqAGKS  411
            EYKRSRL RNRRTVNRPYGGVLSG AVRERIIRAFLVEEQKIVKKVLKIQK KEKQAGKS
Sbjct  61   EYKRSRLPRNRRTVNRPYGGVLSGSAVRERIIRAFLVEEQKIVKKVLKIQKTKEKQAGKS  120



>ref|XP_004232223.1| PREDICTED: 60S ribosomal protein L34 [Solanum lycopersicum]
Length=120

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010551541.1| PREDICTED: 60S ribosomal protein L34-1 [Tarenaya hassleriana]
Length=120

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_006338455.1| PREDICTED: 60S ribosomal protein L34-like [Solanum tuberosum]
Length=120

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHR+VKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRIVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_003613762.1| 60S ribosomal protein L34 [Medicago truncatula]
 gb|AES96720.1| 60S ribosomal L34-like protein [Medicago truncatula]
 gb|AFK43702.1| unknown [Medicago truncatula]
Length=120

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_003621181.1| 60S ribosomal protein L34 [Medicago truncatula]
 gb|ABD32214.1| Ribosomal protein L34e [Medicago truncatula]
 gb|ABN08919.1| Ribosomal protein L34e [Medicago truncatula]
 gb|ACJ83929.1| unknown [Medicago truncatula]
 gb|AES77399.1| 60S ribosomal L34-like protein [Medicago truncatula]
 gb|AFK47549.1| unknown [Medicago truncatula]
Length=120

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_011098620.1| PREDICTED: 60S ribosomal protein L34-like [Sesamum indicum]
Length=120

 Score =   186 bits (472),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010552577.1| PREDICTED: 60S ribosomal protein L34-1-like [Tarenaya hassleriana]
Length=120

 Score =   186 bits (472),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAFlveeqkivkkvlkiqkakekqAGKS  411
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAFLVEEQKIVKKVLK+QKAKEK AGKS
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVKKVLKLQKAKEKLAGKS  120



>emb|CDP02228.1| unnamed protein product [Coffea canephora]
Length=120

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QRLTYRKRHSYATKSNQHRVVKTPGG+LVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MAQRLTYRKRHSYATKSNQHRVVKTPGGRLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|ACJ84129.1| unknown [Medicago truncatula]
 gb|AFK42872.1| unknown [Medicago truncatula]
 gb|KEH19733.1| 60S ribosomal L34-like protein [Medicago truncatula]
Length=120

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_006366104.1| PREDICTED: 60S ribosomal protein L34-like [Solanum tuberosum]
 gb|AAT39969.1| 60S ribosomal protein L34, putative [Solanum demissum]
 gb|ABO92971.1| putative ribosomal protein L34e [Solanum tuberosum]
Length=120

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQTTKKRA+GPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRANGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|NP_001238172.1| uncharacterized protein LOC100499931 [Glycine max]
 gb|ACU14234.1| unknown [Glycine max]
 gb|KHM98949.1| 60S ribosomal protein L34 [Glycine soja]
Length=120

 Score =   185 bits (470),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY RSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYNRSRLHRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KFK44595.1| hypothetical protein AALP_AA1G279200 [Arabis alpina]
Length=120

 Score =   185 bits (470),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KHG15025.1| 60S ribosomal L34-1 -like protein [Gossypium arboreum]
 gb|KJB78274.1| hypothetical protein B456_012G187300 [Gossypium raimondii]
Length=120

 Score =   185 bits (470),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009771519.1| PREDICTED: 60S ribosomal protein L34-like [Nicotiana sylvestris]
Length=120

 Score =   185 bits (470),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKS+QHRVVKTPGGKLVYQ++KKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSSQHRVVKTPGGKLVYQSSKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRT NR YGGVLSGGAVRER+IRAF
Sbjct  61   EYKRSRLSRNRRTANRAYGGVLSGGAVRERVIRAF  95



>gb|KHN06860.1| 60S ribosomal protein L34 [Glycine soja]
Length=120

 Score =   185 bits (470),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_007032522.1| Ribosomal protein L34e superfamily protein [Theobroma cacao]
 gb|EOY03448.1| Ribosomal protein L34e superfamily protein [Theobroma cacao]
Length=120

 Score =   185 bits (470),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010678528.1| PREDICTED: 60S ribosomal protein L34-like [Beta vulgaris subsp. 
vulgaris]
Length=120

 Score =   185 bits (470),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHR+VKTPGG+LVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRRHSYATKSNQHRIVKTPGGRLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRPYGGVLSGSAVRERIIRAF  95



>gb|KJB50912.1| hypothetical protein B456_008G192800 [Gossypium raimondii]
Length=120

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KJB50656.1| hypothetical protein B456_008G181200 [Gossypium raimondii]
Length=119

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KJB33557.1| hypothetical protein B456_006G017600 [Gossypium raimondii]
Length=120

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_004297304.1| PREDICTED: 60S ribosomal protein L34-1 [Fragaria vesca subsp. 
vesca]
Length=120

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AV+ERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGAAVKERIIRAF  95



>ref|XP_002462376.1| hypothetical protein SORBIDRAFT_02g024610 [Sorghum bicolor]
 gb|EER98897.1| hypothetical protein SORBIDRAFT_02g024610 [Sorghum bicolor]
Length=119

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>gb|EAZ09088.1| hypothetical protein OsI_31355 [Oryza sativa Indica Group]
 gb|EAZ44718.1| hypothetical protein OsJ_29349 [Oryza sativa Japonica Group]
Length=119

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>gb|KHF99375.1| 60S ribosomal L34-1 -like protein [Gossypium arboreum]
Length=120

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKL+YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRSRHSYATKSNQHRVVKTPGGKLIYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010532818.1| PREDICTED: 60S ribosomal protein L34 [Tarenaya hassleriana]
Length=120

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLVYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPV  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_010528334.1| PREDICTED: 60S ribosomal protein L34-1 [Tarenaya hassleriana]
Length=120

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQT KKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTAKKRASGPKCPVTGKRIQGIPHLRPV  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_004956809.1| PREDICTED: 60S ribosomal protein L34-like isoform X2 [Setaria 
italica]
Length=119

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_010258364.1| PREDICTED: 60S ribosomal protein L34 [Nelumbo nucifera]
Length=120

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLV+Q+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVFQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_008784145.1| PREDICTED: 60S ribosomal protein L34 [Phoenix dactylifera]
Length=120

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|NP_174010.1| 60S ribosomal protein L34-1 [Arabidopsis thaliana]
 ref|XP_002893376.1| hypothetical protein ARALYDRAFT_472716 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006303190.1| hypothetical protein CARUB_v10010667mg [Capsella rubella]
 ref|XP_010498991.1| PREDICTED: 60S ribosomal protein L34-1 [Camelina sativa]
 ref|XP_010477806.1| PREDICTED: 60S ribosomal protein L34-1 [Camelina sativa]
 sp|Q42351.1|RL341_ARATH RecName: Full=60S ribosomal protein L34-1 [Arabidopsis thaliana]
 gb|AAD14494.1| 60s ribosomal protein L34 [Arabidopsis thaliana]
 gb|AAL85030.1| putative 60s ribosomal protein L34 [Arabidopsis thaliana]
 gb|AAM51402.1| putative 60S ribosomal protein L34 [Arabidopsis thaliana]
 gb|EFH69635.1| hypothetical protein ARALYDRAFT_472716 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30753.1| 60S ribosomal protein L34-1 [Arabidopsis thaliana]
 gb|EOA36088.1| hypothetical protein CARUB_v10010667mg [Capsella rubella]
Length=120

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP+
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|ACJ83310.1| unknown [Medicago truncatula]
Length=120

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+ HSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRRHHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>ref|XP_011085759.1| PREDICTED: 60S ribosomal protein L34-like [Sesamum indicum]
Length=120

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRARHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_008802610.1| PREDICTED: 60S ribosomal protein L34 [Phoenix dactylifera]
Length=120

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_002445552.1| hypothetical protein SORBIDRAFT_07g021410 [Sorghum bicolor]
 ref|XP_008677416.1| PREDICTED: 60S ribosomal protein L34 isoform X1 [Zea mays]
 gb|EES15047.1| hypothetical protein SORBIDRAFT_07g021410 [Sorghum bicolor]
 gb|AFW62294.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGIAVRERIIRAF  95



>ref|XP_010257345.1| PREDICTED: 60S ribosomal protein L34-like [Nelumbo nucifera]
Length=120

