BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8197

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621777.1|  PREDICTED: putative calcium-binding protein ...    194   1e-57   Nicotiana tomentosiformis
ref|XP_009787348.1|  PREDICTED: putative calcium-binding protein ...    192   5e-57   Nicotiana sylvestris
ref|XP_009778709.1|  PREDICTED: putative calcium-binding protein ...    191   1e-56   Nicotiana sylvestris
ref|XP_009596232.1|  PREDICTED: putative calcium-binding protein ...    189   3e-56   
gb|AFU81780.1|  regulator of gene silencing                             189   4e-56   Nicotiana benthamiana
ref|XP_009596235.1|  PREDICTED: putative calcium-binding protein ...    189   6e-56   Nicotiana tomentosiformis
gb|AAK11255.1|AF329729_1  regulator of gene silencing                   188   1e-55   Nicotiana tabacum [American tobacco]
ref|XP_009631063.1|  PREDICTED: putative calcium-binding protein ...    188   2e-55   Nicotiana tomentosiformis
ref|XP_004251211.1|  PREDICTED: putative calcium-binding protein ...    187   6e-55   Solanum lycopersicum
ref|XP_004241366.1|  PREDICTED: putative calcium-binding protein ...    186   7e-55   Solanum lycopersicum
ref|XP_006340311.1|  PREDICTED: calcium-binding protein CML37-like      186   1e-54   Solanum tuberosum [potatoes]
ref|XP_006340309.1|  PREDICTED: calcium-binding protein CML37-like      186   2e-54   Solanum tuberosum [potatoes]
gb|AAM95458.1|  calmodulin-like protein                                 185   2e-54   Datura metel
ref|XP_006361118.1|  PREDICTED: calcium-binding protein CML38-like      185   3e-54   Solanum tuberosum [potatoes]
ref|XP_009778710.1|  PREDICTED: putative calcium-binding protein ...    185   3e-54   Nicotiana sylvestris
ref|XP_009596233.1|  PREDICTED: putative calcium-binding protein ...    181   1e-52   Nicotiana tomentosiformis
ref|XP_006340440.1|  PREDICTED: calcium-binding protein CML37-like      182   3e-52   Solanum tuberosum [potatoes]
ref|XP_006340310.1|  PREDICTED: calcium-binding protein CML38-like      179   4e-52   
ref|NP_001234570.1|  regulator of gene silencing                        177   4e-51   Solanum lycopersicum
ref|XP_011464987.1|  PREDICTED: putative calcium-binding protein ...    167   1e-47   Fragaria vesca subsp. vesca
ref|XP_002509541.1|  Polcalcin Jun o, putative                          164   6e-47   Ricinus communis
ref|XP_010270643.1|  PREDICTED: calcium-binding protein CML38-like      163   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_002277499.1|  PREDICTED: putative calcium-binding protein ...    161   3e-45   Vitis vinifera
emb|CBI40801.3|  unnamed protein product                                162   3e-45   Vitis vinifera
ref|XP_010911621.1|  PREDICTED: putative calcium-binding protein ...    159   3e-44   Elaeis guineensis
ref|XP_008374254.1|  PREDICTED: putative calcium-binding protein ...    157   3e-44   Malus domestica [apple tree]
ref|XP_002264919.1|  PREDICTED: probable calcium-binding protein ...    157   3e-44   Vitis vinifera
emb|CBI27593.3|  unnamed protein product                                157   5e-44   Vitis vinifera
ref|XP_008233410.1|  PREDICTED: probable calcium-binding protein ...    158   7e-44   Prunus mume [ume]
emb|CDX87576.1|  BnaA07g32970D                                          156   3e-43   
gb|KDO55620.1|  hypothetical protein CISIN_1g037913mg                   155   3e-43   Citrus sinensis [apfelsine]
emb|CDP16678.1|  unnamed protein product                                154   5e-43   Coffea canephora [robusta coffee]
ref|XP_009420449.1|  PREDICTED: probable calcium-binding protein ...    156   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008237869.1|  PREDICTED: probable calcium-binding protein ...    155   9e-43   Prunus mume [ume]
ref|XP_008799158.1|  PREDICTED: putative calcium-binding protein ...    154   1e-42   Phoenix dactylifera
ref|XP_007209656.1|  hypothetical protein PRUPE_ppa012065mg             155   1e-42   Prunus persica
emb|CDX88305.1|  BnaC06g37490D                                          154   1e-42   
ref|XP_002264785.1|  PREDICTED: probable calcium-binding protein ...    153   1e-42   Vitis vinifera
ref|XP_007216735.1|  hypothetical protein PRUPE_ppa025431mg             153   1e-42   Prunus persica
gb|KJB76415.1|  hypothetical protein B456_012G087800                    152   2e-42   Gossypium raimondii
ref|XP_006447105.1|  hypothetical protein CICLE_v10018267mg             152   2e-42   Citrus clementina [clementine]
ref|XP_009420461.1|  PREDICTED: probable calcium-binding protein ...    154   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002307832.1|  hypothetical protein POPTR_0005s28110g             154   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009106331.1|  PREDICTED: calcium-binding protein CML38           153   5e-42   Brassica rapa
ref|XP_012073527.1|  PREDICTED: calcium-binding protein CML38-like      153   7e-42   Jatropha curcas
ref|XP_011467704.1|  PREDICTED: calcium-binding protein CML38           151   7e-42   Fragaria vesca subsp. vesca
ref|XP_009359450.1|  PREDICTED: putative calcium-binding protein ...    150   2e-41   
ref|XP_002264640.1|  PREDICTED: probable calcium-binding protein ...    150   2e-41   Vitis vinifera
ref|XP_006365695.1|  PREDICTED: calcium-binding protein CML37-like      149   2e-41   
ref|XP_002264877.1|  PREDICTED: probable calcium-binding protein ...    149   3e-41   Vitis vinifera
ref|XP_008231145.1|  PREDICTED: calcium-binding protein CML38           149   4e-41   Prunus mume [ume]
gb|EYU34794.1|  hypothetical protein MIMGU_mgv1a015890mg                149   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_010111596.1|  Calcium-binding protein CML38                      149   5e-41   Morus notabilis
ref|XP_007037951.1|  Calmodulin like 37                                 149   6e-41   
ref|XP_002264177.1|  PREDICTED: probable calcium-binding protein ...    148   9e-41   Vitis vinifera
ref|XP_002264459.1|  PREDICTED: probable calcium-binding protein ...    147   2e-40   Vitis vinifera
ref|XP_010913814.1|  PREDICTED: probable calcium-binding protein ...    149   2e-40   Elaeis guineensis
gb|ABP04242.1|  calmodulin-like protein                                 150   3e-40   Elaeis guineensis
ref|XP_010063194.1|  PREDICTED: putative calcium-binding protein ...    149   3e-40   Eucalyptus grandis [rose gum]
ref|XP_009375226.1|  PREDICTED: putative calcium-binding protein ...    147   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_011003944.1|  PREDICTED: calcium-binding protein CML38           147   3e-40   Populus euphratica
ref|XP_002510759.1|  Calmodulin, putative                               148   4e-40   
ref|XP_003618823.1|  Calcium-binding protein CML38                      146   5e-40   Medicago truncatula
ref|XP_008392828.1|  PREDICTED: putative calcium-binding protein ...    146   5e-40   
emb|CBI15642.3|  unnamed protein product                                146   8e-40   Vitis vinifera
ref|XP_008379126.1|  PREDICTED: putative calcium-binding protein ...    145   1e-39   
ref|XP_002263765.1|  PREDICTED: probable calcium-binding protein ...    145   1e-39   
ref|XP_010663735.1|  PREDICTED: putative calcium-binding protein ...    147   2e-39   Vitis vinifera
ref|XP_002300609.1|  hypothetical protein POPTR_0002s00350g             147   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010669984.1|  PREDICTED: calcium-binding protein CML39-like      146   2e-39   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN80081.1|  hypothetical protein VITISV_011291                     144   3e-39   Vitis vinifera
ref|XP_002264677.1|  PREDICTED: probable calcium-binding protein ...    144   4e-39   
gb|EYU34793.1|  hypothetical protein MIMGU_mgv1a021590mg                144   4e-39   Erythranthe guttata [common monkey flower]
ref|XP_003553918.1|  PREDICTED: probable calcium-binding protein ...    144   5e-39   Glycine max [soybeans]
ref|XP_002264326.1|  PREDICTED: putative calcium-binding protein ...    143   1e-38   Vitis vinifera
ref|XP_011041111.1|  PREDICTED: probable calcium-binding protein ...    144   1e-38   Populus euphratica
ref|XP_002264501.1|  PREDICTED: probable calcium-binding protein ...    143   1e-38   Vitis vinifera
ref|XP_010026612.1|  PREDICTED: putative calcium-binding protein ...    143   1e-38   Eucalyptus grandis [rose gum]
emb|CBI27599.3|  unnamed protein product                                142   2e-38   Vitis vinifera
ref|XP_011034753.1|  PREDICTED: putative calcium-binding protein ...    144   3e-38   Populus euphratica
ref|XP_003523141.1|  PREDICTED: calcium-binding protein CML38-like      141   5e-38   
emb|CBI27597.3|  unnamed protein product                                141   5e-38   Vitis vinifera
ref|XP_008799159.1|  PREDICTED: putative calcium-binding protein ...    143   5e-38   
ref|XP_008782798.1|  PREDICTED: putative calcium-binding protein ...    143   5e-38   
gb|KJB40017.1|  hypothetical protein B456_007G042400                    141   7e-38   Gossypium raimondii
gb|KEH31724.1|  EF hand calcium-binding family protein                  140   7e-38   Medicago truncatula
ref|XP_009415709.1|  PREDICTED: putative calcium-binding protein ...    142   9e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010033396.1|  PREDICTED: putative calcium-binding protein ...    140   9e-38   Eucalyptus grandis [rose gum]
ref|XP_010928758.1|  PREDICTED: probable calcium-binding protein ...    143   1e-37   Elaeis guineensis
ref|XP_004138054.1|  PREDICTED: putative calcium-binding protein ...    140   1e-37   Cucumis sativus [cucumbers]
ref|XP_007210631.1|  hypothetical protein PRUPE_ppa019709mg             140   1e-37   
ref|XP_003608847.1|  Calcium-binding protein                            140   1e-37   Medicago truncatula
ref|XP_010248958.1|  PREDICTED: calcium-binding protein CML37-like      140   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_011097304.1|  PREDICTED: putative calcium-binding protein ...    140   1e-37   
ref|XP_006579596.1|  PREDICTED: putative calcium-binding protein ...    140   2e-37   Glycine max [soybeans]
gb|KHN34410.1|  Putative calcium-binding protein CML31                  140   2e-37   Glycine soja [wild soybean]
ref|XP_010026630.1|  PREDICTED: putative calcium-binding protein ...    140   2e-37   
ref|XP_010094482.1|  Calcium-binding protein CML38                      141   2e-37   Morus notabilis
ref|XP_006390167.1|  hypothetical protein EUTSA_v10019204mg             141   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010248957.1|  PREDICTED: calcium-binding protein CML37           139   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008464450.1|  PREDICTED: putative calcium-binding protein ...    138   6e-37   Cucumis melo [Oriental melon]
emb|CAN78147.1|  hypothetical protein VITISV_039879                     137   9e-37   Vitis vinifera
ref|XP_010026622.1|  PREDICTED: probable calcium-binding protein ...    138   9e-37   Eucalyptus grandis [rose gum]
ref|XP_007018618.1|  Calcium-binding EF-hand family protein, puta...    142   1e-36   
ref|XP_010026601.1|  PREDICTED: putative calcium-binding protein ...    137   1e-36   Eucalyptus grandis [rose gum]
ref|XP_003549848.1|  PREDICTED: putative calcium-binding protein ...    137   2e-36   Glycine max [soybeans]
ref|XP_010105238.1|  Calcium-binding protein CML37                      137   2e-36   Morus notabilis
gb|EPS67292.1|  hypothetical protein M569_07485                         137   2e-36   Genlisea aurea
ref|XP_008781687.1|  PREDICTED: putative calcium-binding protein ...    139   2e-36   Phoenix dactylifera
gb|AES91046.2|  EF hand calcium-binding family protein                  137   3e-36   Medicago truncatula
ref|XP_007161752.1|  hypothetical protein PHAVU_001G095600g             137   3e-36   Phaseolus vulgaris [French bean]
gb|KHN14097.1|  Putative calcium-binding protein CML31                  136   3e-36   Glycine soja [wild soybean]
emb|CAN78146.1|  hypothetical protein VITISV_039878                     136   4e-36   Vitis vinifera
ref|XP_009804674.1|  PREDICTED: putative calcium-binding protein ...    136   4e-36   Nicotiana sylvestris
gb|KFK42082.1|  hypothetical protein AALP_AA2G208800                    137   5e-36   Arabis alpina [alpine rockcress]
ref|XP_008805121.1|  PREDICTED: putative calcium-binding protein ...    137   6e-36   
ref|XP_010927470.1|  PREDICTED: putative calcium-binding protein ...    137   7e-36   Elaeis guineensis
gb|AAM64535.1|  putative calmodulin                                     137   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106330.1|  PREDICTED: calcium-binding protein CML39           136   7e-36   Brassica rapa
ref|NP_177791.1|  calcium-binding protein CML38                         137   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435500.1|  hypothetical protein CICLE_v10002523mg             137   9e-36   
ref|XP_007151537.1|  hypothetical protein PHAVU_004G055200g             135   1e-35   Phaseolus vulgaris [French bean]
ref|XP_004231789.1|  PREDICTED: putative calcium-binding protein ...    135   1e-35   Solanum lycopersicum
ref|XP_006338687.1|  PREDICTED: putative calcium-binding protein ...    135   1e-35   Solanum tuberosum [potatoes]
ref|XP_002264716.1|  PREDICTED: putative calcium-binding protein ...    135   1e-35   
ref|XP_010932174.1|  PREDICTED: putative calcium-binding protein ...    136   1e-35   Elaeis guineensis
emb|CDY72264.1|  BnaCnng76780D                                          136   2e-35   Brassica napus [oilseed rape]
ref|XP_010250768.1|  PREDICTED: calcium-binding protein CML38-like      134   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004145714.1|  PREDICTED: putative calcium-binding protein ...    134   3e-35   Cucumis sativus [cucumbers]
emb|CDX95188.1|  BnaC09g16820D                                          135   3e-35   
ref|XP_009104663.1|  PREDICTED: calcium-binding protein CML38-like      135   3e-35   Brassica rapa
ref|XP_010026594.1|  PREDICTED: putative calcium-binding protein ...    134   3e-35   Eucalyptus grandis [rose gum]
ref|XP_009113443.1|  PREDICTED: calcium-binding protein CML37           135   4e-35   Brassica rapa
gb|AFK45118.1|  unknown                                                 134   4e-35   Lotus japonicus
ref|XP_006301690.1|  hypothetical protein CARUB_v10022145mg             135   4e-35   Capsella rubella
emb|CDY69441.1|  BnaA09g53510D                                          135   4e-35   Brassica napus [oilseed rape]
gb|KJB08025.1|  hypothetical protein B456_001G059500                    134   4e-35   Gossypium raimondii
gb|KFK42084.1|  hypothetical protein AALP_AA2G209000                    134   5e-35   Arabis alpina [alpine rockcress]
emb|CDX85965.1|  BnaC06g21690D                                          134   6e-35   
ref|XP_003608849.1|  Calmodulin                                         137   6e-35   
emb|CDX87577.1|  BnaA07g32960D                                          134   6e-35   
emb|CDX88304.1|  BnaC06g37480D                                          134   7e-35   
ref|NP_177790.1|  calcium-binding protein CML39                         133   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416589.1|  PREDICTED: calcium-binding protein CML38           134   9e-35   Camelina sativa [gold-of-pleasure]
gb|KJB11648.1|  hypothetical protein B456_001G269500                    132   1e-34   Gossypium raimondii
ref|XP_008450085.1|  PREDICTED: putative calcium-binding protein ...    132   1e-34   Cucumis melo [Oriental melon]
gb|KHN05761.1|  Putative calcium-binding protein CML19                  132   1e-34   Glycine soja [wild soybean]
ref|XP_002889092.1|  hypothetical protein ARALYDRAFT_895547             133   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_006403395.1|  hypothetical protein EUTSA_v10003430mg             134   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006301226.1|  hypothetical protein CARUB_v10021626mg             132   2e-34   Capsella rubella
ref|XP_003602094.1|  Calmodulin-like protein                            132   2e-34   
ref|XP_003602095.1|  Calmodulin-like protein                            132   2e-34   
ref|XP_010248956.1|  PREDICTED: calcium-binding protein CML37-like      131   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008239450.1|  PREDICTED: putative calcium-binding protein ...    131   3e-34   Prunus mume [ume]
ref|XP_006849867.1|  PREDICTED: putative calcium-binding protein ...    134   4e-34   Amborella trichopoda
emb|CDY45939.1|  BnaA02g17650D                                          132   4e-34   Brassica napus [oilseed rape]
ref|XP_009128188.1|  PREDICTED: calcium-binding protein CML39-like      132   4e-34   Brassica rapa
ref|NP_199053.1|  calcium-binding protein CML37                         132   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515822.1|  PREDICTED: putative calcium-binding protein ...    130   5e-34   Cicer arietinum [garbanzo]
ref|XP_012070629.1|  PREDICTED: putative calcium-binding protein ...    130   5e-34   Jatropha curcas
emb|CBI27596.3|  unnamed protein product                                131   6e-34   Vitis vinifera
ref|XP_006282133.1|  hypothetical protein CARUB_v10028385mg             132   6e-34   Capsella rubella
ref|XP_009603057.1|  PREDICTED: putative calcium-binding protein ...    130   6e-34   Nicotiana tomentosiformis
gb|AAM67214.1|  putative calmodulin                                     132   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN21325.1|  Putative calcium-binding protein CML19                  130   7e-34   Glycine soja [wild soybean]
gb|KHN21326.1|  Putative calcium-binding protein CML19                  130   8e-34   Glycine soja [wild soybean]
ref|XP_010428729.1|  PREDICTED: calcium-binding protein CML38-like      131   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004500649.1|  PREDICTED: calcium-binding protein CML38-like      130   1e-33   Cicer arietinum [garbanzo]
ref|XP_002881678.1|  hypothetical protein ARALYDRAFT_903237             130   1e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_006440091.1|  hypothetical protein CICLE_v10022753mg             130   1e-33   Citrus clementina [clementine]
ref|XP_010442165.1|  PREDICTED: calcium-binding protein CML37           131   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006599038.1|  PREDICTED: putative calcium-binding protein ...    129   1e-33   Glycine max [soybeans]
ref|XP_010523259.1|  PREDICTED: calcium-binding protein CML37           131   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_008796461.1|  PREDICTED: probable calcium-binding protein ...    131   2e-33   
ref|XP_010481992.1|  PREDICTED: calcium-binding protein CML37-like      131   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009397097.1|  PREDICTED: putative calcium-binding protein ...    130   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235017.1|  uncharacterized protein LOC100526852               129   2e-33   
ref|XP_009371666.1|  PREDICTED: calcium-binding protein CML38           129   2e-33   Pyrus x bretschneideri [bai li]
gb|KFK32927.1|  hypothetical protein AALP_AA6G307400                    130   2e-33   Arabis alpina [alpine rockcress]
ref|XP_010471819.1|  PREDICTED: calcium-binding protein CML39           129   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010428728.1|  PREDICTED: calcium-binding protein CML39-like      129   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007148928.1|  hypothetical protein PHAVU_005G026000g             129   3e-33   Phaseolus vulgaris [French bean]
ref|XP_008348163.1|  PREDICTED: LOW QUALITY PROTEIN: putative cal...    129   3e-33   
ref|XP_010471823.1|  PREDICTED: calcium-binding protein CML38-like      130   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002511206.1|  Polcalcin Jun o, putative                          128   6e-33   
ref|XP_008341320.1|  PREDICTED: putative calcium-binding protein ...    128   6e-33   
emb|CDY20397.1|  BnaC02g24190D                                          129   6e-33   Brassica napus [oilseed rape]
ref|XP_002321694.2|  hypothetical protein POPTR_0015s10590g             128   6e-33   
ref|XP_002302467.1|  hypothetical protein POPTR_0002s13360g             127   8e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004971306.1|  PREDICTED: probable calcium-binding protein ...    128   8e-33   Setaria italica
gb|EAY77274.1|  hypothetical protein OsI_05248                          128   9e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_002889093.1|  hypothetical protein ARALYDRAFT_476823             128   9e-33   
ref|XP_010922578.1|  PREDICTED: putative calcium-binding protein ...    127   1e-32   Elaeis guineensis
ref|XP_006390168.1|  hypothetical protein EUTSA_v10019832mg             128   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010660785.1|  PREDICTED: putative calcium-binding protein ...    127   1e-32   Vitis vinifera
ref|XP_007148929.1|  hypothetical protein PHAVU_005G026100g             127   1e-32   Phaseolus vulgaris [French bean]
ref|XP_008789178.1|  PREDICTED: putative calcium-binding protein ...    127   1e-32   Phoenix dactylifera
ref|XP_012079860.1|  PREDICTED: calcium-binding protein CML38-like      127   2e-32   Jatropha curcas
ref|XP_006579175.1|  PREDICTED: probable calcium-binding protein ...    126   2e-32   
ref|XP_004971308.1|  PREDICTED: putative calcium-binding protein ...    126   3e-32   Setaria italica
ref|XP_003538266.2|  PREDICTED: calmodulin-like protein 12-like         130   3e-32   
ref|XP_006645374.1|  PREDICTED: putative calcium-binding protein ...    126   3e-32   Oryza brachyantha
ref|XP_011017282.1|  PREDICTED: calcium-binding protein CML37-like      126   3e-32   Populus euphratica
ref|XP_002863793.1|  hypothetical protein ARALYDRAFT_917538             127   4e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_011024043.1|  PREDICTED: calcium-binding protein CML38-like      125   4e-32   Populus euphratica
ref|NP_001045436.1|  Os01g0955100                                       126   5e-32   
gb|EAZ14873.1|  hypothetical protein OsJ_04802                          126   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010530254.1|  PREDICTED: calcium-binding protein CML37-like      127   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_010416584.1|  PREDICTED: calcium-binding protein CML39-like      125   7e-32   Camelina sativa [gold-of-pleasure]
ref|NP_001077834.1|  calcium-binding protein CML38                      126   7e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EMS51536.1|  Putative calcium-binding protein CML23                  125   1e-31   Triticum urartu
gb|EMT24237.1|  Putative calcium-binding protein CML23                  124   1e-31   
ref|XP_006645375.1|  PREDICTED: probable calcium-binding protein ...    124   2e-31   Oryza brachyantha
ref|XP_004138612.1|  PREDICTED: calcium-binding protein CML38-like      124   3e-31   Cucumis sativus [cucumbers]
ref|XP_008441354.1|  PREDICTED: putative calcium-binding protein ...    122   8e-31   Cucumis melo [Oriental melon]
ref|XP_006581875.1|  PREDICTED: calcium-binding protein CML38-like      122   1e-30   Glycine max [soybeans]
ref|XP_010937895.1|  PREDICTED: putative calcium-binding protein ...    122   1e-30   Elaeis guineensis
ref|XP_009128187.1|  PREDICTED: calcium-binding protein CML39-like      122   2e-30   Brassica rapa
ref|XP_010537257.1|  PREDICTED: calcium-binding protein CML38-like      122   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_011098857.1|  PREDICTED: putative calcium-binding protein ...    119   8e-30   Sesamum indicum [beniseed]
gb|EMS48746.1|  Putative calcium-binding protein CML19                  120   8e-30   Triticum urartu
gb|EMT29767.1|  Putative calcium-binding protein CML19                  119   1e-29   
gb|EYU45393.1|  hypothetical protein MIMGU_mgv1a021519mg                119   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_007155535.1|  hypothetical protein PHAVU_003G210000g             119   2e-29   Phaseolus vulgaris [French bean]
ref|XP_003567156.2|  PREDICTED: putative calcium-binding protein ...    119   3e-29   Brachypodium distachyon [annual false brome]
gb|AFK41707.1|  unknown                                                 118   4e-29   Lotus japonicus
ref|XP_008792681.1|  PREDICTED: probable calcium-binding protein ...    118   5e-29   Phoenix dactylifera
gb|EMT24799.1|  Putative calcium-binding protein CML31                  117   1e-28   
ref|XP_009400775.1|  PREDICTED: putative calcium-binding protein ...    116   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY77276.1|  hypothetical protein OsI_05250                          116   2e-28   Oryza sativa Indica Group [Indian rice]
gb|EMS51537.1|  putative calcium-binding protein CML31                  116   3e-28   Triticum urartu
ref|XP_009803565.1|  PREDICTED: putative calcium-binding protein ...    115   5e-28   Nicotiana sylvestris
ref|XP_008796222.1|  PREDICTED: putative calcium-binding protein ...    114   1e-27   
gb|KHN06645.1|  Putative calcium-binding protein CML19                  114   1e-27   Glycine soja [wild soybean]
ref|XP_008676053.1|  PREDICTED: putative calcium-binding protein ...    114   1e-27   Zea mays [maize]
ref|XP_003565101.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Brachypodium distachyon [annual false brome]
gb|EMT24800.1|  Putative calcium-binding protein CML31                  114   2e-27   
gb|EMT21075.1|  Putative calcium-binding protein CML25/26               114   2e-27   
sp|Q8RYJ8.1|CML19_ORYSJ  RecName: Full=Putative calcium-binding p...    113   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010999941.1|  PREDICTED: probable calcium-binding protein ...    114   3e-27   Populus euphratica
ref|XP_006383258.1|  hypothetical protein POPTR_0005s12930g             114   4e-27   
ref|XP_004983744.1|  PREDICTED: putative calcium-binding protein ...    113   4e-27   Setaria italica
emb|CBI27594.3|  unnamed protein product                                110   7e-27   Vitis vinifera
gb|EMT21529.1|  Putative calcium-binding protein CML19                  112   8e-27   
ref|XP_006356024.1|  PREDICTED: putative calcium-binding protein ...    112   1e-26   Solanum tuberosum [potatoes]
ref|NP_190646.1|  putative calcium-binding protein CML41                113   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20498.1|  calmodulin-like protein                                 113   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|EMS52172.1|  putative calcium-binding protein CML31                  111   2e-26   Triticum urartu
gb|EMT21110.1|  Putative calcium-binding protein CML31                  111   2e-26   
ref|XP_002283570.1|  PREDICTED: probable calcium-binding protein ...    112   3e-26   Vitis vinifera
emb|CAN64302.1|  hypothetical protein VITISV_034922                     112   3e-26   Vitis vinifera
ref|XP_006291871.1|  hypothetical protein CARUB_v10018048mg             112   3e-26   Capsella rubella
gb|EMS53282.1|  putative calcium-binding protein CML25/26               109   8e-26   Triticum urartu
gb|KHN24900.1|  Putative calcium-binding protein CML31                  108   9e-26   Glycine soja [wild soybean]
gb|KFK34325.1|  hypothetical protein AALP_AA5G130200                    111   9e-26   Arabis alpina [alpine rockcress]
emb|CBI27601.3|  unnamed protein product                                107   1e-25   Vitis vinifera
ref|XP_002533275.1|  Calmodulin, putative                               110   2e-25   Ricinus communis
ref|XP_010515448.1|  PREDICTED: probable calcium-binding protein ...    110   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006404003.1|  hypothetical protein EUTSA_v10010726mg             110   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_004971307.1|  PREDICTED: putative calcium-binding protein ...    108   2e-25   Setaria italica
ref|XP_010680927.1|  PREDICTED: probable calcium-binding protein ...    110   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010547488.1|  PREDICTED: probable calcium-binding protein ...    110   2e-25   Tarenaya hassleriana [spider flower]
gb|AAL06347.1|AF414128_1  calmodulin-like protein                       108   2e-25   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010106049.1|  putative calcium-binding protein CML41             109   2e-25   
ref|XP_011463281.1|  PREDICTED: putative calcium-binding protein ...    108   3e-25   Fragaria vesca subsp. vesca
ref|XP_010426619.1|  PREDICTED: probable calcium-binding protein ...    109   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004234228.1|  PREDICTED: putative calcium-binding protein ...    107   3e-25   Solanum lycopersicum
ref|XP_006664268.1|  PREDICTED: probable calcium-binding protein ...    107   4e-25   Oryza brachyantha
ref|XP_008437697.1|  PREDICTED: probable calcium-binding protein ...    107   4e-25   Cucumis melo [Oriental melon]
ref|XP_004150479.1|  PREDICTED: probable calcium-binding protein ...    107   5e-25   Cucumis sativus [cucumbers]
ref|XP_009419040.1|  PREDICTED: putative calcium-binding protein ...    108   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008674504.1|  PREDICTED: putative calcium-binding protein ...    107   7e-25   Zea mays [maize]
ref|XP_009607124.1|  PREDICTED: putative calcium-binding protein ...    106   8e-25   Nicotiana tomentosiformis
ref|XP_009609171.1|  PREDICTED: putative calcium-binding protein ...    106   8e-25   
emb|CBI27598.3|  unnamed protein product                                105   1e-24   Vitis vinifera
gb|KJB48467.1|  hypothetical protein B456_008G070200                    107   2e-24   Gossypium raimondii
gb|EMS53281.1|  putative calcium-binding protein CML25/26               105   2e-24   Triticum urartu
ref|XP_010254976.1|  PREDICTED: probable calcium-binding protein ...    107   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008241876.1|  PREDICTED: probable calcium-binding protein ...    105   3e-24   Prunus mume [ume]
ref|XP_008656858.1|  PREDICTED: putative calcium-binding protein ...    105   3e-24   
dbj|BAJ97949.1|  predicted protein                                      105   3e-24   
ref|XP_009399093.1|  PREDICTED: probable calcium-binding protein ...    106   3e-24   
ref|XP_003548785.1|  PREDICTED: probable calcium-binding protein ...    106   4e-24   
ref|XP_008241615.1|  PREDICTED: probable calcium-binding protein ...    106   4e-24   
ref|XP_004509234.1|  PREDICTED: probable calcium-binding protein ...    106   4e-24   
gb|EMT05809.1|  Putative calcium-binding protein CML31                  104   5e-24   
gb|EMS52437.1|  Putative calcium-binding protein CML19                  103   5e-24   
gb|KJB63727.1|  hypothetical protein B456_010G012800                    105   6e-24   
ref|XP_004293230.1|  PREDICTED: probable calcium-binding protein ...    105   7e-24   
gb|KJB43576.1|  hypothetical protein B456_007G207100                    105   8e-24   
ref|XP_010435674.1|  PREDICTED: probable calcium-binding protein ...    104   9e-24   
ref|XP_007224426.1|  hypothetical protein PRUPE_ppa021408mg             105   9e-24   
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...    104   1e-23   
ref|XP_002876048.1|  hypothetical protein ARALYDRAFT_485424             105   1e-23   
ref|XP_009136559.1|  PREDICTED: probable calcium-binding protein ...    105   2e-23   
ref|XP_002310779.1|  calmodulin-like gene family protein                104   2e-23   
emb|CDY70802.1|  BnaCnng69860D                                          104   2e-23   
ref|XP_002884257.1|  hypothetical protein ARALYDRAFT_896060             103   2e-23   
ref|XP_006663707.1|  PREDICTED: probable calcium-binding protein ...    103   2e-23   
ref|XP_009374214.1|  PREDICTED: probable calcium-binding protein ...    104   2e-23   
ref|XP_010243276.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   
ref|XP_007017447.1|  Calmodulin-like 41, putative                       103   3e-23   
ref|XP_008338174.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   
ref|XP_009134577.1|  PREDICTED: probable calcium-binding protein ...    102   3e-23   
ref|XP_010927693.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   
ref|XP_008794664.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...    102   4e-23   
ref|XP_010445909.1|  PREDICTED: calcium-binding protein CML37-like      103   4e-23   
emb|CDP07575.1|  unnamed protein product                                103   6e-23   
ref|XP_002459117.1|  hypothetical protein SORBIDRAFT_03g046210          102   6e-23   
ref|XP_010649201.1|  PREDICTED: probable calcium-binding protein ...    102   6e-23   
gb|EAY97840.1|  hypothetical protein OsI_19761                          103   6e-23   
ref|XP_002533274.1|  Calmodulin, putative                               103   7e-23   
emb|CAN73786.1|  hypothetical protein VITISV_041123                     102   7e-23   
emb|CDX91923.1|  BnaC03g32250D                                          101   7e-23   
ref|XP_010496435.1|  PREDICTED: probable calcium-binding protein ...    101   8e-23   
ref|XP_006365377.1|  PREDICTED: probable calcium-binding protein ...    102   8e-23   
gb|KHN06646.1|  Putative calcium-binding protein CML40                  100   8e-23   
sp|Q8RYJ9.1|CML23_ORYSJ  RecName: Full=Putative calcium-binding p...    101   9e-23   
ref|XP_008802235.1|  PREDICTED: probable calcium-binding protein ...    102   9e-23   
ref|XP_011085544.1|  PREDICTED: probable calcium-binding protein ...    102   1e-22   
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...    102   1e-22   
ref|XP_007202906.1|  hypothetical protein PRUPE_ppa016099mg             102   1e-22   
gb|EAY77275.1|  hypothetical protein OsI_05249                          101   1e-22   
ref|NP_001055397.1|  Os05g0380900                                       102   1e-22   
ref|XP_012071769.1|  PREDICTED: probable calcium-binding protein ...    102   1e-22   
ref|NP_566152.1|  putative calcium-binding protein CML40                100   1e-22   
emb|CBI27595.3|  unnamed protein product                              99.0    1e-22   
ref|XP_010927694.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   
gb|KHN40730.1|  Putative calcium-binding protein CML25                  100   2e-22   
emb|CDP02415.1|  unnamed protein product                                102   2e-22   
ref|XP_003629506.1|  hypothetical protein MTR_8g078270                  101   2e-22   
ref|XP_003528198.1|  PREDICTED: probable calcium-binding protein ...    101   2e-22   
gb|KHN44510.1|  Putative calcium-binding protein CML41                  101   2e-22   
ref|NP_001241810.1|  polcalcin Jun o 2                                  101   2e-22   
ref|XP_004300588.1|  PREDICTED: probable calcium-binding protein ...    101   2e-22   
ref|NP_001150713.1|  LOC100284346                                       101   3e-22   
ref|NP_001237758.1|  uncharacterized protein LOC100306370               100   4e-22   
gb|KHN00568.1|  Putative calcium-binding protein CML41                  100   4e-22   
ref|XP_002456952.1|  hypothetical protein SORBIDRAFT_03g046230        99.8    4e-22   
ref|XP_004234682.1|  PREDICTED: probable calcium-binding protein ...    100   5e-22   
gb|AFW81600.1|  polcalcin Jun o 2                                       100   5e-22   
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...  99.8    9e-22   
ref|NP_001236680.1|  uncharacterized protein LOC100500092             99.8    9e-22   
ref|XP_010926750.1|  PREDICTED: probable calcium-binding protein ...  99.8    9e-22   
ref|XP_008220748.1|  PREDICTED: probable calcium-binding protein ...  99.8    1e-21   
ref|XP_008347412.1|  PREDICTED: probable calcium-binding protein ...  99.8    1e-21   
ref|XP_009365617.1|  PREDICTED: probable calcium-binding protein ...  99.8    1e-21   
ref|XP_010070455.1|  PREDICTED: probable calcium-binding protein ...  99.4    2e-21   
ref|XP_010926751.1|  PREDICTED: probable calcium-binding protein ...  98.2    3e-21   
ref|XP_010485355.1|  PREDICTED: probable calcium-binding protein ...  97.4    3e-21   
ref|XP_011470552.1|  PREDICTED: calcium-binding protein CML24         97.1    4e-21   
ref|XP_008794595.1|  PREDICTED: probable calcium-binding protein ...  97.8    5e-21   
emb|CBI17581.3|  unnamed protein product                              97.8    5e-21   
emb|CDX77085.1|  BnaC04g38800D                                        96.7    5e-21   
gb|EMT06757.1|  Putative calcium-binding protein CML25/26             98.2    5e-21   
ref|XP_009616101.1|  PREDICTED: probable calcium-binding protein ...  97.4    7e-21   
ref|XP_006408553.1|  hypothetical protein EUTSA_v10021726mg           95.9    8e-21   
ref|XP_008802268.1|  PREDICTED: probable calcium-binding protein ...  97.1    8e-21   
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...  97.1    9e-21   
gb|KHN03121.1|  Putative calcium-binding protein CML31                94.7    1e-20   
ref|NP_001065531.1|  Os11g0105000                                     95.9    1e-20   
ref|XP_012079101.1|  PREDICTED: probable calcium-binding protein ...  96.7    1e-20   
ref|XP_007156010.1|  hypothetical protein PHAVU_003G251000g           96.7    1e-20   
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...  96.7    2e-20   
gb|KDP31816.1|  hypothetical protein JCGZ_12277                       96.3    2e-20   
gb|KHN22817.1|  Putative calcium-binding protein CML31                94.0    2e-20   
gb|EMT33532.1|  Putative calcium-binding protein CML23                94.0    2e-20   
ref|XP_009768610.1|  PREDICTED: probable calcium-binding protein ...  96.3    2e-20   
ref|XP_006646691.1|  PREDICTED: putative calcium-binding protein ...  95.1    2e-20   
gb|KHM99985.1|  Putative calcium-binding protein CML31                93.2    3e-20   
ref|XP_006425754.1|  hypothetical protein CICLE_v10026510mg           95.9    3e-20   
gb|EMS61162.1|  putative calcium-binding protein CML16                95.1    4e-20   
ref|XP_008808888.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...  95.1    4e-20   
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8      94.0    7e-20   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...  94.0    8e-20   
ref|XP_010099347.1|  putative calcium-binding protein CML41           94.7    9e-20   
ref|XP_006299725.1|  hypothetical protein CARUB_v10015918mg           93.2    1e-19   
gb|EMT15109.1|  Putative calcium-binding protein CML31                93.2    1e-19   
ref|XP_011074483.1|  PREDICTED: probable calcium-binding protein ...  94.0    1e-19   
emb|CDM86445.1|  unnamed protein product                              94.0    1e-19   
ref|NP_001146874.1|  polcalcin Jun o 2                                93.6    1e-19   
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...  93.6    2e-19   
gb|EMS52171.1|  putative calcium-binding protein CML31                91.7    2e-19   
dbj|GAN11834.1|  calmodulin                                           92.4    2e-19   
gb|ABR17206.1|  unknown                                               94.4    2e-19   
emb|CDM86427.1|  unnamed protein product                              93.2    2e-19   
emb|CDX99691.1|  BnaC04g34480D                                        92.4    2e-19   
gb|EMS68267.1|  Putative calcium-binding protein CML19                92.0    3e-19   
ref|NP_001151735.1|  polcalcin Jun o 2                                92.8    3e-19   
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                 93.2    3e-19   
ref|XP_003568563.1|  PREDICTED: probable calcium-binding protein ...  92.8    3e-19   
ref|XP_002870563.1|  hypothetical protein ARALYDRAFT_493755           91.7    4e-19   
gb|KFK33273.1|  hypothetical protein AALP_AA6G353700                  91.7    4e-19   
emb|CDY45938.1|  BnaA02g17640D                                        91.3    4e-19   
dbj|BAJ86493.1|  predicted protein                                    93.2    4e-19   
ref|XP_011621141.1|  PREDICTED: probable calcium-binding protein ...  91.7    5e-19   
dbj|BAJ88405.1|  predicted protein                                    92.0    6e-19   
ref|XP_004953833.1|  PREDICTED: probable calcium-binding protein ...  91.7    6e-19   
gb|EMS52173.1|  putative calcium-binding protein CML31                90.5    6e-19   
ref|XP_010060908.1|  PREDICTED: probable calcium-binding protein ...  92.4    6e-19   
dbj|BAK02108.1|  predicted protein                                    92.4    6e-19   
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg              90.9    7e-19   
gb|KJB15360.1|  hypothetical protein B456_002G172400                  92.0    8e-19   
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...  92.0    9e-19   
gb|EMT30390.1|  Putative calcium-binding protein CML20                90.9    1e-18   
gb|EPS71378.1|  hypothetical protein M569_03381                       90.9    1e-18   
ref|NP_198593.1|  calcium-binding protein CML24                       90.5    1e-18   
ref|NP_001045400.1|  Os01g0949500                                     91.3    1e-18   
ref|XP_008782318.1|  PREDICTED: probable calcium-binding protein ...  90.9    1e-18   
ref|XP_002441014.1|  hypothetical protein SORBIDRAFT_09g018860        91.3    1e-18   
ref|XP_011655449.1|  PREDICTED: probable calcium-binding protein ...  90.9    1e-18   
gb|EPB84209.1|  calmodulin                                            90.1    1e-18   
gb|EPS62655.1|  hypothetical protein M569_12136                       90.9    1e-18   
ref|XP_001597046.1|  calmodulin                                       90.1    1e-18   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     90.5    1e-18   
ref|XP_006643684.1|  PREDICTED: probable calcium-binding protein ...  90.5    2e-18   
emb|CDY27652.1|  BnaUnng00020D                                        90.1    2e-18   
ref|XP_009383649.1|  PREDICTED: probable calcium-binding protein ...  90.5    2e-18   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...  90.5    2e-18   
ref|XP_006391395.1|  hypothetical protein EUTSA_v10019556mg           92.0    2e-18   
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...  90.9    2e-18   
gb|EMT25426.1|  Putative calcium-binding protein CML31                88.6    2e-18   
ref|XP_001556588.1|  calmodulin                                       89.7    2e-18   
ref|XP_009140162.1|  PREDICTED: calcium-binding protein CML24         89.7    2e-18   
ref|XP_008809157.1|  PREDICTED: probable calcium-binding protein ...  90.1    2e-18   
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...  90.1    2e-18   
emb|CDJ00752.1|  calmodulin                                           89.7    3e-18   
ref|XP_010941852.1|  PREDICTED: putative calcium-binding protein ...  90.1    3e-18   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      89.4    3e-18   
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...  89.0    4e-18   
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g           89.7    4e-18   
emb|CDM80751.1|  unnamed protein product                              89.7    4e-18   
ref|XP_006285942.1|  hypothetical protein CARUB_v10007462mg           89.0    4e-18   
ref|XP_003616365.1|  Polcalcin Nic t                                  88.2    5e-18   
ref|XP_011429056.1|  PREDICTED: calmodulin-A-like isoform X2          88.6    5e-18   
gb|AFK37714.1|  unknown                                               88.2    5e-18   
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g           89.0    5e-18   
gb|EPB84784.1|  calmodulin                                            88.2    5e-18   
gb|EPS63975.1|  hypothetical protein M569_10810                       89.0    6e-18   
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...  89.4    6e-18   
gb|EPY81566.1|  calmodulin-like protein                               89.7    6e-18   
ref|XP_011021780.1|  PREDICTED: probable calcium-binding protein ...  89.4    6e-18   
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...  88.6    7e-18   
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...  89.4    7e-18   
ref|XP_002525994.1|  Polcalcin Jun o, putative                        89.0    7e-18   
ref|XP_006851533.1|  PREDICTED: probable calcium-binding protein ...  89.0    7e-18   
dbj|GAN02697.1|  calmodulin                                           88.2    7e-18   
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...  89.4    7e-18   
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  88.6    7e-18   
ref|XP_007047048.1|  Calmodulin-like 41, putative                     88.2    8e-18   
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...  87.8    8e-18   
ref|XP_011083746.1|  PREDICTED: probable calcium-binding protein ...  89.0    8e-18   
gb|KEH41232.1|  EF hand calcium-binding family protein                87.8    8e-18   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  88.6    9e-18   
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...  88.2    1e-17   
ref|XP_001768479.1|  predicted protein                                87.8    1e-17   
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...  88.2    1e-17   
ref|XP_012072300.1|  PREDICTED: probable calcium-binding protein ...  88.6    1e-17   
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...  87.4    1e-17   
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like    87.0    1e-17   
gb|ADP36946.1|  hypothetical protein                                  87.4    1e-17   
ref|NP_001041950.2|  Os01g0135700                                     88.2    1e-17   
ref|XP_002314786.2|  hypothetical protein POPTR_0010s11740g           88.2    1e-17   
ref|XP_010450535.1|  PREDICTED: calcium-binding protein CML24-like    87.4    2e-17   
gb|KDP45235.1|  hypothetical protein JCGZ_15100                       87.0    2e-17   
ref|XP_008352239.1|  PREDICTED: calmodulin-like protein 7             88.6    2e-17   
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770        87.8    2e-17   
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...  87.8    2e-17   
gb|EUB55563.1|  Calmodulin                                            87.4    2e-17   
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...  87.8    2e-17   
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg              87.4    2e-17   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       87.0    2e-17   
ref|XP_009013108.1|  hypothetical protein HELRODRAFT_110019           87.0    2e-17   
ref|XP_010692608.1|  PREDICTED: probable calcium-binding protein ...  87.8    2e-17   
gb|EYU26972.1|  hypothetical protein MIMGU_mgv1a019086mg              87.0    2e-17   
gb|EMT21076.1|  Putative calcium-binding protein CML19                85.9    2e-17   
ref|XP_010440886.1|  PREDICTED: calcium-binding protein CML24-like    87.0    2e-17   
ref|XP_010385108.1|  PREDICTED: calmodulin-alpha-like                 86.7    2e-17   
ref|XP_009056060.1|  hypothetical protein LOTGIDRAFT_216194           86.7    2e-17   
gb|ACU20154.1|  unknown                                               85.1    2e-17   
ref|XP_010435616.1|  PREDICTED: calcium-binding protein CML24         87.0    2e-17   
ref|XP_009106021.1|  PREDICTED: probable calcium-binding protein ...  87.0    2e-17   
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...  86.3    2e-17   
ref|NP_001152603.1|  polcalcin Jun o 2                                87.4    2e-17   
gb|KFO18269.1|  Calmodulin                                            87.0    3e-17   
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...  87.4    3e-17   
ref|XP_004139293.1|  PREDICTED: calmodulin-like protein 3             88.2    3e-17   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g           87.4    3e-17   
gb|AAZ20284.1|  calcium-binding pollen allergen                       86.7    3e-17   
gb|ACG44451.1|  polcalcin Jun o 2                                     87.4    3e-17   
gb|EMS61663.1|  Calmodulin-like protein 5                             86.7    3e-17   
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1          87.4    3e-17   
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991            85.9    3e-17   
gb|AHC56510.1|  calmodulin                                            86.3    3e-17   
ref|XP_011078048.1|  PREDICTED: calmodulin-like protein 1             86.7    3e-17   
ref|XP_008218258.1|  PREDICTED: calmodulin-like                       86.3    3e-17   
ref|XP_011436587.1|  PREDICTED: calmodulin-A-like                     86.3    3e-17   
ref|XP_001779716.1|  predicted protein                                85.9    4e-17   
ref|XP_009596756.1|  PREDICTED: calcium-binding allergen Ole e 8-...  86.7    4e-17   