 Score =   184 bits (466),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLV+Q TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVFQNTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_006303006.1| hypothetical protein CARUB_v10021161mg [Capsella rubella]
 ref|XP_010512010.1| PREDICTED: 60S ribosomal protein L34-2 [Camelina sativa]
 ref|XP_010415618.1| PREDICTED: 60S ribosomal protein L34-2 [Camelina sativa]
 gb|EOA35904.1| hypothetical protein CARUB_v10021161mg [Capsella rubella]
Length=120

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KJB75747.1| hypothetical protein B456_012G054700 [Gossypium raimondii]
Length=120

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLS  AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSSSAVRERIIRAF  95



>gb|KFK41386.1| hypothetical protein AALP_AA2G123500 [Arabis alpina]
Length=120

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|NP_001132454.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACF81299.1| unknown [Zea mays]
 gb|ACG24514.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACG24624.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACG27353.1| 60S ribosomal protein L34 [Zea mays]
 tpg|DAA61431.1| TPA: 60S ribosomal protein L34 [Zea mays]
Length=120

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_002443887.1| hypothetical protein SORBIDRAFT_07g003770 [Sorghum bicolor]
 ref|XP_004972805.1| PREDICTED: 60S ribosomal protein L34-like [Setaria italica]
 gb|EES13382.1| hypothetical protein SORBIDRAFT_07g003770 [Sorghum bicolor]
Length=119

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|NP_001061026.1| Os08g0156800 [Oryza sativa Japonica Group]
 ref|XP_006659132.1| PREDICTED: 60S ribosomal protein L34-like [Oryza brachyantha]
 dbj|BAC99505.1| putative ribosomal protein L34 [Oryza sativa Japonica Group]
 dbj|BAF22940.1| Os08g0156800 [Oryza sativa Japonica Group]
 gb|EAZ41567.1| hypothetical protein OsJ_26091 [Oryza sativa Japonica Group]
 dbj|BAG96075.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score =   183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|NP_001061890.1| Os08g0436800 [Oryza sativa Japonica Group]
 dbj|BAD10146.1| putative ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF23804.1| Os08g0436800 [Oryza sativa Japonica Group]
 gb|EAZ07111.1| hypothetical protein OsI_29358 [Oryza sativa Indica Group]
 gb|EAZ42859.1| hypothetical protein OsJ_27452 [Oryza sativa Japonica Group]
Length=118

 Score =   183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_004975852.1| PREDICTED: 60S ribosomal protein L34-like [Setaria italica]
Length=119

 Score =   183 bits (465),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGQAVRERIIRAF  95



>ref|XP_004973530.1| PREDICTED: 60S ribosomal protein L34-like [Setaria italica]
Length=119

 Score =   183 bits (464),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>gb|AAM66030.1| 60s ribosomal protein L34 [Arabidopsis thaliana]
Length=120

 Score =   183 bits (464),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKK+ASGPKCPVTGKRIQGIPHLRP+
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKKASGPKCPVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KFK33761.1| hypothetical protein AALP_AA5G056900 [Arabis alpina]
Length=120

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGEAVRERIVRAF  95



>ref|XP_006415975.1| hypothetical protein EUTSA_v10009127mg [Eutrema salsugineum]
 gb|ESQ34328.1| hypothetical protein EUTSA_v10009127mg [Eutrema salsugineum]
Length=120

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQT+KKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTSKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSASAVRERIIRAF  95



>ref|NP_001237362.1| uncharacterized protein LOC100499882 [Glycine max]
 gb|ACU14031.1| unknown [Glycine max]
Length=120

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCP TGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPATGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL +NRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPKNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|ACG48574.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACN36475.1| unknown [Zea mays]
 gb|AFW61206.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RN+RTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLARNQRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|NP_001152634.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACG48648.1| 60S ribosomal protein L34 [Zea mays]
Length=186

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGIAVRERIIRAF  95



>ref|XP_002887248.1| hypothetical protein ARALYDRAFT_894747 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63507.1| hypothetical protein ARALYDRAFT_894747 [Arabidopsis lyrata subsp. 
lyrata]
Length=120

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRP+
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_006660622.1| PREDICTED: 60S ribosomal protein L34-like [Oryza brachyantha]
Length=119

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLYRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_006652368.1| PREDICTED: 60S ribosomal protein L34-like [Oryza brachyantha]
Length=119

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ R+VKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRIVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGQAVRERIIRAF  95



>ref|XP_003573474.1| PREDICTED: 60S ribosomal protein L34-like [Brachypodium distachyon]
Length=119

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGPAVRERIIRAF  95



>ref|XP_006827229.1| PREDICTED: 60S ribosomal protein L34 [Amborella trichopoda]
 ref|XP_006827232.1| PREDICTED: 60S ribosomal protein L34 [Amborella trichopoda]
 gb|ERM94466.1| hypothetical protein AMTR_s00010p00260490 [Amborella trichopoda]
 gb|ERM94469.1| hypothetical protein AMTR_s00010p00260730 [Amborella trichopoda]
Length=120

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQ RVVKTPGGKLVYQT KKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRTRHSYATKSNQTRVVKTPGGKLVYQTAKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKR+RLSRNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  61   EYKRTRLSRNRRTVNRAYGGVLSGGAVRERIIRAF  95



>gb|EMS57639.1| 60S ribosomal protein L34 [Triticum urartu]
Length=119

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGPAVRERIIRAF  95



>ref|XP_003573475.1| PREDICTED: 60S ribosomal protein L34 [Brachypodium distachyon]
Length=118

 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGPAVRERIIRAF  95



>ref|NP_001152435.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACG47609.1| 60S ribosomal protein L34 [Zea mays]
 gb|AFW57303.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   182 bits (462),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLARNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|NP_001152744.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACG24641.1| 60S ribosomal protein L34 [Zea mays]
 gb|ACG49249.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   182 bits (461),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRN RTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNHRTVNRPYGGVLSGIAVRERIIRAF  95



>gb|EPS73949.1| hypothetical protein M569_00807, partial [Genlisea aurea]
Length=116

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSNQHRVV+TPGGKLVYQT KKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRRRHSYATKSNQHRVVRTPGGKLVYQTAKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTV+R YGGVLS GAVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVSRAYGGVLSIGAVRERIIRAF  95



>ref|NP_177120.1| 60S ribosomal protein L34-2 [Arabidopsis thaliana]
 sp|Q9FE65.1|RL342_ARATH RecName: Full=60S ribosomal protein L34-2 [Arabidopsis thaliana]
 gb|AAG12705.1|AC021046_6 60S ribosomal protein L34, putative; 10936-9755 [Arabidopsis 
thaliana]
 gb|AAG40054.1|AF324703_1 T6C23.18 [Arabidopsis thaliana]
 gb|AAG42912.1|AF327531_1 putative 60S ribosomal protein L34 [Arabidopsis thaliana]
 gb|AAG52537.1|AC013289_4 putative 60S ribosomal protein L34; 81002-79821 [Arabidopsis 
thaliana]
 gb|AAK15573.1|AF349526_1 putative 60S ribosomal protein L34 [Arabidopsis thaliana]
 gb|AAL38618.1|AF446885_1 F24J1.23/F24J1.23 [Arabidopsis thaliana]
 gb|AAK96624.1| F24J1.23/F24J1.23 [Arabidopsis thaliana]
 gb|AAM62768.1| 60S ribosomal protein L34, putative [Arabidopsis thaliana]
 gb|AEE34956.1| 60S ribosomal protein L34-2 [Arabidopsis thaliana]
Length=119

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>dbj|BAK01360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=119

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGQAVRERIIRAF  95



>ref|XP_010460258.1| PREDICTED: 60S ribosomal protein L34-1-like [Camelina sativa]
Length=120

 Score =   181 bits (459),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKC VTGKRIQGIPHLRP+
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCLVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_006390992.1| hypothetical protein EUTSA_v10019324mg [Eutrema salsugineum]
 gb|ESQ28278.1| hypothetical protein EUTSA_v10019324mg [Eutrema salsugineum]
Length=120

 Score =   181 bits (459),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRP+
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSASAVRERIIRAF  95



>gb|ACG30531.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   181 bits (458),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_010937139.1| PREDICTED: 60S ribosomal protein L34 [Elaeis guineensis]
Length=120

 Score =   181 bits (458),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009385532.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   181 bits (458),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ T KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +YKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   QYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|ACG45094.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   181 bits (458),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCP TGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPFTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RN+RTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLARNQRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_010932825.1| PREDICTED: 60S ribosomal protein L34-like [Elaeis guineensis]
Length=120