>ref|XP_009621777.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
tomentosiformis]
Length=203

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 5/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDEDGDG+VS AELQR VRAVGGELT EEAE AVRLSDSDGDGMLG+EDF+KLM
Sbjct  63   ERVFTYFDEDGDGKVSPAELQRCVRAVGGELTEEEAEMAVRLSDSDGDGMLGLEDFSKLM  122

Query  250  EG-----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            EG     + KE ELR AF MY ++GT  ITPKSLK+ML +LGEST+  NCK+MI+RFDL+
Sbjct  123  EGSDVEEKNKESELRGAFEMYEMEGTGQITPKSLKRMLSKLGESTSVDNCKSMIQRFDLD  182

Query  85   GDGVLGFDEFKIMMS  41
            GDGVL FDEFKIMM+
Sbjct  183  GDGVLNFDEFKIMMN  197



>ref|XP_009787348.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
sylvestris]
Length=203

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 113/135 (84%), Gaps = 5/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDEDGDG+VS AELQR VRAVGGELT EEAE AVRLSDSDGDGMLG+EDF+KLM
Sbjct  63   ERVFTYFDEDGDGKVSPAELQRCVRAVGGELTEEEAEMAVRLSDSDGDGMLGLEDFSKLM  122

Query  250  EG-----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            EG     + KE ELR AF MY ++GT  ITPKSLK+ML RLGEST+  NCK MI+RFDL+
Sbjct  123  EGGDVEEKSKESELRGAFEMYEMEGTGQITPKSLKRMLSRLGESTSVDNCKFMIQRFDLD  182

Query  85   GDGVLGFDEFKIMMS  41
            GDGVL FDEFKIMM+
Sbjct  183  GDGVLNFDEFKIMMN  197



>ref|XP_009778709.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
sylvestris]
Length=189

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL+R V+AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  55   ERVFTYFDENGDGKVSPAELRRCVKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  114

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YITPKSLK+ML RLGEST+  NCKAMI+RFD+NG
Sbjct  115  EGMEEERNKESELIGAFGMYEMEGSGYITPKSLKRMLSRLGESTSIDNCKAMIQRFDING  174

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  175  DGVLSFDEFKVMMT  188



>ref|XP_009596232.1| PREDICTED: putative calcium-binding protein CML19, partial [Nicotiana 
tomentosiformis]
Length=184

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL+R V+AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  50   ERVFTYFDENGDGKVSPAELRRCVKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  109

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YITPKSLK ML RLGEST+  NCKAMIRRFD+NG
Sbjct  110  EGMEEERNKESELIGAFGMYEMEGSGYITPKSLKMMLSRLGESTSIDNCKAMIRRFDING  169

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEF++MM+
Sbjct  170  DGVLSFDEFRVMMT  183



>gb|AFU81780.1| regulator of gene silencing [Nicotiana benthamiana]
Length=188

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 116/134 (87%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFD++GDG+VS AEL+R V+AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  54   ERVFTYFDDNGDGKVSPAELRRCVKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  113

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ Y+TPKSLK+ML RLGEST+  NCKAMI+RFD+NG
Sbjct  114  EGMEEERNKESELIGAFGMYEMEGSGYVTPKSLKRMLSRLGESTSIDNCKAMIQRFDING  173

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  174  DGVLSFDEFKVMMT  187



>ref|XP_009596235.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
tomentosiformis]
Length=187

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL+R V+AVGGELT EEAE AVRLSDSDGDG+L +EDFTKLM
Sbjct  53   ERVFTYFDENGDGKVSPAELRRCVKAVGGELTVEEAEMAVRLSDSDGDGLLVLEDFTKLM  112

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YITPKSLK+ML +LGEST+  NCKAMIRRFD+NG
Sbjct  113  EGMEEERNKESELIGAFGMYEMEGSGYITPKSLKRMLSQLGESTSIDNCKAMIRRFDING  172

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  173  DGVLSFDEFKVMMT  186



>gb|AAK11255.1|AF329729_1 regulator of gene silencing [Nicotiana tabacum]
Length=190

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL+R V+AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  56   ERVFTYFDENGDGKVSPAELRRCVKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  115

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YITPKSLK ML RLGEST+  NCKAMI+RFD+NG
Sbjct  116  EGMEEERNKESELIGAFGMYEMEGSGYITPKSLKMMLSRLGESTSIDNCKAMIQRFDING  175

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MM+
Sbjct  176  DGVLNFDEFKAMMT  189



>ref|XP_009631063.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
tomentosiformis]
Length=193

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL+R V+AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  59   ERVFTYFDENGDGKVSPAELRRCVKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  118

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YITPKSLK ML RLGEST+  NCKAMI+RFD+NG
Sbjct  119  EGMEEERNKESELIGAFGMYEMEGSGYITPKSLKMMLSRLGESTSIDNCKAMIQRFDING  178

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MM+
Sbjct  179  DGVLNFDEFKAMMT  192



>ref|XP_004251211.1| PREDICTED: putative calcium-binding protein CML19 [Solanum lycopersicum]
Length=203

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 113/134 (84%), Gaps = 6/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL++ V+AVGGELT EEAE AVRLSDSDGDG+LGIEDFTKLM
Sbjct  71   ERVFTYFDENGDGKVSPAELRKCVKAVGGELTVEEAEMAVRLSDSDGDGLLGIEDFTKLM  130

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY  +G  YITPKSLK ML RLGEST+  NCKAMIRRFDLNG
Sbjct  131  EGMEEERNKEGELMGAFGMYETEG--YITPKSLKNMLSRLGESTSIDNCKAMIRRFDLNG  188

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  189  DGVLSFDEFKVMMT  202



>ref|XP_004241366.1| PREDICTED: putative calcium-binding protein CML19 [Solanum lycopersicum]
Length=186

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 3/133 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDEDGDG+VS AEL+R V+AVGG+LT EEAE AVRLSDSDGDGMLG+EDF+KLM
Sbjct  52   ERVFTYFDEDGDGKVSPAELRRCVKAVGGDLTTEEAEMAVRLSDSDGDGMLGLEDFSKLM  111

Query  250  E-GER--KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E GE+  KE ELR AF MY ++G+  ITPKSLK+ML RLGES +  NCKAMI+RFDL+GD
Sbjct  112  ELGEKDNKESELRGAFEMYEMEGSGQITPKSLKRMLSRLGESKSIDNCKAMIKRFDLDGD  171

Query  79   GVLGFDEFKIMMS  41
            GVL FDEFK+MM+
Sbjct  172  GVLSFDEFKVMMN  184



>ref|XP_006340311.1| PREDICTED: calcium-binding protein CML37-like [Solanum tuberosum]
Length=196

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 6/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL++ V+AVGGELT EEAE AVRLSDSDGDG+LGIEDFTKLM
Sbjct  64   ERVFTYFDENGDGKVSPAELRKCVKAVGGELTVEEAEMAVRLSDSDGDGLLGIEDFTKLM  123

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL   FGMY ++G  YITPKSLK ML RLGEST+  NCKAMIRRFDLNG
Sbjct  124  EGMEEERNKESELIGGFGMYEMEG--YITPKSLKNMLSRLGESTSIDNCKAMIRRFDLNG  181

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  182  DGVLSFDEFKVMMT  195



>ref|XP_006340309.1| PREDICTED: calcium-binding protein CML37-like [Solanum tuberosum]
Length=206

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 6/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL++ V+AVGGELT EEAE AVRLSDSDGDG+LGI DFTKLM
Sbjct  74   ERVFTYFDENGDGKVSPAELRKCVKAVGGELTVEEAEMAVRLSDSDGDGLLGIADFTKLM  133

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G  YITPKSLK ML RLGEST+  NCKAMIRRFDLNG
Sbjct  134  EGMEEERNKESELIGAFGMYEMEG--YITPKSLKNMLSRLGESTSIDNCKAMIRRFDLNG  191

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  192  DGVLSFDEFKVMMT  205



>gb|AAM95458.1| calmodulin-like protein [Datura metel]
Length=191

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS  EL+R VRAVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  57   ERVFTYFDENGDGKVSPVELRRCVRAVGGELTEEEAEMAVRLSDSDGDGLLGLEDFTKLM  116

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY  K   YITPKSLK+ML RLGEST+   CK MIRRFDLNG
Sbjct  117  EGMEEERNKESELIGAFGMYEEKEGGYITPKSLKRMLSRLGESTSIDKCKVMIRRFDLNG  176

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  177  DGVLSFDEFKVMMT  190



>ref|XP_006361118.1| PREDICTED: calcium-binding protein CML38-like [Solanum tuberosum]
Length=193

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 114/133 (86%), Gaps = 3/133 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDEDGDG+VS AEL+R V+AVGG+LT EEAE AVRLSDSDGDGMLG+EDF+KLM
Sbjct  59   ERVFTYFDEDGDGKVSPAELRRCVKAVGGDLTTEEAEMAVRLSDSDGDGMLGLEDFSKLM  118

Query  250  E-GER--KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E GE+  KE ELR AF MY ++G+  ITPKSLK+ML RLGES +  NCKAMI++FDL+GD
Sbjct  119  ELGEKDNKESELRGAFEMYEMEGSGQITPKSLKRMLSRLGESKSIDNCKAMIKKFDLDGD  178

Query  79   GVLGFDEFKIMMS  41
            GVL FDEFK+MM+
Sbjct  179  GVLSFDEFKVMMN  191



>ref|XP_009778710.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
sylvestris]
Length=197

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS AEL++ V+AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  63   ERVFIYFDENGDGKVSPAELRKCVKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  122

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YIT KSLK+ML +LGEST+  NCK MIRRFDLNG
Sbjct  123  EGMEEERNKESELIGAFGMYEMEGSGYITAKSLKRMLSQLGESTSIDNCKTMIRRFDLNG  182

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEF++MM+
Sbjct  183  DGVLSFDEFRVMMT  196



>ref|XP_009596233.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
tomentosiformis]
Length=189

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS  EL+R ++AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  55   ERVFTYFDENGDGKVSPVELRRCMKAVGGELTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  114

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G+ YIT KSLK+ML RLGEST+  NCK MI+RFD+NG
Sbjct  115  EGMEEERNKESELIGAFGMYEMEGSGYITHKSLKRMLSRLGESTSIDNCKVMIQRFDING  174

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MM+
Sbjct  175  DGVLSFDEFKAMMT  188



>ref|XP_006340440.1| PREDICTED: calcium-binding protein CML37-like [Solanum tuberosum]
Length=261

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 110/134 (82%), Gaps = 6/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG VS  EL+R ++AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  129  ERVFTYFDENGDGNVSPPELRRCMKAVGGELTMEEAEMAVRLSDSDGDGLLGLEDFTKLM  188

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G  YITPKSLK ML RLGEST+   CK MIRRFD+NG
Sbjct  189  EGMEEERNKESELMGAFGMYEMEG--YITPKSLKMMLSRLGESTSIDKCKVMIRRFDING  246

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFKIMM+
Sbjct  247  DGVLSFDEFKIMMT  260



>ref|XP_006340310.1| PREDICTED: calcium-binding protein CML38-like [Solanum tuberosum]
Length=198

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 111/134 (83%), Gaps = 6/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS  EL+R ++AVGGE+T EEAE AVRLSDSDGDG+LG+EDFTKLM
Sbjct  66   ERVFTYFDENGDGKVSPTELRRCMKAVGGEMTVEEAEMAVRLSDSDGDGLLGLEDFTKLM  125

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G  YITPKSLK ML RLGEST+   CK MIRRFD+NG
Sbjct  126  EGMEEERNKESELMGAFGMYEMEG--YITPKSLKMMLSRLGESTSIDKCKVMIRRFDING  183

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  184  DGVLSFDEFKVMMT  197



>ref|NP_001234570.1| regulator of gene silencing [Solanum lycopersicum]
 gb|AAT65969.1| regulator of gene silencing [Solanum lycopersicum]
Length=198

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 108/134 (81%), Gaps = 6/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG+VS  EL+R ++AVGGE+T EEAE  VRLSDSDGDG+LG EDFTKLM
Sbjct  66   ERVFTYFDENGDGKVSPMELRRCMKAVGGEITVEEAEMVVRLSDSDGDGLLGFEDFTKLM  125

Query  250  EG---ER-KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            EG   ER KE EL  AFGMY ++G  YITPKSLK ML RLGEST+   CK MIRRFD NG
Sbjct  126  EGMEEERNKESELMGAFGMYEMEG--YITPKSLKMMLSRLGESTSIDKCKVMIRRFDTNG  183

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MM+
Sbjct  184  DGVLSFDEFKVMMT  197



>ref|XP_011464987.1| PREDICTED: putative calcium-binding protein CML19 [Fragaria vesca 
subsp. vesca]
Length=191

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 124/187 (66%), Gaps = 8/187 (4%)
 Frame = -2

Query  586  ISPRNTKKATHSSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFAYFD  407
            ++P  +        SP   S     C KL+ ++A+    SS  SS       E+VF YFD
Sbjct  8    LTPAASMDKAQQQHSP--KSTLAKLCRKLSSRKAERRTLSSPTSSSCSSE-LEKVFYYFD  64

Query  406  EDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG-----E  242
            E+GDG++S AELQ  VR VGGEL+ EEA+ AV  SD DGDGMLG E+F KLME      E
Sbjct  65   ENGDGKISPAELQTCVRTVGGELSEEEAQAAVEASDMDGDGMLGFEEFQKLMEASNGDEE  124

Query  241  RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFD  62
             K  ELR+AFGMY ++G+  ITP SLK+ML RLGES +T +CK+MIR FDLNGDGVL FD
Sbjct  125  NKSKELRDAFGMYEMEGSGCITPASLKRMLGRLGESRSTEDCKSMIRMFDLNGDGVLNFD  184

Query  61   EFKIMMS  41
            EF+IMM+
Sbjct  185  EFRIMMA  191



>ref|XP_002509541.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF50928.1| Polcalcin Jun o, putative [Ricinus communis]
Length=141

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FDE+GDGR+S +E+Q+ VRA+GGEL+  EAE AV  +DSDGDG+LG EDF + 
Sbjct  8    YERVFNHFDENGDGRLSPSEIQQCVRAIGGELSLAEAEAAVEYTDSDGDGLLGFEDFVRF  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K ++L+EAF MY ++ T  ITP+SLK+ML RLG+S+T   CK MI +FDLNG
Sbjct  68   LEGGEEEEKANDLKEAFKMYEMEETGCITPRSLKRMLSRLGQSSTLDQCKTMIAQFDLNG  127

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  128  DGVLNFDEFKVMM  140



>ref|XP_010270643.1| PREDICTED: calcium-binding protein CML38-like [Nelumbo nucifera]
Length=193

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 123/181 (68%), Gaps = 5/181 (3%)
 Frame = -2

Query  577  RNTKKATHSSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFAYFDEDG  398
            R++      SSSP K+S F   C KL+ K++     S   ++ + G   +RVF Y DE+G
Sbjct  14   RDSTDRLPGSSSP-KSSAFQKLCRKLSPKKSDKRTLSVEPNAPKYGEL-DRVFRYLDENG  71

Query  397  DGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME---GERKEDE  227
            DG++S  ELQ  VR VGGE++ EEAE AV  SDSDGDG+ G +DF KLME    E ++ +
Sbjct  72   DGKISPEELQSCVRMVGGEMSTEEAEAAVESSDSDGDGLFGYDDFVKLMEVSGEEERQKD  131

Query  226  LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIM  47
            LREAFGMY ++G+ +ITP SLK+M+ RLGES T   CK +I+ FDLNGDGVL FDEF+ M
Sbjct  132  LREAFGMYEMEGSGFITPTSLKRMMSRLGESRTIGQCKDIIKSFDLNGDGVLSFDEFRAM  191

Query  46   M  44
            M
Sbjct  192  M  192



>ref|XP_002277499.1| PREDICTED: putative calcium-binding protein CML19 [Vitis vinifera]
Length=168

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 118/174 (68%), Gaps = 16/174 (9%)
 Frame = -2

Query  553  SSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAE  374
            +++SP+ NS   S   KL+R++                   +RVF YFD++GDG++S  E
Sbjct  6    TAASPACNSSPKSGSGKLSRRKGAACSQ------------LQRVFRYFDKNGDGKISPEE  53

Query  373  LQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKEDE----LREAFGM  206
            LQ  VRAVGGEL+A+EAE AV+ SD DGDGMLG+EDF  LME   +E+E    L+EAFGM
Sbjct  54   LQSCVRAVGGELSAKEAEAAVKSSDMDGDGMLGMEDFEMLMEANGEEEEKTKDLKEAFGM  113

Query  205  YAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            Y ++G+  ITPKSLK++L RLGES T  +CK MI  FD+NGDGVL F+EF  MM
Sbjct  114  YEMEGSGCITPKSLKRVLSRLGESKTIEDCKVMIHMFDINGDGVLSFEEFSAMM  167



>emb|CBI40801.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 123/188 (65%), Gaps = 16/188 (9%)
 Frame = -2

Query  595  EEVISPRNTKKATHSSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFA  416
            E  I  + T +   +++SP+ NS   S   KL+R++                   +RVF 
Sbjct  29   EGFIYKQITMRREDTAASPACNSSPKSGSGKLSRRKGAACSQ------------LQRVFR  76

Query  415  YFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERK  236
            YFD++GDG++S  ELQ  VRAVGGEL+A+EAE AV+ SD DGDGMLG+EDF  LME   +
Sbjct  77   YFDKNGDGKISPEELQSCVRAVGGELSAKEAEAAVKSSDMDGDGMLGMEDFEMLMEANGE  136

Query  235  EDE----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLG  68
            E+E    L+EAFGMY ++G+  ITPKSLK++L RLGES T  +CK MI  FD+NGDGVL 
Sbjct  137  EEEKTKDLKEAFGMYEMEGSGCITPKSLKRVLSRLGESKTIEDCKVMIHMFDINGDGVLS  196

Query  67   FDEFKIMM  44
            F+EF  MM
Sbjct  197  FEEFSAMM  204



>ref|XP_010911621.1| PREDICTED: putative calcium-binding protein CML19 [Elaeis guineensis]
Length=201

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 125/191 (65%), Gaps = 16/191 (8%)
 Frame = -2

Query  568  KKATHSSSSPSKNSG-----FVSFCTKLTRKRAKgedssssfsseedgSCY--------E  428
            K+A +S+ S +  SG     F  F + L+ K  K    SS        + +        E
Sbjct  10   KEALNSTISTTHQSGKKPPLFCKFFSMLSPKNEKNAKVSSPSHHAVPSTIFTVSKSGELE  69

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            RVF YFDE+GDG++S AELQ  +RA G EL+AE+AE  V  +DSDGDG+LG+EDF KL++
Sbjct  70   RVFRYFDENGDGKISPAELQNCLRAAGEELSAEDAEAVVESTDSDGDGLLGLEDFLKLVD  129

Query  247  GERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDG  77
             E +E++   LR+AF MY ++G   ITP SL++ML RLGE+ +   C+AMIRRFDLNGDG
Sbjct  130  AEEEEEKGRNLRDAFKMYEMEGQGCITPNSLRRMLRRLGETRSIDECRAMIRRFDLNGDG  189

Query  76   VLGFDEFKIMM  44
            V+ FDEFK+MM
Sbjct  190  VISFDEFKVMM  200



>ref|XP_008374254.1| PREDICTED: putative calcium-binding protein CML19 [Malus domestica]
Length=140

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF YFDEDGDG+VS AEL+R +  +GGEL   EAE AV + DSDGDG+LG+ED   L
Sbjct  7    YERVFRYFDEDGDGKVSPAELRRRLGLMGGELLQNEAEAAVEMLDSDGDGLLGLEDLVGL  66

Query  253  MEGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG  +ED+   LREAF +Y ++G  +ITP SLK+ML +LGES +   CK MI+RFDLNG
Sbjct  67   MEGGEEEDKVKGLREAFELYDVEGCGFITPSSLKRMLSKLGESKSVDECKVMIQRFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGV+ F+EF+IMM 
Sbjct  127  DGVICFEEFRIMMQ  140