 Score =   180 bits (457),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGKRIQGIP LRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKRIQGIPRLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009105516.1| PREDICTED: 60S ribosomal protein L34-2 [Brassica rapa]
 emb|CDY01759.1| BnaC06g27990D [Brassica napus]
 emb|CDX95913.1| BnaA07g28180D [Brassica napus]
Length=120

 Score =   180 bits (457),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSALAVRERIVRAF  95



>emb|CDY68374.1| BnaCnng58700D [Brassica napus]
Length=120

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSALAVRERIVRAF  95



>ref|XP_009127750.1| PREDICTED: 60S ribosomal protein L34-2-like [Brassica rapa]
 ref|XP_009104992.1| PREDICTED: 60S ribosomal protein L34-2-like [Brassica rapa]
 emb|CDY44081.1| BnaA02g14450D [Brassica napus]
 emb|CDY07341.1| BnaA07g24200D [Brassica napus]
 emb|CDY04284.1| BnaC06g25310D [Brassica napus]
Length=120

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSALAVRERIVRAF  95



>pdb|3J61|GG Chain g, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50987.1| ribosomal protein l34 [Triticum aestivum]
Length=119

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKR RLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRPRLSRNRRTVNRPYGGVLSGPAVRERIIRAF  95



>gb|ACG33498.1| 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRAS PKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASXPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RN+RTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLARNQRTVNRPYGGVLSGTAVRERIIRAF  95



>ref|XP_009111611.1| PREDICTED: 60S ribosomal protein L34-2-like [Brassica rapa]
 emb|CDY20010.1| BnaA09g02410D [Brassica napus]
 emb|CDY00108.1| BnaC09g01930D [Brassica napus]
Length=120

 Score =   180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AV++RI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGLAVKDRIVRAF  95



>ref|XP_010235171.1| PREDICTED: 60S ribosomal protein L34-like [Brachypodium distachyon]
Length=119

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRA GPKCPVTGK+IQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRAGGPKCPVTGKKIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRPYGGVLSGPAVRERIIRAF  95



>ref|XP_010939495.1| PREDICTED: 60S ribosomal protein L34 [Elaeis guineensis]
Length=120

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_008664659.1| PREDICTED: 60S ribosomal protein L34 [Zea mays]
 gb|ACF86965.1| unknown [Zea mays]
 gb|ACG48602.1| 60S ribosomal protein L34 [Zea mays]
 tpg|DAA48954.1| TPA: 60S ribosomal protein L34 [Zea mays]
Length=119

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL R+RRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLPRSRRTVNRPYGGVLSGIAVRERIIRAF  95



>gb|KHG05667.1| 60S ribosomal protein L34-1 [Gossypium arboreum]
Length=120

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M+QRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MIQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RN RTVNR YGGVLS  AVRERIIRAF
Sbjct  61   EYKRSRLPRNCRTVNRAYGGVLSCSAVRERIIRAF  95



>ref|XP_009421274.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ T KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRN+RTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNQRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KHN13622.1| 60S ribosomal protein L34 [Glycine soja]
Length=801

 Score =   193 bits (491),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  682  MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  741

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNR YGGVLSGGAVRERIIRAF
Sbjct  742  EYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAF  776



>ref|XP_009381424.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381425.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ T KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +YKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   QYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009413520.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ T KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +YKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   QYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009404517.1| PREDICTED: 60S ribosomal protein L34 [Musa acuminata subsp. malaccensis]
Length=120

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ T KRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTNKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_006291983.1| hypothetical protein CARUB_v10018171mg, partial [Capsella rubella]
 gb|EOA24881.1| hypothetical protein CARUB_v10018171mg, partial [Capsella rubella]
Length=156

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +1

Query  49   KMVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP  228
            KMVQRL YR RHSYATKSNQHR+VKTPGGKL YQTT KRASGPKCPVTGKRIQGIPHLRP
Sbjct  36   KMVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRP  95

Query  229  AEYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            AEYKRSRLSRN RTVNR YGGVLSG AVRERI+RAF
Sbjct  96   AEYKRSRLSRNERTVNRAYGGVLSGVAVRERIVRAF  131



>ref|XP_009110049.1| PREDICTED: 60S ribosomal protein L34-1-like [Brassica rapa]
 emb|CDY65271.1| BnaCnng46360D [Brassica napus]
Length=120

 Score =   178 bits (452),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIHGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSALAVRERIVRAF  95



>ref|XP_010514604.1| PREDICTED: 60S ribosomal protein L34-3 [Camelina sativa]
 ref|XP_010425679.1| PREDICTED: 60S ribosomal protein L34-3 [Camelina sativa]
Length=120

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTT KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRN RTVNR YGGVLSG AVRERI+RAF
Sbjct  61   EYKRSRLSRNERTVNRAYGGVLSGVAVRERIVRAF  95



>ref|XP_006439595.1| hypothetical protein CICLE_v10022900mg [Citrus clementina]
 gb|ESR52835.1| hypothetical protein CICLE_v10022900mg [Citrus clementina]
Length=97

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSGGAVRER    F
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGGAVRERYASTF  95



>emb|CDY46432.1| BnaA08g19980D [Brassica napus]
Length=120

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIHGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLS  AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSALAVRERIVRAF  95



>gb|AAT38711.2| 60S ribosomal protein L34, putative [Solanum demissum]
Length=126

 Score =   178 bits (452),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 92/101 (91%), Gaps = 6/101 (6%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG------I  213
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKL+YQTTKKRA+GPKCPVTGKRIQG      I
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQTTKKRANGPKCPVTGKRIQGILIGFYI  60

Query  214  PHLRPAEYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            PHLRPAEYKRSRL RNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   PHLRPAEYKRSRLPRNRRTVNRAYGGVLSGSAVRERIIRAF  101



>ref|XP_006659440.1| PREDICTED: 60S ribosomal protein L34-like [Oryza brachyantha]
Length=119

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ  KKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYPKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   EYKRSRLYRNRRTVNRPYGGVLSGTAVRERIIRAF  95



>gb|KHG05666.1| 60S ribosomal protein L34-1 [Gossypium arboreum]
Length=123

 Score =   177 bits (450),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M+QRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MIQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL RN RTVNR YGGVLS  AVRERIIRAF
Sbjct  61   EYKRSRLPRNCRTVNRAYGGVLSCSAVRERIIRAF  95



>ref|XP_006395329.1| hypothetical protein EUTSA_v10005142mg [Eutrema salsugineum]
 gb|ESQ32615.1| hypothetical protein EUTSA_v10005142mg [Eutrema salsugineum]
Length=120

 Score =   177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL +R RHSYATKSNQHR+VKTPGGKL YQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLVFRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGG LSG AVRERI+RAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGALSGVAVRERIVRAF  95



>ref|XP_010523457.1| PREDICTED: 60S ribosomal protein L34-like [Tarenaya hassleriana]
Length=120

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHS+ATKSNQHRVVKTPGG+LVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRGRHSFATKSNQHRVVKTPGGRLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYK SRL+RNRRTVNR YGGVLS  AV+ERIIRAF
Sbjct  61   EYKVSRLARNRRTVNRVYGGVLSSSAVKERIIRAF  95



>ref|NP_189532.1| 60S ribosomal protein L34-3 [Arabidopsis thaliana]
 sp|Q9LJW6.1|RL343_ARATH RecName: Full=60S ribosomal protein L34-3 [Arabidopsis thaliana]
 dbj|BAB02133.1| 60S ribosomal protein L34 [Arabidopsis thaliana]
 gb|AAK76492.1| putative 60S ribosomal protein L34 [Arabidopsis thaliana]
 gb|AAM14298.1| putative 60S ribosomal protein L34 [Arabidopsis thaliana]
 gb|AEE77504.1| 60S ribosomal protein L34-3 [Arabidopsis thaliana]
Length=120

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQTT KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+RN RTVNR YGGVLSG AVRERI+RAF
Sbjct  61   EYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAF  95



>ref|XP_009393697.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG LVYQ T KRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGSLVYQYTNKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +YKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   QYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>ref|XP_009801519.1| PREDICTED: 60S ribosomal protein L34-like [Nicotiana sylvestris]
Length=120

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTY KRH+YATKSNQHRVVKT GGKL+YQ+TKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYWKRHNYATKSNQHRVVKTLGGKLIYQSTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVRERIIRA 
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAL  95



>gb|ABK21342.1| unknown [Picea sitchensis]
 gb|ABK21936.1| unknown [Picea sitchensis]
 gb|ABK26150.1| unknown [Picea sitchensis]
 gb|ABK26719.1| unknown [Picea sitchensis]
 gb|ACN40477.1| unknown [Picea sitchensis]
Length=120