>ref|XP_002264919.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLTEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK +ELREAFGMY + G+  ITPKSLK+ML RLGES +   C  MIR+FD+NG
Sbjct  67   MEREDEERKMEELREAFGMYEMDGSGCITPKSLKRMLSRLGESRSVEECSVMIRQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVLGFDEFK+MM
Sbjct  127  DGVLGFDEFKLMM  139



>emb|CBI27593.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLTEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK +ELREAFGMY + G+  ITPKSLK+ML RLGES +   C  MIR+FD+NG
Sbjct  67   MEREDEERKMEELREAFGMYEMDGSGCITPKSLKRMLSRLGESRSVEECSVMIRQFDVNG  126

Query  82   DGVLGFDEFKIMMS*FIQAHTLY  14
            DGVLGFDEFK+MM   +    ++
Sbjct  127  DGVLGFDEFKLMMLMLLIPKIIF  149



>ref|XP_008233410.1| PREDICTED: probable calcium-binding protein CML31 [Prunus mume]
Length=185

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 117/184 (64%), Gaps = 21/184 (11%)
 Frame = -2

Query  586  ISPRNTKKATHSSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFAYFD  407
            +SPR TK   H    P +N    + C+ ++                       +VF +FD
Sbjct  19   VSPRKTKAGHHDVEGPIENP---TTCSSISSNSDLQMW---------------KVFDFFD  60

Query  406  EDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG---ERK  236
            E+GDG++S AELQ  VR+VGGEL+ EEAE AV  SD DGDG+LG E+F KLME    + K
Sbjct  61   ENGDGKISPAELQTCVRSVGGELSEEEAEAAVEASDFDGDGLLGFEEFQKLMEATNEDNK  120

Query  235  EDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEF  56
              +LR+AFGMY ++G+  ITP SLK+ML RLG+S +  +CKAMIR FDLNGDGVL F+EF
Sbjct  121  NQQLRDAFGMYEMEGSGCITPASLKRMLSRLGDSRSIDDCKAMIRAFDLNGDGVLSFNEF  180

Query  55   KIMM  44
             IMM
Sbjct  181  TIMM  184



>emb|CDX87576.1| BnaA07g32970D [Brassica napus]
Length=181

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = -2

Query  553  SSSSPSKNSGFVSFCTKLTRKRAKgedssssfs---seedgSCYERVFAYFDEDGDGRVS  383
            ++  P  +S FV FC KL+ KR      S+  +    ++     E VFAY DE+ DGR+S
Sbjct  4    NTQEPQSSSSFVKFCRKLSPKRKDSPAESTQHNINDDQDKNKDLEAVFAYMDENKDGRIS  63

Query  382  AAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKEDE----LREA  215
              ELQ++   +G +L+ EEAE AVRLSD+DGDGML  ++F +L++G+  +DE    L+EA
Sbjct  64   PHELQKSFMTLGEQLSDEEAEAAVRLSDTDGDGMLDFQEFAQLIKGDDDQDEKKTELKEA  123

Query  214  FGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            F MY  +G + ITP+SLK ML +LGES TT +C+ MIR FDLN DGVL FDEF +MM
Sbjct  124  FRMYIAEGEECITPRSLKTMLKKLGESRTTDDCRVMIRAFDLNADGVLSFDEFALMM  180



>gb|KDO55620.1| hypothetical protein CISIN_1g037913mg [Citrus sinensis]
Length=141

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD +GD R+S +ELQ+ V A+GGEL+  EAE AV   D+DGDG+LG +DF +L
Sbjct  8    YERVFNHFDSNGDRRISPSELQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRL  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K ++L+EAF MY + G   ITPKSLK+ML RLG+S +   CK+MI  FDLNG
Sbjct  68   VEGSGEEEKMNDLKEAFKMYEMDGCGCITPKSLKRMLSRLGQSKSDDECKSMIAYFDLNG  127

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEF+IMMS
Sbjct  128  DGVLNFDEFRIMMS  141



>emb|CDP16678.1| unnamed protein product [Coffea canephora]
Length=141

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF + DE+GDG++SA+ELQ+ V ++GGE++ EE+E AVRL D+DGDG+L +EDF ++
Sbjct  7    YERVFNHLDENGDGKISASELQQCVASMGGEMSVEESEAAVRLMDTDGDGLLCLEDFVRI  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  +L  AF MY ++G  YI PKSLK+ML RLGES + + C+ MI RFDLNG
Sbjct  67   VEGAGDEEKGADLMGAFKMYEMEGCGYINPKSLKRMLQRLGESKSINECRKMIARFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MMS
Sbjct  127  DGVLSFDEFKNMMS  140



>ref|XP_009420449.1| PREDICTED: probable calcium-binding protein CML31 [Musa acuminata 
subsp. malaccensis]
Length=215

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF Y DE+GDG++S AELQ+ +RA G E++ E+A  AV  SDSDGDG+LG+EDF KL+
Sbjct  83   ERVFNYLDENGDGKISPAELQKCMRAAGEEISPEDARSAVESSDSDGDGLLGMEDFVKLV  142

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E E +E++   LR+AFGMYA +G   ITP SL++ML RLGES +   C  MI+ FDLN D
Sbjct  143  EPEGEEEKGRNLRDAFGMYATEGQGCITPSSLRRMLKRLGESRSVEECARMIQTFDLNND  202

Query  79   GVLGFDEFKIMM  44
            GVL FDEFKIMM
Sbjct  203  GVLSFDEFKIMM  214



>ref|XP_008237869.1| PREDICTED: probable calcium-binding protein CML31 [Prunus mume]
Length=185

 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 21/184 (11%)
 Frame = -2

Query  586  ISPRNTKKATHSSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFAYFD  407
            +SPR T+   H    P +N    + C+ ++                       ++F +FD
Sbjct  19   LSPRKTEAGHHEVGGPIENP---TTCSSISSNSDLQ---------------MSKMFDFFD  60

Query  406  EDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG---ERK  236
            E+GDG++S AELQ  VR+VGGEL+ EEAE AV  SD DGDG+LG E+F KLME    + K
Sbjct  61   ENGDGKISPAELQTCVRSVGGELSEEEAEAAVEASDLDGDGLLGFEEFQKLMEATNDDNK  120

Query  235  EDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEF  56
              +LR+AFGMY ++G+  ITP SLK+ML RLG+S +  +CKAMIR FDLNGDGVL F+EF
Sbjct  121  NQQLRDAFGMYEMEGSGCITPASLKRMLSRLGDSRSIDDCKAMIRAFDLNGDGVLSFNEF  180

Query  55   KIMM  44
             IMM
Sbjct  181  TIMM  184



>ref|XP_008799158.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=163

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 104/132 (79%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG++S AELQ  +RA G EL+AE+AE  V   DSDGDG+LG+EDF KL+
Sbjct  31   ERVFRYFDENGDGKISPAELQNCLRAAGEELSAEDAEAVVESIDSDGDGLLGLEDFLKLV  90

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            + E +E++   +R+AF MY ++G   ITP SL++ML RLGES +T  C+AMIR+FDLNGD
Sbjct  91   DAEEEEEKARNIRDAFRMYEMEGQGCITPNSLRRMLKRLGESRSTDECRAMIRQFDLNGD  150

Query  79   GVLGFDEFKIMM  44
            GV+ FDEF++MM
Sbjct  151  GVISFDEFEVMM  162



>ref|XP_007209656.1| hypothetical protein PRUPE_ppa012065mg [Prunus persica]
 gb|EMJ10855.1| hypothetical protein PRUPE_ppa012065mg [Prunus persica]
Length=185

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 21/184 (11%)
 Frame = -2

Query  586  ISPRNTKKATHSSSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCYERVFAYFD  407
            +SPR TK   H    P +N    + C+ ++                       +VF +FD
Sbjct  19   LSPRKTKAGHHDVEGPIENP---TTCSSISSNSDLQMW---------------KVFDFFD  60

Query  406  EDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKED-  230
            E+GDG++S AELQ  VR+VGGEL+ EEAE AV  SD DGDG+LG E+F KLME   +++ 
Sbjct  61   ENGDGKISPAELQTCVRSVGGELSEEEAEAAVEASDLDGDGLLGFEEFQKLMEATNEDNN  120

Query  229  --ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEF  56
              +LR+AFGMY ++G+  ITP SLK+ML RLG+S +  +CKAMIR FDLNGDG L F+EF
Sbjct  121  NQQLRDAFGMYEMEGSGCITPASLKRMLSRLGDSRSIDDCKAMIRAFDLNGDGALSFNEF  180

Query  55   KIMM  44
             IMM
Sbjct  181  TIMM  184



>emb|CDX88305.1| BnaC06g37490D [Brassica napus]
Length=180

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = -2

Query  550  SSSPSKNSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVSA  380
            S+ P  +S FV FC KL+ KR          +    ++     E VFAY D + DGR+S 
Sbjct  4    STQPQSSSSFVKFCRKLSPKRKDSPAESTQHNINEDQDKNKDLEAVFAYMDANRDGRISP  63

Query  379  AELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG----ERKEDELREAF  212
             ELQ++   +G +L+ EEAE AVRLSD+DGDGML  ++F +L++G    E K+ EL+EAF
Sbjct  64   HELQKSFMTLGEQLSDEEAEAAVRLSDTDGDGMLDFQEFAQLIKGDDDQEEKKTELKEAF  123

Query  211  GMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
             MY  +G + ITP+SLK ML +LGES TT +C+ MIR FDLN DGVL FDEF +MM
Sbjct  124  RMYIAEGEECITPRSLKMMLKKLGESRTTDDCRVMIRAFDLNADGVLSFDEFALMM  179



>ref|XP_002264785.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DS+GDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLMEEAQEVVESVDSNGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK +ELREAF MY ++G++ ITPKSLK+ML RLGES +  +C  MIR+FD+NG
Sbjct  67   MEREGEERKMEELREAFRMYEMEGSECITPKSLKRMLSRLGESRSVEDCSVMIRQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLSFDEFKLMM  139



>ref|XP_007216735.1| hypothetical protein PRUPE_ppa025431mg [Prunus persica]
 gb|EMJ17934.1| hypothetical protein PRUPE_ppa025431mg [Prunus persica]
Length=143

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD +GDG++S  ELQ+ VRA+GGEL+  EAE AV   DSDGDG+L ++DF K 
Sbjct  7    YERVFNHFDANGDGKISPLELQQCVRAIGGELSLTEAEVAVEHLDSDGDGLLCLDDFVKF  66

Query  253  MEGERKE---DELREAFGMYAIK---GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            ++G R+E   ++L+EAF MY +    G   ITPKSLK+ML RLGES +  +CK MI RFD
Sbjct  67   VDGGREEEKVNDLKEAFNMYVMDDGCGFSCITPKSLKRMLSRLGESKSVDDCKVMISRFD  126

Query  91   LNGDGVLGFDEFKIMM  44
            LNGDGVL FDEFK+MM
Sbjct  127  LNGDGVLNFDEFKVMM  142



>gb|KJB76415.1| hypothetical protein B456_012G087800 [Gossypium raimondii]
Length=140

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FDE+ DG++S AELQ+ V+A+GGEL+ EEAE AV + D+DGDG+LG+EDF +L
Sbjct  7    YERVFNHFDENKDGKISPAELQQCVKAIGGELSREEAEVAVEVLDTDGDGLLGLEDFIRL  66

Query  253  MEGERKE---DELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +E   +E   ++L+EAF MY ++G   ITPKSLK+ML RLGES T   CK+MI +FDLNG
Sbjct  67   VEEVGEEEKVNDLKEAFKMYEMEGCGCITPKSLKRMLSRLGESRTLEECKSMIAQFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF++MM
Sbjct  127  DGVLNFDEFRVMM  139



>ref|XP_006447105.1| hypothetical protein CICLE_v10018267mg [Citrus clementina]
 ref|XP_006470029.1| PREDICTED: calcium-binding protein CML38-like [Citrus sinensis]
 gb|ESR60345.1| hypothetical protein CICLE_v10018267mg [Citrus clementina]
Length=141

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD +GD ++S +E+Q+ V A+GGEL+  EAE AV   D+DGDG+LG +DF +L
Sbjct  8    YERVFNHFDSNGDRKISPSEIQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRL  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K ++L+EAF MY + G   ITPKSLK+ML RLG+S +   CK+MI  FDLNG
Sbjct  68   VEGSGEEEKMNDLKEAFKMYEMDGCGCITPKSLKRMLSRLGQSKSDDECKSMIAYFDLNG  127

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEF+IMMS
Sbjct  128  DGVLNFDEFRIMMS  141



>ref|XP_009420461.1| PREDICTED: probable calcium-binding protein CML31 [Musa acuminata 
subsp. malaccensis]
Length=215

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF Y DE+GDG++S AEL + +RA G E++ E+A  AV  SDSDGDG+LG+EDF KL+
Sbjct  83   ERVFDYLDENGDGKISPAELHKCMRAAGEEISPEDARSAVESSDSDGDGLLGMEDFVKLV  142

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E E  E++   LR+AFGMYA +G   ITP SL++ML RLGES +   C  MI+ FDLNGD
Sbjct  143  EAEGDEEKGRNLRDAFGMYATEGQGCITPSSLRRMLKRLGESRSVDECARMIQTFDLNGD  202

Query  79   GVLGFDEFKIMM  44
            GVL FDEFKIMM
Sbjct  203  GVLSFDEFKIMM  214



>ref|XP_002307832.1| hypothetical protein POPTR_0005s28110g [Populus trichocarpa]
 gb|EEE94828.1| hypothetical protein POPTR_0005s28110g [Populus trichocarpa]
Length=197

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 100/134 (75%), Gaps = 5/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            +RVF YFDEDGDGR+S AEL+  +  VGG+L+ EEAE AV  SD DGDG+LG +DF  LM
Sbjct  63   QRVFNYFDEDGDGRISPAELRSCITTVGGQLSIEEAEAAVSFSDMDGDGLLGFQDFQCLM  122

Query  250  EG----ERKEDELREAFGMYAIK-GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
             G    E K +ELR+AFGMY  + G+  ITP SLK+ML RLG+S + ++CKAMIR FDLN
Sbjct  123  AGSASEEEKTEELRQAFGMYETEPGSGCITPTSLKRMLSRLGKSRSINDCKAMIRTFDLN  182

Query  85   GDGVLGFDEFKIMM  44
            GDGVL F EF +MM
Sbjct  183  GDGVLSFHEFSVMM  196



>ref|XP_009106331.1| PREDICTED: calcium-binding protein CML38 [Brassica rapa]
Length=181

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 7/177 (4%)
 Frame = -2

Query  553  SSSSPSKNSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVS  383
            ++  P  +S FV FC KL+ KR          +    ++     E VFAY D + DGR+S
Sbjct  4    NTQEPQSSSSFVKFCRKLSPKRKDSPAESTQHNINEDQDKNKDLEAVFAYMDANRDGRIS  63

Query  382  AAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG----ERKEDELREA  215
              ELQ++   +G +L+ EEAE AVRLSD+DGDGML  ++F +L++G    E K+ EL+EA
Sbjct  64   PHELQKSFMTLGEQLSDEEAEAAVRLSDTDGDGMLDFQEFAQLIKGDDDQEDKKTELKEA  123

Query  214  FGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            F MY  +G + ITP+SLK ML +LGES TT +C+ MIR FDLN DGVL FDEF +MM
Sbjct  124  FRMYIAEGEECITPRSLKTMLKKLGESRTTDDCRVMIRAFDLNADGVLSFDEFALMM  180



>ref|XP_012073527.1| PREDICTED: calcium-binding protein CML38-like [Jatropha curcas]
 gb|KDP36713.1| hypothetical protein JCGZ_08004 [Jatropha curcas]
Length=193

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            +RVF YFDE+GDG++S AELQ  VR +GG+L+ E+A  A+   D+DGDG+LG EDF KLM
Sbjct  59   QRVFNYFDENGDGKISPAELQSCVRTLGGDLSIEDAVAAISSCDTDGDGLLGFEDFQKLM  118

Query  250  EG----ERKEDELREAFGMYAIK-GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            +     E K++ELR+AFG+Y  + G+ +I+P SLK++L RLGES +  +CKAMIR FDLN
Sbjct  119  DCNSSEEDKKEELRQAFGIYETEPGSGFISPTSLKRILSRLGESRSLDDCKAMIRTFDLN  178

Query  85   GDGVLGFDEFKIMM  44
            GDGVL F+EF +MM
Sbjct  179  GDGVLNFNEFSVMM  192



>ref|XP_011467704.1| PREDICTED: calcium-binding protein CML38 [Fragaria vesca subsp. 
vesca]
Length=140

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FD +GDG++S  ELQ+ V A+GGEL++ EAE AV   DSD DG+LG +DF K 
Sbjct  7    YERVFNQFDGNGDGKISPMELQQCVEAIGGELSSSEAEAAVEYLDSDRDGLLGFDDFVKF  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K ++LREAF MY   G   ITPKSLK+ML RLGES +   CK MI +FDLNG
Sbjct  67   VEGGDEEEKVNDLREAFKMYDTDGCGCITPKSLKRMLSRLGESRSVDECKVMIAKFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLNFDEFKVMM  139