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QRLTYRKRHSYATKSNQ RV+KTPGG+L+YQT KKRASGPKCPVTGKRI GIPHLRPA
Sbjct  1    MAQRLTYRKRHSYATKSNQTRVLKTPGGRLIYQTAKKRASGPKCPVTGKRIHGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRNRRTVNR YGGVLSG AVR+RIIRAF
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRDRIIRAF  95



>ref|XP_010502889.1| PREDICTED: 60S ribosomal protein L34-3-like [Camelina sativa]
Length=120

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL Y  RHSYATKSNQHR+VKTPGGKL YQTT KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYLSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRLSRN RTVNR YGGVLSG AVRERI+RAF
Sbjct  61   EYKRSRLSRNERTVNRAYGGVLSGVAVRERIVRAF  95



>ref|XP_009410005.1| PREDICTED: 60S ribosomal protein L34 [Musa acuminata subsp. malaccensis]
Length=120

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ   KRA+GPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYANKRANGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +YKRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   QYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KJB50657.1| hypothetical protein B456_008G181200 [Gossypium raimondii]
Length=150

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERII  327
            EYKRSRL RNRRTVNR YGGVLSG AVRER +
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRERFV  92



>ref|NP_001077600.1| 60S ribosomal protein L34-1 [Arabidopsis thaliana]
 gb|AEE30754.1| 60S ribosomal protein L34-1 [Arabidopsis thaliana]
Length=96

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP+
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERII  327
            EYKRSRLSRNRRTVNR YGGVLSG AVRER +
Sbjct  61   EYKRSRLSRNRRTVNRAYGGVLSGSAVRERFV  92



>gb|KJB50913.1| hypothetical protein B456_008G192800 [Gossypium raimondii]
Length=90

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRER  321
            EYKRSRL RNRRTVNR YGGVLSG AVRER
Sbjct  61   EYKRSRLPRNRRTVNRAYGGVLSGSAVRER  90



>ref|XP_003540043.1| PREDICTED: 60S ribosomal protein L34-like [Glycine max]
Length=120

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MV+RLTYRKR+SYATKSNQHRVVKTPGGKLVYQTTKKRA+GPKC VTGKR+QGIPHLRP 
Sbjct  1    MVERLTYRKRYSYATKSNQHRVVKTPGGKLVYQTTKKRANGPKCTVTGKRVQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKR RL RNRRTVNR YGGVLSG  VRERIIRAF
Sbjct  61   EYKRLRLPRNRRTVNRAYGGVLSGSVVRERIIRAF  95



>gb|ABD66516.1| ribosomal protein [Gymnadenia conopsea]
Length=120

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ T KRASGPKCPVTGKRI GIP LRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTNKRASGPKCPVTGKRIIGIPRLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +YKRSRLSRNRRTV R YGGVLSGGAVRERIIRAF
Sbjct  61   QYKRSRLSRNRRTVGRAYGGVLSGGAVRERIIRAF  95



>ref|XP_009383241.1| PREDICTED: 60S ribosomal protein L34-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score =   171 bits (432),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRH YATKSNQ RVVKTPGGKLVYQ T KRASGP CPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRKRHGYATKSNQTRVVKTPGGKLVYQYTNKRASGPICPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYKRSRL+R++RTVNR YGGVL+G AV+ERIIRAF
Sbjct  61   EYKRSRLARSQRTVNRAYGGVLAGSAVKERIIRAF  95



>gb|AFW61205.1| hypothetical protein ZEAMMB73_915933 [Zea mays]
Length=90

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRER  321
            EYKRSRL+RN+RTVNRPYGGVLSG AVRER
Sbjct  61   EYKRSRLARNQRTVNRPYGGVLSGTAVRER  90



>gb|AFW57302.1| hypothetical protein ZEAMMB73_857117 [Zea mays]
Length=90

 Score =   169 bits (428),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQGIPHLRPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRER  321
            EYKRSRL+RNRRTVNRPYGGVLSG AVRER
Sbjct  61   EYKRSRLARNRRTVNRPYGGVLSGTAVRER  90



>gb|AAT08730.1| ribosomal protein L34 [Hyacinthus orientalis]
Length=96

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYAT+SNQ RVVKTPGGKL YQT KKRA GP+CPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATRSNQTRVVKTPGGKLTYQTAKKRAKGPRCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRA  333
            EYKRSRL+RNRRTVNR YGGVLSG AV+ERIIRA
Sbjct  61   EYKRSRLARNRRTVNRAYGGVLSGSAVKERIIRA  94



>gb|EMT23852.1| 60S ribosomal protein L34 [Aegilops tauschii]
Length=137

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 91/113 (81%), Gaps = 18/113 (16%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPG------------------GKLVYQTTKKRASGP  177
            MVQRLTYRKRHSYATKSNQ RVVKTPG                  G+LVYQ TKKRASGP
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGLNFTCVLTAPLTVGFILGGRLVYQYTKKRASGP  60

Query  178  KCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            KCPVTGK+IQGIPHLRP EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   KCPVTGKKIQGIPHLRPTEYKRSRLSRNRRTVNRPYGGVLSGPAVRERIIRAF  113



>gb|EMS56163.1| 60S ribosomal protein L34 [Triticum urartu]
Length=142

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 91/118 (77%), Gaps = 23/118 (19%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG-------  210
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQG       
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGGYSISLF  60

Query  211  ----------------IPHLRPAEYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
                            IPHLRP EYKRSRLSRNRRTVNRPYGGVLSG AVRERIIRAF
Sbjct  61   VWWMNWILVLGYYLYVIPHLRPTEYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAF  118



>ref|XP_002877140.1| hypothetical protein ARALYDRAFT_484659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53399.1| hypothetical protein ARALYDRAFT_484659 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score =   167 bits (424),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 86/97 (89%), Gaps = 2/97 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR RHSYATKSNQHR+VKTPGGKL YQ T KRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQKTNKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRER--IIRAF  336
            EYKR RL+RN RTVNR YGGVLSG AVRER  I+RAF
Sbjct  61   EYKRPRLARNERTVNRAYGGVLSGVAVRERQVIVRAF  97



>ref|XP_006383986.1| hypothetical protein POPTR_0004s02890g, partial [Populus trichocarpa]
 gb|ERP61783.1| hypothetical protein POPTR_0004s02890g, partial [Populus trichocarpa]
Length=120

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  58   QRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEY  237
            Q L + KRHSYATKSNQHRVV +P GKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA+Y
Sbjct  4    QLLVHPKRHSYATKSNQHRVVISPCGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAKY  63

Query  238  KRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            KRSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  64   KRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  96



>ref|XP_004956808.1| PREDICTED: 60S ribosomal protein L34-like isoform X1 [Setaria 
italica]
Length=162

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 92/138 (67%), Gaps = 43/138 (31%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPG---------------------------------  132
            MVQRLTYRKRHSYATKSNQ RVVKTPG                                 
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGLDPLLFRSSHPFLLFSFHFWWFLRSALGVVLMC  60

Query  133  ----------GKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRP  282
                      GKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPAEYKRSRLSRNRRTVNRP
Sbjct  61   WIALWLVLAGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPAEYKRSRLSRNRRTVNRP  120

Query  283  YGGVLSGGAVRERIIRAF  336
            YGGVLSG AVRERIIRAF
Sbjct  121  YGGVLSGTAVRERIIRAF  138



>ref|XP_002318778.1| hypothetical protein POPTR_0012s11010g [Populus trichocarpa]
 gb|EEE96998.1| hypothetical protein POPTR_0012s11010g [Populus trichocarpa]
Length=110

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 83/95 (87%), Gaps = 10/95 (11%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG       
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG-------  53

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
               RSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  54   ---RSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  85



>gb|EMS64887.1| 60S ribosomal protein L34 [Triticum urartu]
Length=161

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 91/137 (66%), Gaps = 42/137 (31%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG-------  210
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQG       
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGRLLLEFS  60

Query  211  -----------------------------------IPHLRPAEYKRSRLSRNRRTVNRPY  285
                                               IPHLRP EYKRSRLSRNRRTVNRPY
Sbjct  61   NFTALIINRLVRMQNWLHTTVVLLQPSVLCRWFDIIPHLRPTEYKRSRLSRNRRTVNRPY  120

Query  286  GGVLSGGAVRERIIRAF  336
            GGVLSG AVRERIIRAF
Sbjct  121  GGVLSGQAVRERIIRAF  137



>ref|XP_001762793.1| predicted protein [Physcomitrella patens]
 gb|EDQ72294.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH YATKSNQ RVVKTPGGK V+QT  KRA GPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLTYRRRHCYATKSNQTRVVKTPGGKNVFQTATKRARGPKCPVTGKRIAGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYK SRL R+R+TVNR YGG ++G AVRERIIRAF
Sbjct  61   EYKTSRLHRHRKTVNRAYGGTMAGSAVRERIIRAF  95



>ref|XP_001751741.1| predicted protein [Physcomitrella patens]
 gb|EDQ83176.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH YATKSNQ RVVKTPGGK V+QT  KRA GPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLTYRRRHCYATKSNQTRVVKTPGGKNVFQTATKRARGPKCPVTGKRIAGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYK SRL R+R+TVNR YGG ++G AVRERIIRAF
Sbjct  61   EYKTSRLHRHRKTVNRAYGGTMAGSAVRERIIRAF  95



>ref|XP_001765474.1| predicted protein [Physcomitrella patens]
 gb|EDQ69735.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH YATKSNQ RVVKTPGGK V+QT  KRA GPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLTYRRRHCYATKSNQTRVVKTPGGKNVFQTATKRARGPKCPVTGKRIAGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYK SRL R+++TVNR YGG ++G AVRERIIRAF
Sbjct  61   EYKTSRLHRHKKTVNRAYGGTMAGSAVRERIIRAF  95



>ref|XP_010907733.1| PREDICTED: 60S ribosomal protein L34-like [Elaeis guineensis]
Length=120

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ T KRASGP+CPVTGKRIQGIPH RPA
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTNKRASGPRCPVTGKRIQGIPHRRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY+RSRLSRNRRTVNR YGGVLSG AVRERIIRAF
Sbjct  61   EYRRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAF  95



>gb|KJB50911.1| hypothetical protein B456_008G192800 [Gossypium raimondii]
Length=91

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/82 (94%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR RHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA
Sbjct  1    MVQRLTYRTRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVL  297
            EYKRSRL RNRRTVNR YGG  
Sbjct  61   EYKRSRLPRNRRTVNRAYGGSF  82



>ref|XP_001759832.1| predicted protein [Physcomitrella patens]
 gb|EDQ75336.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   155 bits (391),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH YA+KSNQ RVVKTPGGK V+QT  KRA GPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLTYRRRHCYASKSNQTRVVKTPGGKNVFQTAIKRARGPKCPVTGKRIAGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYK SRL R+R+TVNR YGG +SG AVRERIIRAF
Sbjct  61   EYKTSRLHRHRKTVNRAYGGNMSGSAVRERIIRAF  95



>ref|XP_001776049.1| predicted protein [Physcomitrella patens]
 gb|EDQ59094.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH YATKSNQ RVVKTPGG+ V+QT  KRA+GPKCPV+GKRI GIPHLRP 
Sbjct  1    MVQRLTYRRRHCYATKSNQTRVVKTPGGRNVFQTATKRAAGPKCPVSGKRIAGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EYK SRL R+++TVNR YGG L+G AVRERIIRAF
Sbjct  61   EYKTSRLHRHKKTVNRAYGGNLAGSAVRERIIRAF  95



>ref|XP_001759827.1| predicted protein [Physcomitrella patens]
 gb|EDQ75331.1| predicted protein [Physcomitrella patens]
Length=122

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH YATKSNQ RVVKTPGGK V+QT  KRA GPKCPVTGKRI GIPHLRP 
Sbjct  1    MVQRLTYRRRHCYATKSNQTRVVKTPGGKNVFQTATKRARGPKCPVTGKRIAGIPHLRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY+ SRL R+++TVNR YGG L+G AVRERIIRAF
Sbjct  61   EYRTSRLHRHKKTVNRAYGGNLAGSAVRERIIRAF  95



>gb|ABA27086.1| TO121-23 [Taraxacum officinale]
Length=74

 Score =   148 bits (374),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/74 (99%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP 
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPT  60

Query  232  EYKRSRLSRNRRTV  273
            EYKRSRLSRNRRTV
Sbjct  61   EYKRSRLSRNRRTV  74



>gb|AAO19740.1| 60S ribosomal protein L34, partial [Orobanche cernua var. cumana]
Length=102

 Score =   144 bits (362),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  106  QHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPY  285
            Q RVVKTPGGKLVY++TKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRL RNRRTV RPY
Sbjct  1    QRRVVKTPGGKLVYRSTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVTRPY  60

Query  286  GGVLSGGAVRERIIRAF  336
            GGVLSG AVRERIIRAF
Sbjct  61   GGVLSGIAVRERIIRAF  77



>ref|XP_011468660.1| PREDICTED: 60S ribosomal protein L34-like [Fragaria vesca subsp. 
vesca]
Length=168

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  121  KTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLS  300
            + PGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNR YGGVLS
Sbjct  72   QNPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGGVLS  131

Query  301  GGAVRERIIRAF  336
            GGAVRERIIRAF
Sbjct  132  GGAVRERIIRAF  143



>ref|XP_008804557.1| PREDICTED: 60S ribosomal protein L34-like [Phoenix dactylifera]
Length=110

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/75 (91%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  112  RVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPYGG  291
            R   T GGKLVYQ TKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNR YGG
Sbjct  11   RCFDTAGGKLVYQYTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGG  70

Query  292  VLSGGAVRERIIRAF  336
            VLSG AVRERIIRAF
Sbjct  71   VLSGSAVRERIIRAF  85



>gb|AFW62295.1| hypothetical protein ZEAMMB73_590401 [Zea mays]
Length=174

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  130  GGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLSGGA  309
            GGKLVYQ TKKRASGPKCPVTGK+IQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLSG A
Sbjct  82   GGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLSGIA  141

Query  310  VRERIIRAF  336
            VRERIIRAF
Sbjct  142  VRERIIRAF  150



>ref|XP_007158654.1| hypothetical protein PHAVU_002G171200g, partial [Phaseolus vulgaris]
 gb|ESW30648.1| hypothetical protein PHAVU_002G171200g, partial [Phaseolus vulgaris]
Length=93

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/68 (96%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  133  GKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLSGGAV  312
            GKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRL RNRRTVNR YGGVLSG AV
Sbjct  1    GKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGSAV  60

Query  313  RERIIRAF  336
            RERIIRAF
Sbjct  61   RERIIRAF  68



>ref|XP_006373970.1| hypothetical protein POPTR_0016s11840g, partial [Populus trichocarpa]
 gb|ERP51767.1| hypothetical protein POPTR_0016s11840g, partial [Populus trichocarpa]
Length=103

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 71/93 (76%), Gaps = 15/93 (16%)
 Frame = +1

Query  58   QRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEY  237
            Q L + KRHSYATKSNQHR+V TPGGKLVYQTTKKRASGPK               PAEY
Sbjct  2    QLLVHPKRHSYATKSNQHRMVITPGGKLVYQTTKKRASGPK---------------PAEY  46

Query  238  KRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            KRSRLSRNRRTVNR YGGVLSG AVRERII AF
Sbjct  47   KRSRLSRNRRTVNRAYGGVLSGSAVRERIIWAF  79



>ref|XP_002980840.1| hypothetical protein SELMODRAFT_113433 [Selaginella moellendorffii]
 ref|XP_002989365.1| hypothetical protein SELMODRAFT_129627 [Selaginella moellendorffii]
 gb|EFJ09639.1| hypothetical protein SELMODRAFT_129627 [Selaginella moellendorffii]
 gb|EFJ18025.1| hypothetical protein SELMODRAFT_113433 [Selaginella moellendorffii]
Length=90

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QRLTYR+RHSYAT+SNQ +VV+TPGG+LVYQT  K+A GP+C +T K I G+P LRP 
Sbjct  1    MAQRLTYRRRHSYATRSNQTKVVRTPGGRLVYQTATKKAKGPRCAITKKPIIGVPRLRPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRER  321
            EYKRSR++R++++++R YGG +S  AVRER
Sbjct  61   EYKRSRIARHKKSISRAYGGSMSASAVRER  90



>ref|XP_011398868.1| 60S ribosomal protein L34 [Auxenochlorella protothecoides]
 gb|KFM25972.1| 60S ribosomal protein L34 [Auxenochlorella protothecoides]
Length=129

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSY TKSN+ R+VKTPGGKLVYQ   K AS P CP++G+R+ G+P +RP 
Sbjct  1    MVQRLTYRRRHSYHTKSNRQRIVKTPGGKLVYQRQVKPASFPVCPISGQRLNGLPAVRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   SRL+++++TV R YGG L+ G VRERIIRAF
Sbjct  61   EL--SRLNKSKKTVQRAYGGHLAAGVVRERIIRAF  93