>ref|XP_009359450.1| PREDICTED: putative calcium-binding protein CML19 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009359451.1| PREDICTED: putative calcium-binding protein CML19 isoform X2 
[Pyrus x bretschneideri]
Length=140

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF YFDEDGDG++S +EL+R +  +GGEL   EAE AV + DSDGDG+LG+ED   L
Sbjct  7    YERVFRYFDEDGDGKISPSELRRRLGLMGGELLQNEAEMAVEMLDSDGDGLLGLEDLVGL  66

Query  253  MEGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG ++E++   LREAF +Y ++   +ITP SLK+ML +LGES +   CK MI+RFDLNG
Sbjct  67   MEGGKEEEKVKGLREAFEVYDVERCGFITPSSLKRMLSKLGESKSIDECKVMIQRFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DG++ F+EF+IMM 
Sbjct  127  DGLISFEEFRIMMQ  140



>ref|XP_002264640.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG++G+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLMEEAQEVVESMDSDGDGLVGLEEFVGW  66

Query  253  M--EGE-RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            M  EGE RK +ELREAF MY ++G+  ITPKSLK+ML RLGES +   C  MIR+FD+NG
Sbjct  67   MKREGEERKMEELREAFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIRQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLSFDEFKLMM  139



>ref|XP_006365695.1| PREDICTED: calcium-binding protein CML37-like [Solanum tuberosum]
Length=121

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 95/121 (79%), Gaps = 6/121 (5%)
 Frame = -2

Query  391  RVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG---ER-KEDEL  224
            R+      R ++AVGGELT EEAE AVRLSDSDGDG+LG+EDFTKLMEG   ER KE EL
Sbjct  2    RIFIGTFWRCMKAVGGELTMEEAEMAVRLSDSDGDGLLGLEDFTKLMEGMEEERNKESEL  61

Query  223  REAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
              AFGMY ++G  YITPKSLK ML RLGEST+   CK MIRRFD+NGDGVL FDEFKIMM
Sbjct  62   MGAFGMYEMEG--YITPKSLKMMLSRLGESTSIDKCKVMIRRFDINGDGVLSFDEFKIMM  119

Query  43   S  41
            +
Sbjct  120  T  120



>ref|XP_002264877.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE +F  FDEDGDG++S  ELQR V ++G EL  EEA E V   DSDGDG++G+E+F   
Sbjct  7    YELIFKRFDEDGDGKLSPWELQRCVGSIGEELLMEEAREVVESMDSDGDGLVGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK  ELREAFGMY + G+  ITPKSLK+ML RLGES +   C  M+R+FD+NG
Sbjct  67   MEREDEERKMKELREAFGMYEMDGSGCITPKSLKRMLSRLGESRSVEECGVMLRQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLSFDEFKLMM  139



>ref|XP_008231145.1| PREDICTED: calcium-binding protein CML38 [Prunus mume]
Length=143

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD +GDG++S  ELQ+ VRA+GGEL+  EAE AV   DSDGDG+L ++DF K 
Sbjct  7    YERVFNHFDANGDGKISPLELQQCVRAIGGELSLTEAEVAVEHLDSDGDGLLCLDDFVKF  66

Query  253  MEGERKE---DELREAFGMYAIK---GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            ++G R+E   ++L+EAF MY +    G   ITPKSLK+ML RLGES +   CK MI R+D
Sbjct  67   VDGGREEEKVNDLKEAFKMYVMDDGCGFGCITPKSLKRMLSRLGESKSVDECKVMISRYD  126

Query  91   LNGDGVLGFDEFKIMM  44
            LNGDGVL FDEFK+MM
Sbjct  127  LNGDGVLNFDEFKVMM  142



>gb|EYU34794.1| hypothetical protein MIMGU_mgv1a015890mg [Erythranthe guttata]
Length=142

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD +GDGR+S AEL++ V  +GG +TAEEA  AV L+DSDGDG++ ++DF K+
Sbjct  7    YERVFNHFDSNGDGRISPAELRQCVCTIGGVMTAEEAAAAVALTDSDGDGLMCLDDFVKV  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  +L+ AFGMY ++G   ITP+SLK+ML RLG+  +   CK MI RFDLNG
Sbjct  67   VEGAGEEEKTSDLKAAFGMYELEGRGCITPESLKRMLSRLGQQRSVDECKNMIARFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MMS
Sbjct  127  DGVLNFDEFKVMMS  140



>ref|XP_010111596.1| Calcium-binding protein CML38 [Morus notabilis]
 gb|EXC31341.1| Calcium-binding protein CML38 [Morus notabilis]
Length=140

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD DGDG++S  ELQ  V ++GGEL+  EAE A+   DSDGD +LG++DF K 
Sbjct  7    YERVFNHFDADGDGKISPLELQTCVGSIGGELSEAEAEAAMDYLDSDGDRLLGLDDFVKF  66

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG R+E+   +L+EAF MY ++G   ITPKSLK+ML RLGES +  +CK MI RFDL G
Sbjct  67   LEGGREEEKVKDLKEAFKMYEMEGCGCITPKSLKRMLSRLGESKSIDDCKVMIARFDLKG  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEF +MMS
Sbjct  127  DGVLNFDEFMVMMS  140



>ref|XP_007037951.1| Calmodulin like 37 [Theobroma cacao]
 gb|EOY22452.1| Calmodulin like 37 [Theobroma cacao]
Length=140

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  YFDEDGDG++SA+EL R +  +GGEL   EAE A+   DS+GDG+L +ED   L
Sbjct  7    YERVLRYFDEDGDGKISASELSRRLGQMGGELLLNEAEAAIEALDSNGDGLLDLEDLIGL  66

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME   +ED   +LREAFGMY   G  +ITPK LKKML RLGES +   CK MI++FDLNG
Sbjct  67   MEEVGEEDKLKDLREAFGMYDADGCGFITPKGLKKMLNRLGESKSIDECKVMIKQFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL F+EF++MM 
Sbjct  127  DGVLSFEEFRVMMQ  140



>ref|XP_002264177.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   148 bits (374),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLMEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK +ELREAFGMY ++G+  IT KSLK+ML RLGES +   C  MIR+FD+N 
Sbjct  67   MEREGEERKMEELREAFGMYEMEGSGCITAKSLKRMLSRLGESRSVEECCVMIRQFDVNC  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLSFDEFKLMM  139



>ref|XP_002264459.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE +F  FDEDGDG++S +EL+R +  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YEHIFKRFDEDGDGKLSPSELRRCLGTIGEELMMEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK ++LREAF MY ++G+ YITPKSLK+ML RLGES +   C  MI +FD+NG
Sbjct  67   MEREGEERKMEDLREAFRMYEMEGSGYITPKSLKRMLSRLGESRSVEECSVMIAQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+M+
Sbjct  127  DGVLSFDEFKLML  139



>ref|XP_010913814.1| PREDICTED: probable calcium-binding protein CML31 [Elaeis guineensis]
Length=205

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG++S +EL+  +R VG EL+ E+AE  V  SDSDGDG+L  +DF +L+
Sbjct  73   ERVFRYFDENGDGKISPSELRNCMRTVGEELSHEDAEAVVASSDSDGDGLLCYDDFVRLV  132

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            + E +E++   LREAFG+Y ++G   ITPKSLK+ L RLG+S TT  C AMIRRFDLNGD
Sbjct  133  DVEGEEEKVRSLREAFGVYEMEGQGCITPKSLKRALQRLGDSRTTKECTAMIRRFDLNGD  192

Query  79   GVLGFDEFKIMM  44
            GVL F+EF++MM
Sbjct  193  GVLSFEEFRVMM  204



>gb|ABP04242.1| calmodulin-like protein [Elaeis guineensis]
Length=222

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG++S +EL+  +R VG EL+ E+AE  V  SDSDGDG+L  +DF +L+
Sbjct  90   ERVFRYFDENGDGKISPSELRNCMRTVGEELSHEDAEAVVASSDSDGDGLLCYDDFVRLV  149

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            + E +E++   LREAFG+Y ++G   ITPKSLK+ L RLG+S TT  C AMIRRFDLNGD
Sbjct  150  DVEGEEEKVRSLREAFGVYEMEGQGCITPKSLKRALQRLGDSRTTKECTAMIRRFDLNGD  209

Query  79   GVLGFDEFKIMM  44
            GVL F+EF++MM
Sbjct  210  GVLSFEEFRVMM  221



>ref|XP_010063194.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus 
grandis]
 gb|KCW70395.1| hypothetical protein EUGRSUZ_F03632 [Eucalyptus grandis]
Length=201

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            RVF YFDE+GDG++S AEL+  V ++GG+L++EEAE AVR SD DGDGMLG E+F +L+E
Sbjct  70   RVFDYFDENGDGKISPAELRSCVSSLGGDLSSEEAEMAVRASDLDGDGMLGFEEFQRLVE  129

Query  247  G---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDG  77
                E K  +L EAFGMY ++G+  IT  SL++ML RLGE+ +  +CKAMIR FDLNGDG
Sbjct  130  SGGEEEKRKDLEEAFGMYEMEGSGCITAGSLRRMLSRLGEARSVEDCKAMIRAFDLNGDG  189

Query  76   VLGFDEFKIMM  44
            VL FDEF +MM
Sbjct  190  VLSFDEFSVMM  200



>ref|XP_009375226.1| PREDICTED: putative calcium-binding protein CML19 [Pyrus x bretschneideri]
 ref|XP_009375234.1| PREDICTED: putative calcium-binding protein CML19 [Pyrus x bretschneideri]
 ref|XP_009346517.1| PREDICTED: putative calcium-binding protein CML19 [Pyrus x bretschneideri]
Length=140

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF YFDEDGDG+VS AEL+R +  +GGEL   EAE AV + DSDGDG+LG+ED   L
Sbjct  7    YERVFRYFDEDGDGKVSPAELRRRLGLMGGELLQNEAEAAVEMLDSDGDGLLGLEDLVGL  66

Query  253  MEGER---KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG     K   LREAF +Y ++G  +ITP SLK+ML +LGES +   CK MI+RFDLNG
Sbjct  67   MEGGEEEEKVKGLREAFEVYDVEGCGFITPSSLKRMLSKLGESKSVDECKVMIQRFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGV+ F+EF+IMM 
Sbjct  127  DGVICFEEFRIMMQ  140



>ref|XP_011003944.1| PREDICTED: calcium-binding protein CML38 [Populus euphratica]
Length=144

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERVF +FDE+GDG++S +ELQ+ VR +GGEL+  +AE AV  SD DGDG LG+EDF KL
Sbjct  8    FERVFNHFDENGDGKISPSELQQCVRKMGGELSVADAEAAVEFSDLDGDGSLGLEDFVKL  67

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG  +E+    L+EAF MY ++ +  ITPKSLK+ML RLGES T   C+ MI  FDLNG
Sbjct  68   VEGGEEEEKVKSLKEAFKMYEMEESGCITPKSLKRMLSRLGESKTIDECRIMISWFDLNG  127

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  128  DGVLNFDEFKVMM  140



>ref|XP_002510759.1| Calmodulin, putative [Ricinus communis]
 gb|EEF52946.1| Calmodulin, putative [Ricinus communis]
Length=190

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 102/134 (76%), Gaps = 5/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            +RVF YFDE+ DG++SAAELQR VRAVGGEL+ E+AE AV  +D+DGD +LG EDF +LM
Sbjct  56   QRVFDYFDENRDGKISAAELQRCVRAVGGELSTEDAEAAVISADTDGDCLLGFEDFQRLM  115

Query  250  EGERK----EDELREAFGMYAIK-GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            EG       ++ELR+AFGMY  + G+ +I+P SLK+ML RLG+S +  +C  MIR FD+N
Sbjct  116  EGSNSEEEKKEELRQAFGMYETEPGSGFISPASLKRMLSRLGDSKSLTDCSQMIRTFDIN  175

Query  85   GDGVLGFDEFKIMM  44
            GDG+L F EF +MM
Sbjct  176  GDGLLSFHEFSLMM  189



>ref|XP_003618823.1| Calcium-binding protein CML38 [Medicago truncatula]
 gb|AES75041.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=142

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y RVF +FDE+GDG++S++EL++ V A+G +++ EEAE AV L DSDGDG++G++DF K 
Sbjct  9    YIRVFNHFDENGDGKISSSELRQCVEAIGAKMSNEEAEMAVELLDSDGDGLIGLDDFVKF  68

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K ++LREAF MY ++G   ITPKSLK+ML RLGE  +   C+AMI +FD++G
Sbjct  69   VEGGKEEEKVNDLREAFKMYEMEGCGCITPKSLKRMLGRLGECRSVDECQAMISQFDIDG  128

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF+ MM
Sbjct  129  DGVLSFDEFRTMM  141



>ref|XP_008392828.1| PREDICTED: putative calcium-binding protein CML19 [Malus domestica]
 ref|XP_008351744.1| PREDICTED: putative calcium-binding protein CML19 [Malus domestica]
Length=140

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF YFDEDGDG++S +EL+R +  +GGEL   EAE AV + DSDGDG+LG+ED   L
Sbjct  7    YERVFRYFDEDGDGKISPSELRRRLGLMGGELLQNEAEVAVEMLDSDGDGLLGLEDLVGL  66

Query  253  MEGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG ++E++   LR AF +Y +    +ITP SLK+ML +LGES +   CK MI+R+DLNG
Sbjct  67   MEGGKEEEKVKGLRXAFEVYDVXRCGFITPSSLKRMLSKLGESKSIDECKVMIQRYDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DG++ F+EF+IMM 
Sbjct  127  DGLISFEEFRIMMQ  140



>emb|CBI15642.3| unnamed protein product [Vitis vinifera]
Length=143

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E+VF  FDED DG++S +EL R V  +GGEL  +EAE  V+  DSDGDG+L +EDF +L
Sbjct  7    FEQVFNQFDEDHDGKLSPSELTRCVGLIGGELPLKEAEAVVQQLDSDGDGLLSLEDFIRL  66

Query  253  MEGER------KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            MEGE       K +ELREAFGMY + G  +ITPKSLK+ML RLG+  +   C+ MI +FD
Sbjct  67   MEGEGGEGEEEKMNELREAFGMYDMDGCGFITPKSLKRMLSRLGQKKSVDECRVMINQFD  126

Query  91   LNGDGVLGFDEFKIMM  44
            LNGDGVL FDEFK+MM
Sbjct  127  LNGDGVLSFDEFKVMM  142



>ref|XP_008379126.1| PREDICTED: putative calcium-binding protein CML19 [Malus domestica]
Length=140

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FD +GDG++S  ELQ+ V A+G EL+  EAE AV   DSDG+G+LG++DF K 
Sbjct  7    YERVFKQFDGNGDGKISPMELQQCVGAIGSELSLTEAEVAVEYLDSDGEGLLGLDDFVKF  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++G   E K   LREAF M+ + G+  ITPKSLK+ML R+GES +   CK MI RFDLN 
Sbjct  67   VDGGCDEEKVSVLREAFKMHVMDGSGCITPKSLKRMLSRIGESKSVDECKNMIARFDLNS  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLNFDEFKVMM  139



>ref|XP_002263765.1| PREDICTED: probable calcium-binding protein CML31 isoform X2 
[Vitis vinifera]
 ref|XP_010655569.1| PREDICTED: probable calcium-binding protein CML31 isoform X1 
[Vitis vinifera]
Length=140

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVETIGEELLIEEAQELVESMDSDGDGLLGMEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK +ELREAF MY ++G+  IT KSLK+ML RLGES +   C  MI +FD+NG
Sbjct  67   MEREGEERKMEELREAFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECGVMIGQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLSFDEFKLMM  139



>ref|XP_010663735.1| PREDICTED: putative calcium-binding protein CML19 [Vitis vinifera]
 emb|CAN81786.1| hypothetical protein VITISV_026005 [Vitis vinifera]
Length=212

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E+VF  FDED DG++S +EL R V  +GGEL  +EAE  V+  DSDGDG+L +EDF +L
Sbjct  76   FEQVFNQFDEDHDGKLSPSELTRCVGLIGGELPLKEAEAVVQQLDSDGDGLLSLEDFIRL  135

Query  253  MEGER------KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            MEGE       K +ELREAFGMY + G  +ITPKSLK+ML RLG+  +   C+ MI +FD
Sbjct  136  MEGEGGEGEEEKMNELREAFGMYDMDGCGFITPKSLKRMLSRLGQKKSVDECRVMINQFD  195

Query  91   LNGDGVLGFDEFKIMM  44
            LNGDGVL FDEFK+MM
Sbjct  196  LNGDGVLSFDEFKVMM  211



>ref|XP_002300609.1| hypothetical protein POPTR_0002s00350g [Populus trichocarpa]
 gb|EEE79882.1| hypothetical protein POPTR_0002s00350g [Populus trichocarpa]
Length=192