>ref|XP_003621256.1| 60S ribosomal protein L34 [Medicago truncatula]
 gb|AES77474.1| 60S ribosomal L34-like protein [Medicago truncatula]
Length=102

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 65/95 (68%), Gaps = 16/95 (17%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MV R TY  RH+Y TK NQHRVVKTPGG+LVY TTKKRAS P CP               
Sbjct  1    MVHRFTYCNRHTYTTKFNQHRVVKTPGGRLVYHTTKKRASEPMCP---------------  45

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
             YKRSRL RNR TVN  YGG+LSGGAVRE IIRAF
Sbjct  46   -YKRSRLPRNRSTVNCAYGGILSGGAVREMIIRAF  79



>ref|XP_006361895.1| PREDICTED: 60S ribosomal protein L34-like [Solanum tuberosum]
Length=102

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  166  ASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            A+GPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNR YGGVLSGGAVRERI+RAF
Sbjct  21   ANGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGGVLSGGAVRERIVRAF  77



>ref|XP_005850425.1| hypothetical protein CHLNCDRAFT_20596 [Chlorella variabilis]
 gb|EFN58323.1| hypothetical protein CHLNCDRAFT_20596 [Chlorella variabilis]
Length=171

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYATKSN+ RV++TPGGKL  QT KK+ + P CP++G+R+ G+P +RP 
Sbjct  1    MVQRLTYRRRHSYATKSNKQRVLRTPGGKLTLQTVKKKTTHPTCPISGQRLHGLPAVRPG  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
               R+  +++++TV+R YGG L+ G V++RI+RAF
Sbjct  61   SLHRT--NKSKKTVHRAYGGHLAAGVVKDRIVRAF  93



>gb|ACO14672.1| 60S ribosomal protein L34 [Caligus clemensi]
Length=116

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQR+TYR+R SY T+SN+ +V++TPGGKLV+Q  KKR S PKCP+TG +++GI   RPA
Sbjct  1    MVQRITYRRRLSYNTRSNRRKVIRTPGGKLVFQYLKKRPSVPKCPMTGLKLKGIKPSRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  R RLSR ++ V R YGGVLS  AV+E+IIRAF
Sbjct  61   E--RKRLSRRQKKVYRAYGGVLSHQAVKEKIIRAF  93



>gb|ACO13005.1| 60S ribosomal protein L34 [Lepeophtheirus salmonis]
Length=118

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQR+TYR+R SY TKSN+ +V++TPGGKLV+Q  KKR S PKCP+TG R++GI   RPA
Sbjct  1    MVQRITYRRRLSYNTKSNRRKVIRTPGGKLVFQYLKKRPSVPKCPMTGLRLKGIKPSRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +  R RL +  R V R YGGVLS  AV+E+IIRAF
Sbjct  61   D--RKRLYKRERKVYRAYGGVLSHQAVKEKIIRAF  93



>ref|XP_001751736.1| predicted protein [Physcomitrella patens]
 gb|EDQ83171.1| predicted protein, partial [Physcomitrella patens]
Length=102

 Score =   112 bits (281),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +1

Query  88   YATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRR  267
            Y TKS Q RVV+ P GK V+QT  KRA GPKCPVT KRI GI HLRP EYK S L R+R+
Sbjct  1    YTTKSKQTRVVEIPSGKNVFQTATKRARGPKCPVTRKRIAGISHLRPTEYKASHLHRHRK  60

Query  268  TVNRPYGGVLSGGAVRERIIRAF  336
            T+NR  GG ++G AVRERII+AF
Sbjct  61   TINRANGGTMAGSAVRERIIQAF  83



>gb|AFK44937.1| unknown [Lotus japonicus]
Length=114

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH+YAT SN+ +VVKTPGGKL Y   KK AS  KC +  + IQGIP LRP 
Sbjct  1    MVQRLTYRRRHAYATASNKVKVVKTPGGKLTYHYQKKNASPKKCGLCPQIIQGIPVLRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY  SRLS+  +TV+R YGGV     VRERI+RAF
Sbjct  61   EY--SRLSKREKTVSRAYGGVNCAQCVRERIVRAF  93



>gb|ACO10322.1| 60S ribosomal protein L34 [Caligus rogercresseyi]
Length=116

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQR+TYR+R SY T+SN+ ++++TPGGKLV+Q  KKR S PKCP+TG R++GI   RPA
Sbjct  1    MVQRITYRRRLSYNTRSNRRKIIRTPGGKLVFQYLKKRPSVPKCPMTGLRLKGIKPSRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  R RLS  ++ V R YGGVLS  AV+E+IIRAF
Sbjct  61   E--RKRLSLRQKKVFRAYGGVLSHMAVKEKIIRAF  93



>ref|XP_005646616.1| hypothetical protein COCSUDRAFT_16876 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22072.1| hypothetical protein COCSUDRAFT_16876 [Coccomyxa subellipsoidea 
C-169]
Length=177

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RHSYAT+SN+ R VKTPGGKLV+Q T+K+ S   C  TG R+ GIP LRP 
Sbjct  1    MVQRLTYRRRHSYATRSNKVRKVKTPGGKLVFQYTRKKPSPRICGATGVRLNGIPSLRPK  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E    +LSR  +TV+R YGG LS   V++RI+RAF
Sbjct  61   EMSNRQLSRPSKTVHRIYGGHLSHAVVKDRIVRAF  95



>gb|KDO82918.1| hypothetical protein CISIN_1g0334121mg, partial [Citrus sinensis]
Length=53

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 53/53 (100%), Gaps = 0/53 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQG  210
            MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQ+TKKRASGPKCPVTGKRIQG
Sbjct  1    MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQSTKKRASGPKCPVTGKRIQG  53



>gb|KIZ06472.1| 60S ribosomal protein L34 [Monoraphidium neglectum]
Length=111

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH Y + SN+ RVVKTPGGKLV Q  KK    PKC  TG R+ G+P  RPA
Sbjct  1    MVQRLTYRRRHCYNSASNRTRVVKTPGGKLVVQYQKKPTKHPKCAATGVRLHGLPQRRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
                +RLS+ +++VNR YGG LS   V+ERI+RAF
Sbjct  61   TL--ARLSKRQKSVNRIYGGALSHAVVKERIVRAF  93



>gb|EPB80124.1| ribosomal protein L34e [Ancylostoma ceylanicum]
Length=113

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R SY TKSN+ ++VKTPGG+LV+Q  KKR S PKC  TG ++ GI   RP 
Sbjct  1    MAQRVTYRRRLSYNTKSNKAKIVKTPGGRLVFQYLKKRGSVPKCKDTGVKLHGITPARPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   +RL +N+RTV+R YGG LS  AV+ERIIR+F
Sbjct  61   EL--TRLKKNQRTVSRTYGGCLSPNAVKERIIRSF  93



>gb|EYC13581.1| hypothetical protein Y032_0043g796 [Ancylostoma ceylanicum]
Length=141

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R SY TKSN+ ++VKTPGG+LV+Q  KKR S PKC  TG ++ GI   RP 
Sbjct  29   MAQRVTYRRRLSYNTKSNKAKIVKTPGGRLVFQYLKKRGSVPKCKDTGVKLHGITPARPR  88

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   +RL +N+RTV+R YGG LS  AV+ERIIR+F
Sbjct  89   EL--TRLKKNQRTVSRTYGGCLSPNAVKERIIRSF  121



>gb|EYC13582.1| hypothetical protein Y032_0043g796 [Ancylostoma ceylanicum]
Length=155

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R SY TKSN+ ++VKTPGG+LV+Q  KKR S PKC  TG ++ GI   RP 
Sbjct  43   MAQRVTYRRRLSYNTKSNKAKIVKTPGGRLVFQYLKKRGSVPKCKDTGVKLHGITPARPR  102

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   +RL +N+RTV+R YGG LS  AV+ERIIR+F
Sbjct  103  EL--TRLKKNQRTVSRTYGGCLSPNAVKERIIRSF  135



>emb|CDJ80770.1| Ribosomal protein L34e domain containing protein [Haemonchus 
contortus]
Length=113

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R SY T+SN+ ++VKTPGG+L+YQ  KKR S P+C  TG ++ GI   RP 
Sbjct  1    MAQRVTYRRRLSYNTRSNKCKIVKTPGGRLIYQYLKKRGSVPRCKDTGVKLHGITPARPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   +RL +N+RTV+R YGG LS  AV+ERIIR+F
Sbjct  61   EL--TRLKKNQRTVSRTYGGCLSPNAVKERIIRSF  93