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF YFDE+GDG++S AELQ  + +VGG+L+ EEAE A+R SD DGDG+LG +DF  LM G
Sbjct  60   VFNYFDENGDGKISPAELQSCITSVGGKLSIEEAEAAIRFSDMDGDGLLGFQDFLCLMTG  119

Query  244  ----ERKEDELREAFGMYAIK-GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
                E K ++LR+AFG+Y  + G+  IT  SLK+ML RLGES + ++CKA+IR FDLNGD
Sbjct  120  NLSEEEKTEDLRQAFGLYETEPGSGCITHSSLKRMLSRLGESNSINDCKAIIRTFDLNGD  179

Query  79   GVLGFDEFKIMM  44
            GVL F EF +MM
Sbjct  180  GVLSFHEFAVMM  191



>ref|XP_010669984.1| PREDICTED: calcium-binding protein CML39-like [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 101/142 (71%), Gaps = 13/142 (9%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            E+VF Y DEDGDG++S AEL+R V+AVG + L+ EEAE AV  SDSDGDG+L + DF +L
Sbjct  52   EKVFRYIDEDGDGKISPAELRRCVKAVGAQRLSVEEAEAAVECSDSDGDGLLSLNDFERL  111

Query  253  MEG-----ERKEDELREAFGMY-------AIKGTDYITPKSLKKMLCRLGESTTTHNCKA  110
            M+G     E K+DELREAF MY           +  ITPKSLK+ML RLG+  + H+CK 
Sbjct  112  MKGNGLSEEEKKDELREAFLMYNDNKKKKKKVSSGVITPKSLKRMLSRLGDHKSIHDCKD  171

Query  109  MIRRFDLNGDGVLGFDEFKIMM  44
            MIR +DLNGDGVL FDEF IMM
Sbjct  172  MIRVYDLNGDGVLSFDEFAIMM  193



>emb|CAN80081.1| hypothetical protein VITISV_011291 [Vitis vinifera]
Length=140

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R +  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCLGTIGEELLMEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK  +LREAF MY ++G+  ITPKSLK+ML RLGES +   C  MI +FD NG
Sbjct  67   MEREGEERKMQDLREAFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIAQFDXNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+M+
Sbjct  127  DGVLSFDEFKLML  139



>ref|XP_002264677.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+  V  +G EL  EEA+E V   DSDGDG++G+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRSCVGTIGEELLMEEAQEVVESMDSDGDGLVGLEEFVGC  66

Query  253  MEGE---RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME E   RK +ELREAF MY ++G+  ITPKSLK+ML RLGES +   C  MIR+FD+NG
Sbjct  67   MEREGEKRKMEELREAFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIRQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGV+ F EFK+MM
Sbjct  127  DGVMSFYEFKLMM  139



>gb|EYU34793.1| hypothetical protein MIMGU_mgv1a021590mg [Erythranthe guttata]
Length=142

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD +GDGR+S  EL+  V ++GG +TA+EAE AV L DSDGDG + ++DF ++
Sbjct  7    YERVFKHFDSNGDGRISPEELRHCVASIGGVMTADEAEAAVALVDSDGDGQMCLDDFVRI  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  +L+ AF +Y ++G+  ITP+SLK+ML +LG+ +T   C+ MI RFD+NG
Sbjct  67   VEGAGDEEKASDLKWAFKLYEMEGSGCITPESLKRMLSKLGQRSTVDQCRNMIARFDING  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK+MMS
Sbjct  127  DGVLNFDEFKVMMS  140



>ref|XP_003553918.1| PREDICTED: probable calcium-binding protein CML31-like [Glycine 
max]
Length=140

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDE+GDG++SA+EL + V A+GGEL+ ++AE AV L DSDGDG++G +DF + 
Sbjct  7    YERLFNQFDENGDGKISASELWQCVEAMGGELSEKDAEAAVALMDSDGDGLVGFDDFLRF  66

Query  253  MEGERKE---DELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG ++E   D L+EAF MY + G+  ITP+SLK+ML RLGES +   CK MI RFDL+G
Sbjct  67   VEGGKEEEKEDGLKEAFKMYEMDGSGCITPRSLKRMLSRLGESRSIDECKVMIARFDLDG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLTFDEFKVMM  139



>ref|XP_002264326.1| PREDICTED: putative calcium-binding protein CML23 [Vitis vinifera]
Length=140

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R +  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCLGKIGEELLMEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK ++LREAF MY ++G+  ITPKSLK+ML RLGES +   C  +I +FD+NG
Sbjct  67   MEREGEERKMEDLREAFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVIIGQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+M+
Sbjct  127  DGVLSFDEFKLML  139



>ref|XP_011041111.1| PREDICTED: probable calcium-binding protein CML31 [Populus euphratica]
Length=195

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 5/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            +RVF YFDEDGDG++S AEL+  +  VGG+L+ EEAE AV  SD DGDG+LG +DF  LM
Sbjct  61   QRVFNYFDEDGDGKISPAELRSCITTVGGQLSIEEAEAAVSFSDMDGDGLLGFQDFQCLM  120

Query  250  EGERKEDE----LREAFGMYAIK-GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
             G   ++E    LR+AF  Y  + G+  ITP SLK+ML RLGES + ++CKAMIR FDLN
Sbjct  121  AGSASKEEETEALRQAFEKYETEPGSGCITPTSLKRMLSRLGESRSINDCKAMIRTFDLN  180

Query  85   GDGVLGFDEFKIMM  44
            GDGVL F EF +MM
Sbjct  181  GDGVLSFHEFSVMM  194



>ref|XP_002264501.1| PREDICTED: probable calcium-binding protein CML31 [Vitis vinifera]
Length=140

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R +  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCLGTIGEELLMEEAQELVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK ++LREAF MY ++G+  IT KSLK+ML RLGES +   C  MI +FD+NG
Sbjct  67   MEREGEERKMEDLREAFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECSVMIGQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLSFDEFKLMM  139



>ref|XP_010026612.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus 
grandis]
 gb|KCW83172.1| hypothetical protein EUGRSUZ_B00125 [Eucalyptus grandis]
Length=143

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FDEDGDG++S +EL+R V   GGEL  +EAE  V   DSDGDG+L +EDF   
Sbjct  10   YERVFRCFDEDGDGKLSPSELRRHVGLTGGELLLKEAEVTVESLDSDGDGLLCLEDFVGF  69

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG  +E+   +LREAFGMY   G  +ITPKSLK+ML RLGES    +CKAMIR FDL+G
Sbjct  70   MEGGGEEEKMGDLREAFGMYVTDGCGFITPKSLKRMLSRLGESKAEDDCKAMIRHFDLDG  129

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEFK+MM
Sbjct  130  DGVISFDEFKVMM  142



>emb|CBI27599.3| unnamed protein product [Vitis vinifera]
Length=156

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 100/149 (67%), Gaps = 19/149 (13%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R +  +G EL  EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCLGTIGEELLMEEAQELVESMDSDGDGLLGLEEFVGW  66

Query  253  ME-------------------GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGEST  131
            ME                    ERK ++LREAF MY ++G+ YITPKSLK+ML RLGES 
Sbjct  67   MEREDGLLGLEEFVGWMEREGEERKMEDLREAFRMYEMEGSGYITPKSLKRMLSRLGESR  126

Query  130  TTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            +   C  MI +FD+NGDGVL FDEFK+M+
Sbjct  127  SVEECSVMIAQFDVNGDGVLSFDEFKLML  155



>ref|XP_011034753.1| PREDICTED: putative calcium-binding protein CML19 [Populus euphratica]
Length=192

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            RVF  FDE+GDG++S AELQ  + +VGG+L+ EEAE A+R SD DGDG+LG +DF  LM 
Sbjct  59   RVFNCFDENGDGKISPAELQSCITSVGGKLSIEEAEAAIRFSDMDGDGLLGFQDFLCLMT  118

Query  247  G----ERKEDELREAFGMYAIK-GTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            G    E K ++LR+AFG+Y  + G+  IT  SLK+ML R+GES + ++CKAMIR FDL+G
Sbjct  119  GNASEEEKTEDLRQAFGLYETEPGSGCITHTSLKRMLSRMGESNSINDCKAMIRTFDLDG  178

Query  82   DGVLGFDEFKIMM  44
            DGVL F EF +MM
Sbjct  179  DGVLSFQEFAVMM  191



>ref|XP_003523141.1| PREDICTED: calcium-binding protein CML38-like [Glycine max]
 gb|KHN31903.1| Calcium-binding protein CML38 [Glycine soja]
Length=140

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E V  YFDEDGDG+VS +EL+  +R +GGEL  +EAE A+   DSDGDG+L +ED   L
Sbjct  7    FEDVLRYFDEDGDGKVSPSELKHGLRMMGGELLMKEAEMAIAALDSDGDGLLSLEDLIAL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E+K ++L+ AF MY  +G  +ITPKSLK+ML ++GES +   CKAMI++FDLNG
Sbjct  67   MEAGGEEQKLNDLKVAFEMYDTEGCGFITPKSLKRMLKKMGESKSIDECKAMIKQFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL  +EF+IMM 
Sbjct  127  DGVLSIEEFRIMMQ  140



>emb|CBI27597.3| unnamed protein product [Vitis vinifera]
Length=148

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG++G+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLMEEAQEVVESMDSDGDGLVGLEEFVGW  66

Query  253  M--EGE-RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            M  EGE RK +ELREAF MY ++G+  ITPKSLK+ML RLGES +   C  MIR+FD+NG
Sbjct  67   MKREGEERKMEELREAFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIRQFDVNG  126

Query  82   DGVLGFDE  59
            DGVL FDE
Sbjct  127  DGVLSFDE  134



>ref|XP_008799159.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=193

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            ++RVF +FDE+GDG++S  ELQ  +R +G E++ E+    V  SDSDGDG+LG +DF K+
Sbjct  60   FQRVFRFFDENGDGKISPVELQSCMRTIGEEVSLEDTAALVESSDSDGDGLLGFDDFIKM  119

Query  253  MEGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +  E +E++   LREAF +Y + G + ITP SLK+ L +LGES T   C  MIRRFD+NG
Sbjct  120  VGPEGEEEKGRSLREAFRVYQMDGQECITPTSLKRALGKLGESKTIEECTVMIRRFDING  179

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEF IMM
Sbjct  180  DGVISFDEFTIMM  192



>ref|XP_008782798.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=203

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG++S AEL+  +R  G EL+ E+AE  V  SDSDGDG+L  +DF +L+
Sbjct  71   ERVFRYFDENGDGKISPAELRSRMRIAGEELSPEDAEAVVASSDSDGDGLLCYDDFVRLL  130

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            + E +E++   LREAF +Y ++G   ITPKSLK+ L  LGES TT  C AMIRRFDL+GD
Sbjct  131  DVEGEEEKARSLREAFRVYEMEGRGCITPKSLKRALRTLGESRTTKECVAMIRRFDLDGD  190

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  191  GVLSFDEFSVMM  202



>gb|KJB40017.1| hypothetical protein B456_007G042400 [Gossypium raimondii]
Length=140

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV +YFD DGDG++SA+EL   +  +GGEL   EA+ A+   DS+GDG+L +EDF  L
Sbjct  7    YERVLSYFDRDGDGKISASELSHRLGLMGGELKLNEAQVAIEALDSNGDGLLDLEDFIGL  66

Query  253  ME--GE-RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +E  GE  K  +L+EAF MY   G  +ITPK LKKML +LGE  +   CK MI+RFDLNG
Sbjct  67   LEEGGEAEKTKDLKEAFQMYDTDGNGFITPKDLKKMLSKLGEFKSIDECKVMIKRFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGV+ F+EFK+MM 
Sbjct  127  DGVISFEEFKLMMQ  140



>gb|KEH31724.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=140

 Score =   140 bits (354),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV +YFDED DG++S  EL+  +  +GGE   +E E A+   DSDGDG+L +ED  KL
Sbjct  7    YERVLSYFDEDRDGKISPNELRSRMAKIGGEFQLKEVEIAIEALDSDGDGLLSLEDLIKL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +G  +ITPKSLK+ML +LG+S +   CK MI+RFDL+G
Sbjct  67   MESGGEEEKLKDLREAFEMYDNEGCGFITPKSLKRMLKKLGDSKSIEECKLMIKRFDLDG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF+IMM
Sbjct  127  DGVLSFEEFRIMM  139



>ref|XP_009415709.1| PREDICTED: putative calcium-binding protein CML19 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            RVF +FDED DG++SA ELQ  +RA+G EL+ E+A   V   DSDGDG+LG +D  +L++
Sbjct  65   RVFCFFDEDCDGKISATELQSCMRAMGEELSHEDAVAVVESIDSDGDGLLGFDDIVRLVD  124

Query  247  GE---RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDG  77
            GE    KE  +REAF MY ++G   ITPKSL+  L RLGES +   C+ MIRRFD N DG
Sbjct  125  GEGENEKEQNMREAFRMYEMEGEGCITPKSLRSALERLGESKSMEECRNMIRRFDTNDDG  184

Query  76   VLGFDEFKIMM  44
            V+ FDEF+IMM
Sbjct  185  VISFDEFRIMM  195



>ref|XP_010033396.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus 
grandis]
 gb|KCW53024.1| hypothetical protein EUGRSUZ_J02318 [Eucalyptus grandis]
Length=141

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y RVF++FD D DG++S AEL++ V AVGGE++  EAE AV   D DGDG LG EDF   
Sbjct  7    YARVFSHFDGDKDGKISPAELRQCVAAVGGEMSPAEAEAAVAALDGDGDGHLGFEDFMAF  66

Query  253  MEG---ERKEDELREAFGMYAIKGTD-YITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            +EG   E +  +L+EAF MY + G+   ITPKSLK+ML RLGES +   CKAMI RFDLN
Sbjct  67   VEGGGAEERAADLKEAFRMYEVDGSGGCITPKSLKRMLSRLGESRSLDECKAMIARFDLN  126

Query  85   GDGVLGFDEFKIMMS  41
            GDGV+ FDEF++MMS
Sbjct  127  GDGVINFDEFRVMMS  141



>ref|XP_010928758.1| PREDICTED: probable calcium-binding protein CML31 [Elaeis guineensis]
Length=227

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG++S AEL+  +R  G EL+ EEAE  V  SDSDGDG+L  EDF +L+
Sbjct  95   ERVFRYFDENGDGKISPAELRSRMRTAGEELSPEEAEAVVASSDSDGDGLLCYEDFVRLV  154

Query  250  EGERKEDELR---EAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            + E +E++ R   EAFG+Y ++G   IT KSLK+ L  LGES TT  C AMIRRFDLNGD
Sbjct  155  DVEGEEEKARSLTEAFGVYEMEGRGCITAKSLKRALRTLGESRTTKECMAMIRRFDLNGD  214

Query  79   GVLGFDEFKIMM  44
            GVL FDEF++MM
Sbjct  215  GVLSFDEFRVMM  226



>ref|XP_004138054.1| PREDICTED: putative calcium-binding protein CML19 [Cucumis sativus]
 gb|KGN63491.1| hypothetical protein Csa_1G002110 [Cucumis sativus]
Length=142

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y+RV +YFDEDGDG++S +EL+  +  +GGEL   EAE AV   DSDGDG+L + D  +L
Sbjct  10   YDRVLSYFDEDGDGKISPSELRNRLGLIGGELQQAEAEAAVESLDSDGDGLLCVGDIERL  69

Query  253  ME--GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            +E   E K  +L+EAF +Y  +G  +ITPK+LKKML +LGE  +T  CK MIRRFDLNGD
Sbjct  70   LEVGEEEKLKDLKEAFALYDSEGCGFITPKNLKKMLRKLGERKSTEECKMMIRRFDLNGD  129

Query  79   GVLGFDEFKIMMS  41
            G++ F+EF+IMM+
Sbjct  130  GLISFEEFQIMMA  142



>ref|XP_007210631.1| hypothetical protein PRUPE_ppa019709mg [Prunus persica]
 gb|EMJ11830.1| hypothetical protein PRUPE_ppa019709mg [Prunus persica]
Length=140

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            ++RV +YFDEDGDG++S +EL+R +  +GGEL  +EAE AV L DSDGDG+LG+ED   L
Sbjct  7    FDRVLSYFDEDGDGKISPSELRRGLGFMGGELLQKEAEVAVELLDSDGDGLLGLEDLVCL  66

Query  253  MEGER---KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG     K   LR+AF +Y ++G  +ITPKSLK+ML  LGES +   CK MI +FDLNG
Sbjct  67   MEGGEEEEKVKGLRDAFQVYDVEGCGFITPKSLKRMLSSLGESRSIDECKVMINQFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGV+ F+EF+IMM 
Sbjct  127  DGVISFEEFRIMMQ  140