>gb|ETN74517.1| ribosomal protein L34e [Necator americanus]
Length=162

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R SY TKSN+ ++VKTPGG+LV+Q  KKR S P+C  TG ++ GI   RP 
Sbjct  50   MAQRVTYRRRLSYNTKSNKAKIVKTPGGRLVFQYLKKRGSVPRCKDTGVKLHGITPARPR  109

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   +RL +N+RTV+R YGG LS  AV+ERIIR+F
Sbjct  110  EL--TRLKKNQRTVSRTYGGCLSPNAVKERIIRSF  142



>emb|CBY09263.1| unnamed protein product [Oikopleura dioica]
Length=112

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R +Y T SN  ++VKTPGGKLVYQ  KK AS P C  T K ++G+  +RP 
Sbjct  1    MVQRLTYRRRLAYNTASNGRKIVKTPGGKLVYQRVKKAASVPICGDTKKPLRGVRAVRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E   S+LSR ++TV+R YGG LSG AVR RI+RAF
Sbjct  61   EA--SKLSRRQKTVSRAYGGTLSGSAVRSRIVRAF  93



>emb|CAR63541.1| putative Ribosomal Protein [Angiostrongylus cantonensis]
Length=112

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R SY T+SN+ ++VKTPGG+LVYQ  KKR S P+C  TG ++ GI   RP 
Sbjct  1    MAQRVTYRRRLSYNTRSNKAKIVKTPGGRLVYQYLKKRGSVPRCKDTGVKLHGITPARPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E +  RL +N+RTV+R YGG LS  AV+ERI+R+F
Sbjct  61   ELR--RLKKNQRTVSRAYGGCLSPNAVKERILRSF  93



>tpg|DAA61430.1| TPA: hypothetical protein ZEAMMB73_025341 [Zea mays]
Length=75

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGI  213
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQG+
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGV  54



>gb|KIY98731.1| hypothetical protein MNEG_9232 [Monoraphidium neglectum]
Length=391

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+RH Y + SN+ RVVKTPGGKLV Q  KK    PKC  TG R+ G+P  RPA
Sbjct  1    MVQRLTYRRRHCYNSASNRTRVVKTPGGKLVVQYQKKPTKHPKCAATGVRLHGLPQRRPA  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
                +RLS+ +++VNR YGG LS   V+ERI+RAF
Sbjct  61   TL--ARLSKRQKSVNRIYGGALSHAVVKERIVRAF  93



>gb|AFW61204.1| hypothetical protein ZEAMMB73_915933 [Zea mays]
Length=84

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGI  213
            MVQRLTYRKRHSYATKSNQ RVVKTPGGKLVYQ TKKRASGPKCPVTGK+IQG+
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGV  54



>gb|ACC77573.1| ribosomal protein L34 [Ceratitis capitata]
Length=126

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLT R+R SY TKSN+ R+V+TPGG+LVYQ  KK  + PKC    ++++GI   RP 
Sbjct  1    MVQRLTLRRRLSYNTKSNRRRIVRTPGGRLVYQYVKKNKTVPKCGQCKEKLKGIRPTRPC  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSRLS+ ++TV R YGGVL  G +RERI+RAF
Sbjct  61   E--RSRLSKRQKTVARTYGGVLCHGCLRERIVRAF  93



>gb|AAY43421.1| ribosomal protein L34 [Phytophthora infestans]
Length=117

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = +1

Query  61   RLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYK  240
            R+TYR+RHSYATKSN  + VKTPGGKLV Q  KKRA+GPKC    + ++GI HL+  EYK
Sbjct  6    RITYRRRHSYATKSNAIKAVKTPGGKLVAQYIKKRAAGPKCGDCKQTLKGIKHLQSKEYK  65

Query  241  RSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
               +S+ +RTV+R YGG      VR+RI+RAF
Sbjct  66   --NVSKTQRTVSRAYGGSRCALCVRQRIVRAF  95



>ref|XP_004536191.1| PREDICTED: 60S ribosomal protein L34-like isoform X1 [Ceratitis 
capitata]
 ref|XP_004536192.1| PREDICTED: 60S ribosomal protein L34-like isoform X2 [Ceratitis 
capitata]
Length=151

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLT R+R SY TKSN+ R+V+TPGG+LVYQ  KK  + PKC    ++++GI   RP 
Sbjct  1    MVQRLTLRRRLSYNTKSNRRRIVRTPGGRLVYQYVKKNKTVPKCGQCKEKLKGIRPTRPC  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSRLS+ ++TV R YGGVL  G +RERI+RAF
Sbjct  61   E--RSRLSKRQKTVARTYGGVLCHGCLRERIVRAF  93



>gb|EAZ05646.1| hypothetical protein OsI_27865 [Oryza sativa Indica Group]
Length=68

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRP  228
            MVQRLTYRKRHSYATKSNQ RVVKTPGG+LVYQ TKKRASGPKCPVTGK+IQG+    P
Sbjct  1    MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGVCAANP  59



>gb|EPX73799.1| 60S ribosomal protein L34 [Schizosaccharomyces octosporus yFS286]
Length=112

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R +Y T+SN+ R++KTPG KL Y   KK  + P+C  TG  +QGIP LRP 
Sbjct  1    MAQRVTYRRRLAYNTRSNKTRIIKTPGNKLRYLHIKKLGTIPRCGDTGVPLQGIPALRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E+  +RLS N++TV R YGG LS  AV++RI+RAF
Sbjct  61   EF--ARLSHNKKTVQRAYGGNLSANAVKDRIVRAF  93



>ref|XP_008905063.1| hypothetical protein PPTG_11487 [Phytophthora parasitica INRA-310]
 gb|ETI47514.1| hypothetical protein F443_08294 [Phytophthora parasitica P1569]
 gb|ETK87453.1| hypothetical protein L915_08125 [Phytophthora parasitica]
 gb|ETL40877.1| hypothetical protein L916_08047 [Phytophthora parasitica]
 gb|ETL94036.1| hypothetical protein L917_07941 [Phytophthora parasitica]
 gb|ETM47272.1| hypothetical protein L914_08007 [Phytophthora parasitica]
 gb|ETN09917.1| hypothetical protein PPTG_11487 [Phytophthora parasitica INRA-310]
 gb|ETO76235.1| hypothetical protein F444_08357 [Phytophthora parasitica P1976]
 gb|ETP17309.1| hypothetical protein F441_08276 [Phytophthora parasitica CJ01A1]
 gb|ETP45360.1| hypothetical protein F442_08239 [Phytophthora parasitica P10297]
Length=117

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 2/92 (2%)
 Frame = +1

Query  61   RLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYK  240
            R+TYR+RHSYATKSN  + VKTPGGKLV Q  KKRA+GPKC    + ++GI HL+  EYK
Sbjct  6    RITYRRRHSYATKSNAIKAVKTPGGKLVAQYRKKRAAGPKCGDCKQTLKGIKHLQSKEYK  65

Query  241  RSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
               +S+ +RTV+R YGG      VR+RI+RAF
Sbjct  66   --NVSKTQRTVSRAYGGSRCALCVRQRIVRAF  95



>gb|EPX70997.1| 60S ribosomal protein L34 [Schizosaccharomyces octosporus yFS286]
Length=112

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R +Y T+SN+ R++KTPG KL Y   KK  + P+C  TG  +QGIP LRP 
Sbjct  1    MAQRVTYRRRLAYNTRSNKTRIIKTPGNKLRYLHIKKLGTIPRCGDTGVPLQGIPALRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E+  +RLS N++TV R YGG LS  AV++RI+RAF
Sbjct  61   EF--ARLSHNKKTVQRAYGGNLSANAVKDRIVRAF  93



>gb|KFH63161.1| 50S ribosomal protein L34e, variant [Mortierella verticillata 
NRRL 6337]
 gb|KFH63162.1| 50S ribosomal protein L34e [Mortierella verticillata NRRL 6337]
 gb|KFH74039.1| 50S ribosomal protein L34e [Mortierella verticillata NRRL 6337]
Length=119

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QRLTYR+R SY TKSN+ RVVKTPGG+L +   KK  + PKC   G  + G+P LRP 
Sbjct  1    MAQRLTYRRRLSYNTKSNRTRVVKTPGGRLTWLYEKKPGTAPKCGDCGVALPGVPALRPT  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY  +R+SR ++TVNR YGG      VR+RI+RAF
Sbjct  61   EY--ARISRRQKTVNRAYGGSRCANCVRDRIVRAF  93



>ref|XP_003702766.1| PREDICTED: 60S ribosomal protein L34-like [Megachile rotundata]
 ref|XP_012139516.1| PREDICTED: 60S ribosomal protein L34-like [Megachile rotundata]
 ref|XP_012139517.1| PREDICTED: 60S ribosomal protein L34-like [Megachile rotundata]
Length=116

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>emb|CEP60062.1| LALA0S01e02168g1_1 [Lachancea lanzarotensis]
Length=126

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQR+TYR+R+ Y T+SN+ +VVKTPGG L  Q TKK A+ PKC  TG  +QGI  LRP 
Sbjct  1    MVQRVTYRRRNPYNTRSNKIKVVKTPGGVLRAQHTKKLATRPKCGDTGVPLQGISTLRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +Y  + +S+ ++TV+R YGGVL   AV+ERI+RAF
Sbjct  61   QY--ATISKTKKTVSRAYGGVLCANAVKERIVRAF  93



>ref|XP_011157318.1| PREDICTED: 60S ribosomal protein L34-like [Solenopsis invicta]
 ref|XP_011643612.1| PREDICTED: 60S ribosomal protein L34-like [Pogonomyrmex barbatus]
 ref|XP_011700055.1| PREDICTED: 60S ribosomal protein L34-like [Wasmannia auropunctata]
 gb|EFZ19578.1| hypothetical protein SINV_03395, partial [Solenopsis invicta]
Length=119

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_011269324.1| PREDICTED: 60S ribosomal protein L34-like [Camponotus floridanus]
 gb|EFN72752.1| 60S ribosomal protein L34 [Camponotus floridanus]
Length=119

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_011150097.1| PREDICTED: 60S ribosomal protein L34-like [Harpegnathos saltator]
 gb|EFN77532.1| 60S ribosomal protein L34 [Harpegnathos saltator]
Length=119

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_011050156.1| PREDICTED: 60S ribosomal protein L34-like [Acromyrmex echinatior]
 ref|XP_012064202.1| PREDICTED: 60S ribosomal protein L34-like [Atta cephalotes]
 gb|EGI70879.1| 60S ribosomal protein L34 [Acromyrmex echinatior]
Length=119

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_011344554.1| PREDICTED: 60S ribosomal protein L34-like [Cerapachys biroi]
 gb|EZA50747.1| 60S ribosomal protein L34 [Cerapachys biroi]
Length=119

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ R+V+TPGGKLVYQ  KK    P+C    ++++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRIVRTPGGKLVYQYLKKPKKIPRCGQCKEKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_003494912.1| PREDICTED: 60S ribosomal protein L34-like [Bombus impatiens]
Length=118

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_011297499.1| PREDICTED: 60S ribosomal protein L34-like [Fopius arisanus]
Length=119

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_003400365.1| PREDICTED: 60S ribosomal protein L34-like [Bombus terrestris]
Length=118

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_001121176.1| PREDICTED: 60S ribosomal protein L34 isoformX1 [Apis mellifera]
 ref|XP_006565805.1| PREDICTED: 60S ribosomal protein L34 isoform X2 [Apis mellifera]
 ref|XP_006612728.1| PREDICTED: 60S ribosomal protein L34-like [Apis dorsata]
Length=118

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_003694750.1| PREDICTED: 60S ribosomal protein L34-like [Apis florea]
Length=124

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>gb|EPY50643.1| 60S ribosomal protein L34 [Schizosaccharomyces cryophilus OY26]
Length=112

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R +Y T+SN+ R++KTPG K+ Y   KK  + P+C  TG  +QGIP LRP 
Sbjct  1    MAQRVTYRRRLAYNTRSNKTRIIKTPGNKVRYLHIKKLGTIPRCGDTGVPLQGIPALRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E+  +RLS N++TV R YGG LS  AV++RI+RAF
Sbjct  61   EF--ARLSHNKKTVQRAYGGNLSANAVKDRIVRAF  93



>ref|XP_001601949.1| PREDICTED: 60S ribosomal protein L34-like [Nasonia vitripennis]
Length=119

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGV+    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVMCHKCVKERIVRAF  93



>ref|XP_011870014.1| PREDICTED: 60S ribosomal protein L34-like [Vollenhovia emeryi]
 ref|XP_011870015.1| PREDICTED: 60S ribosomal protein L34-like [Vollenhovia emeryi]
Length=119

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ R+V+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRIVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPK  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVLCHKCVKERIVRAF  93



>ref|XP_011500541.1| PREDICTED: 60S ribosomal protein L34-like [Ceratosolen solmsi 
marchali]
Length=119

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLTYR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGV+    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRVYGGVMCHKCVKERIVRAF  93



>ref|XP_459104.1| 60S ribosomal protein L34 [Debaryomyces hansenii CBS767]
 emb|CAG87272.1| DEHA2D14410p [Debaryomyces hansenii CBS767]
Length=122

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R+ Y TKSN+ +VVKTPGGKLV Q  KK AS PKC   G  +QGI  LRP 
Sbjct  1    MAQRVTYRRRNPYNTKSNKIKVVKTPGGKLVAQHVKKLASRPKCGDCGDALQGISTLRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            EY  +++S+  +TV R YGG      V+ERI+RAF
Sbjct  61   EY--AQVSKTHKTVQRAYGGSRCANCVKERIVRAF  93



>ref|XP_011207015.1| PREDICTED: 60S ribosomal protein L34 [Bactrocera dorsalis]
Length=151

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRLT R+R SY TKSN+ R+V+TPGG+LVYQ  KK  + PKC    ++++GI   RP 
Sbjct  1    MVQRLTLRRRLSYNTKSNRRRIVRTPGGRLVYQYVKKNKTVPKCGQCKEKLKGIRPTRPC  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSRLS+ ++TV R YGGVL    +RERI+RAF
Sbjct  61   E--RSRLSKRQKTVARTYGGVLCHSCLRERIVRAF  93



>gb|EPY51448.1| 60S ribosomal protein L34 [Schizosaccharomyces cryophilus OY26]
Length=112

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R +Y T+SN+ R++KTPG K+ Y   KK  + P+C  TG  +QGIP LRP 
Sbjct  1    MAQRVTYRRRLAYNTRSNKTRIIKTPGNKVRYLHIKKLGTIPRCGDTGVPLQGIPALRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E+  +RL  N++TV R YGG LS  AV++RIIRAF
Sbjct  61   EF--ARLPHNKKTVQRAYGGCLSANAVKDRIIRAF  93



>ref|NP_594438.1| 60S ribosomal protein L34 [Schizosaccharomyces pombe 972h-]
 sp|O42846.1|RL34A_SCHPO RecName: Full=60S ribosomal protein L34-A [Schizosaccharomyces 
pombe 972h-]
 emb|CAA16982.1| 60S ribosomal protein L34 [Schizosaccharomyces pombe]
Length=112

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+TYR+R +Y T+SN+ R++KTPG  + Y   KK  + P+C  TG  +QGIP LRP 
Sbjct  1    MAQRVTYRRRLAYNTRSNRTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E+  +RLS N++TV R YGG LS  AV++RI+RAF
Sbjct  61   EF--ARLSHNKKTVQRAYGGCLSANAVKDRIVRAF  93



>ref|XP_007842997.1| 60s ribosomal protein l34-b [Moniliophthora roreri MCA 2997]
 gb|ESK97717.1| 60s ribosomal protein l34-b [Moniliophthora roreri MCA 2997]
Length=111

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            M QR+T RKR  Y TKS+  RVVKTPGG L+Y T KKRAS PKC   G  + GIP LRP 
Sbjct  1    MAQRVTLRKRQPYNTKSSGRRVVKTPGGSLIYHTVKKRASAPKCGDCGLALPGIPALRPR  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            +Y  + +S+ +++VNR YGG   G  V++RI+RAF
Sbjct  61   QY--ATISKRQKSVNRAYGGARCGICVKQRILRAF  93



>gb|KDR24050.1| 60S ribosomal protein L34 [Zootermopsis nevadensis]
Length=119

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = +1

Query  52   MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPA  231
            MVQRL YR+R SY TKSN+ RVV+TPGGKLVYQ  KK    P+C     +++GI   RP 
Sbjct  1    MVQRLVYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM  60

Query  232  EYKRSRLSRNRRTVNRPYGGVLSGGAVRERIIRAF  336
            E  RSR+ R ++TV R YGGVL    V+ERI+RAF
Sbjct  61   E--RSRMCRRKKTVKRAYGGVLCHKCVKERIVRAF  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1161397529311