>ref|XP_003608847.1| Calcium-binding protein [Medicago truncatula]
 gb|AES91044.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=140

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV +YFDEDGDG++S  EL+  +  + GE   +E E A+   DSDGDG+L +ED   L
Sbjct  7    FERVLSYFDEDGDGKISPNELRSRMAKISGEFQLKEVEIAIEALDSDGDGLLSLEDLIAL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +G  YITPKSLK+ML +LG+S +   CK MI+RFDL+G
Sbjct  67   MESGGEEEKLKDLREAFEMYDDEGCGYITPKSLKRMLKKLGDSKSIEECKVMIKRFDLDG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF+IMM
Sbjct  127  DGVLSFEEFRIMM  139



>ref|XP_010248958.1| PREDICTED: calcium-binding protein CML37-like [Nelumbo nucifera]
Length=143

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE VF YFDE+ DG++S +ELQ  V  +GGEL  EE+E      DSDGDGML +EDF  L
Sbjct  9    YEXVFHYFDENRDGKISPSELQACVMRIGGELLLEESEAVTESLDSDGDGMLELEDFVGL  68

Query  253  MEGERKEDELR---EAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME E +E+++R   +AFGMY + G+ +IT KSLK+ML RLG S     C  MI RFDLNG
Sbjct  69   MEAEGEEEKMRDMKQAFGMYEMDGSGFITAKSLKRMLSRLGMSRPMDECSIMITRFDLNG  128

Query  82   DGVLGFDEFKIMM  44
            DG+L FDEF IMM
Sbjct  129  DGMLSFDEFCIMM  141



>ref|XP_011097304.1| PREDICTED: putative calcium-binding protein CML23 [Sesamum indicum]
Length=142

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y+RVF +FD +GDG++  AEL++ V ++GGE+TAEEAE AV + DSDGDG+L +EDF ++
Sbjct  7    YQRVFNHFDFNGDGKICPAELRQCVGSIGGEMTAEEAEAAVVIMDSDGDGLLCLEDFVRI  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  +L+ AF MY ++G+  IT KSL++ML RLGE  +   C+ MI RFD+NG
Sbjct  67   VEGAGEEEKAGDLKAAFKMYEMEGSGCITAKSLRRMLSRLGERRSVEECRNMIARFDING  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MMS
Sbjct  127  DGVLNFDEFKAMMS  140



>ref|XP_006579596.1| PREDICTED: putative calcium-binding protein CML19-like [Glycine 
max]
Length=140

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  YFDEDGDG++S +EL+  +  +GGE+  +EAE A+   DSD DG+L +ED  KL
Sbjct  7    YERVLRYFDEDGDGKISPSELRNRISMMGGEVMLKEAEMAIEALDSDCDGLLCLEDLMKL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY ++   +ITPK+LK+ML +LGES +   CK MI RFDLNG
Sbjct  67   MEAAGEEEKLKDLREAFNMYDMERCGFITPKALKRMLKKLGESKSMDECKVMISRFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DG+L F+EF+IMM
Sbjct  127  DGMLSFEEFRIMM  139



>gb|KHN34410.1| Putative calcium-binding protein CML31 [Glycine soja]
Length=139

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  YFDEDGDG++S +EL+  +  +GGE+  +EAE A+   DSD DG+L +ED  KL
Sbjct  6    YERVLRYFDEDGDGKISPSELRNRISMMGGEVMLKEAEMAIEALDSDCDGLLCLEDLMKL  65

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY ++   +ITPK+LK+ML +LGES +   CK MI RFDLNG
Sbjct  66   MEAAGEEEKLKDLREAFNMYDMERCGFITPKALKRMLKKLGESKSMDECKVMISRFDLNG  125

Query  82   DGVLGFDEFKIMM  44
            DG+L F+EF+IMM
Sbjct  126  DGMLSFEEFRIMM  138



>ref|XP_010026630.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus 
grandis]
 gb|KCW83175.1| hypothetical protein EUGRSUZ_B00128 [Eucalyptus grandis]
Length=141

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FDEDGDG++S  EL+R V  +GGEL  EE E AV   DSDGDG+L +EDF  L
Sbjct  8    YERVFRCFDEDGDGKLSPLELRRQVGLIGGELLLEEVEVAVESLDSDGDGLLCLEDFVGL  67

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG  +E+   +LREAFGMY   G ++ITPKSLK+ML RLG+S T   C+AMI   DL+G
Sbjct  68   MEGGGEEEKMGDLREAFGMYVTDGCEFITPKSLKRMLSRLGQSKTVDECEAMICHVDLDG  127

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEFK+MM
Sbjct  128  DGVISFDEFKVMM  140



>ref|XP_010094482.1| Calcium-binding protein CML38 [Morus notabilis]
 gb|EXB56236.1| Calcium-binding protein CML38 [Morus notabilis]
Length=194

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 93/132 (70%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y DEDGDG++S  EL+  V A GG+L+ EEAE AV  SD DGDG LG E+F  LME 
Sbjct  62   VFNYMDEDGDGKISPVELRSCVGAAGGQLSREEAEAAVACSDKDGDGHLGFEEFCSLMET  121

Query  244  -----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
                 E K  ELREAFGMYA    + ITP SL++ML RLGES +  +CKA++R FDLNGD
Sbjct  122  SHETEEEKVKELREAFGMYAAAMEECITPGSLRRMLGRLGESRSLEDCKAIVRVFDLNGD  181

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  182  GVLTFDEFALMM  193



>ref|XP_006390167.1| hypothetical protein EUTSA_v10019204mg [Eutrema salsugineum]
 gb|ESQ27453.1| hypothetical protein EUTSA_v10019204mg [Eutrema salsugineum]
Length=178

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 112/171 (65%), Gaps = 8/171 (5%)
 Frame = -2

Query  532  NSGFVSFCTKLT--RKRAKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRAV  359
             S F   C KL+  RK +  E   ++ + E+     E VFAY D + DGR+SA ELQ++ 
Sbjct  7    QSSFKKLCRKLSPERKDSAAEKRQNNRNGEDKNRDLEAVFAYMDANRDGRISADELQKSF  66

Query  358  RAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG------ERKEDELREAFGMYAI  197
              +G +L+ EEAE AVRLSD+DGDGML  E+F +L++G      E K  EL+EAF MY  
Sbjct  67   TTLGEQLSDEEAEAAVRLSDTDGDGMLDYEEFAQLIKGDDESTEEDKTIELKEAFKMYIA  126

Query  196  KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            +G + ITP+SLK ML +LGES TT +C+ MI  FDLN DGVL FDEF +MM
Sbjct  127  EGEECITPRSLKMMLKKLGESRTTDDCRVMISAFDLNADGVLSFDEFVLMM  177



>ref|XP_010248957.1| PREDICTED: calcium-binding protein CML37 [Nelumbo nucifera]
Length=143

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE VF YFDE+ DG++S +ELQ  V  +GGEL  EE+E      DSDGDGML +EDF  L
Sbjct  9    YEGVFHYFDENRDGKISPSELQACVMRIGGELLLEESEAVTESLDSDGDGMLELEDFVGL  68

Query  253  MEGERKEDELR---EAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME E +E+++R   +AFGMY + G+ +IT KSLK+ML RLG S     C  MI RFDLNG
Sbjct  69   MEAEGEEEKMRDMKQAFGMYEMDGSGFITAKSLKRMLSRLGMSRPMDECSIMITRFDLNG  128

Query  82   DGVLGFDEFKIMM  44
            DG+L FDEF IMM
Sbjct  129  DGMLSFDEFCIMM  141



>ref|XP_008464450.1| PREDICTED: putative calcium-binding protein CML19 [Cucumis melo]
Length=142

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y+RV +YFDEDGDG++S +EL+  +  +GGEL   EAE AV   DSDGDG+L   D  +L
Sbjct  10   YDRVLSYFDEDGDGKISPSELRNRLGLIGGELLQAEAEAAVESLDSDGDGLLCAGDIERL  69

Query  253  ME--GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            +E   E K  +L+EAF +Y  +G  +ITPK+LKKML +LGE  +T  CK MIRRFDLNGD
Sbjct  70   LEVGEEEKLKDLKEAFALYDSEGCGFITPKNLKKMLRKLGERKSTEECKMMIRRFDLNGD  129

Query  79   GVLGFDEFKIMMS  41
            G++ F+EF+IMM+
Sbjct  130  GLISFEEFQIMMA  142



>emb|CAN78147.1| hypothetical protein VITISV_039879 [Vitis vinifera]
Length=129

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 93/131 (71%), Gaps = 10/131 (8%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+R V  +G EL  EEA+E V   DSDGDG         L
Sbjct  7    YERIFKRFDEDGDGKLSPSELRRCVGTIGEELLMEEAQEVVESMDSDGDG---------L  57

Query  253  MEGE-RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDG  77
             EGE RK +ELREAF MY ++G+  ITPKSLK+ML RLGES +   C  MIR FD+NGDG
Sbjct  58   REGEERKMEELREAFRMYEMEGSGCITPKSLKRMLSRLGESRSVEECSVMIREFDVNGDG  117

Query  76   VLGFDEFKIMM  44
            VL FDEFK+MM
Sbjct  118  VLSFDEFKLMM  128



>ref|XP_010026622.1| PREDICTED: probable calcium-binding protein CML31 [Eucalyptus 
grandis]
 gb|KCW83174.1| hypothetical protein EUGRSUZ_B00127 [Eucalyptus grandis]
Length=143

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FDEDGDG++S +EL+R V   GGE+  +E E AV   DSDGDG+L +EDF   
Sbjct  10   YERVFRCFDEDGDGKLSPSELRRCVGLTGGEVLLKEVEVAVESLDSDGDGLLCLEDFVGF  69

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG  +E+   +LREAFGMY   G   ITPKSLK+ML RLG+S    +C+AMIR FDL+G
Sbjct  70   MEGGGEEERMGDLREAFGMYVTDGCGCITPKSLKRMLSRLGQSKAEDDCEAMIRHFDLDG  129

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEFK+MM
Sbjct  130  DGVISFDEFKVMM  142



>ref|XP_007018618.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY15843.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=304

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 5/134 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            + VF + D +GDG++SA ELQR VR  GG L+ +EAE AV+ SD DGDGMLG  +F +L+
Sbjct  170  QMVFDFIDANGDGKISAEELQRCVRTAGGHLSMDEAELAVKSSDLDGDGMLGFHEFQELV  229

Query  250  EG-----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            EG     E ++ ELREAFGMY ++G++ ITP SL++ML RLGES +  +CKAMIR FDLN
Sbjct  230  EGGGSTEEERKKELREAFGMYVMEGSECITPASLRRMLRRLGESKSIKDCKAMIRAFDLN  289

Query  85   GDGVLGFDEFKIMM  44
            GDGVL FDEF +MM
Sbjct  290  GDGVLSFDEFSVMM  303



>ref|XP_010026601.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus 
grandis]
 gb|KCW83171.1| hypothetical protein EUGRSUZ_B00124 [Eucalyptus grandis]
Length=143

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FDEDGDG++S +EL+R V   GGEL  +E E  V   DS GDG+L +EDF   
Sbjct  10   YERVFRCFDEDGDGKLSPSELRRHVGLTGGELLLKEVEVVVESLDSGGDGLLCLEDFVGF  69

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG  +E+   +LREAFGMY   G  +ITPKSLK+ML RLG+S    +CKAMIR FDL+G
Sbjct  70   MEGGGEEEKMGDLREAFGMYVADGCGFITPKSLKRMLSRLGQSKFEDDCKAMIRHFDLDG  129

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEFK+MM
Sbjct  130  DGVISFDEFKVMM  142



>ref|XP_003549848.1| PREDICTED: putative calcium-binding protein CML19-like [Glycine 
max]
Length=140

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  YFDEDGDG++S +EL+  +  +GGE+  +EAE A+   DSDGDG+L ++D   L
Sbjct  7    YERVLRYFDEDGDGKISPSELRNRIAMMGGEVMLKEAEMAIEALDSDGDGLLCLDDLMNL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +   +ITPK+LK+ML +LGES +   CK MI RFDLNG
Sbjct  67   MEAAGEEEKLKDLREAFDMYDTERCGFITPKALKRMLKKLGESKSMVECKVMISRFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DG+L F+EF+IMM
Sbjct  127  DGMLSFEEFRIMM  139



>ref|XP_010105238.1| Calcium-binding protein CML37 [Morus notabilis]
 gb|EXC04125.1| Calcium-binding protein CML37 [Morus notabilis]
Length=144

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 6/136 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGE--LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            E VF YFDEDGDG++S +EL+  +  +GGE  +  +EAEEAV   DSDGDG+LG+ED  +
Sbjct  9    EHVFHYFDEDGDGKISPSELRNRLGLMGGEELIELKEAEEAVESLDSDGDGLLGLEDLAR  68

Query  256  LME----GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            LME     E K  +LR AF MY ++G  +ITPKSLK+ML RLGES +   CK MI  FDL
Sbjct  69   LMELGGGEEEKMKDLRMAFEMYDVEGKGFITPKSLKRMLSRLGESRSVDECKVMINHFDL  128

Query  88   NGDGVLGFDEFKIMMS  41
            NGDGVL F+EF+IMM 
Sbjct  129  NGDGVLCFEEFRIMMQ  144



>gb|EPS67292.1| hypothetical protein M569_07485, partial [Genlisea aurea]
Length=146

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y RVF  FD DGDG++  +ELQR +  +  + TAEEAE+AV + DSDGDG + +ED  ++
Sbjct  14   YRRVFGRFDSDGDGKICPSELQRCIGLISADFTAEEAEQAVAMMDSDGDGSICLEDLMRV  73

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E +  +L+EAF MY ++G+  IT KSL++ML RLGE  T H C+ MI RFDLNG
Sbjct  74   VEGGGEEERMQDLKEAFRMYEMEGSGIITAKSLRRMLSRLGERRTVHQCRNMIARFDLNG  133

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK MM
Sbjct  134  DGVLSFDEFKAMM  146



>ref|XP_008781687.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=204

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 96/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFDE+GDG++S AEL+  +R VG EL+ E+AE  V  SDSDGDG+L  +DF +L+
Sbjct  72   ERVFRYFDENGDGKISPAELRSCMRTVGEELSHEDAEAVVASSDSDGDGLLCYDDFVRLV  131

Query  250  E---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            +    E K   LREAF +Y +     ITPKSLK+ L RLG+S TT  C AMIRRFDL+GD
Sbjct  132  DVEEEEEKVRSLREAFRVYEMDNQGRITPKSLKRALERLGDSRTTKECMAMIRRFDLDGD  191

Query  79   GVLGFDEFKIMM  44
            GVL F+EF++MM
Sbjct  192  GVLSFEEFRVMM  203



>gb|AES91046.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=136

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV +YFDEDGDG++S  EL+  +  +GGE   +E E A+   DSDGDG+L + D   L
Sbjct  3    FERVLSYFDEDGDGKISPNELRSRMAKIGGEFQLKEVEIAIEALDSDGDGLLSLGDLITL  62

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +G  +ITPKSLK+ML +LG+S +   CK MI+RFDL+G
Sbjct  63   MESGGEEEKLKDLREAFEMYDNEGCGFITPKSLKRMLKKLGDSKSIEECKLMIKRFDLDG  122

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF+IMM
Sbjct  123  DGVLSFEEFRIMM  135



>ref|XP_007161752.1| hypothetical protein PHAVU_001G095600g [Phaseolus vulgaris]
 gb|ESW33746.1| hypothetical protein PHAVU_001G095600g [Phaseolus vulgaris]
Length=140

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FDE+GDG++SA ELQ+ V A+G EL+A +A   V   D+DGDGM+G +DF + 
Sbjct  7    YERVFKQFDENGDGKISAWELQQCVEAMGEELSAADAAATVTAMDADGDGMVGFDDFVRF  66

Query  253  MEGERKE---DELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG ++E   ++L+EAF MY ++ +  ITP+SLK ML RLGEST+   C+ MI RFDL+G
Sbjct  67   VEGGKEEEKENDLKEAFKMYEMEESGCITPRSLKMMLSRLGESTSIDECEVMIARFDLDG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLTFDEFKVMM  139



>gb|KHN14097.1| Putative calcium-binding protein CML31 [Glycine soja]
Length=139

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  YFDEDGDG++S +EL+  +  +GGE+  +EAE A+   DSDGDG+L ++D   L
Sbjct  6    YERVLRYFDEDGDGKISPSELRNRIAMMGGEVMLKEAEMAIEALDSDGDGLLCLDDLMNL  65

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME   +E+   +LREAF MY  +   +ITPK+LK+ML +LGES +   CK MI RFDLNG
Sbjct  66   MEAAGEEENLKDLREAFDMYDTERCGFITPKALKRMLKKLGESKSMVECKVMISRFDLNG  125

Query  82   DGVLGFDEFKIMM  44
            DG+L F+EF+IMM
Sbjct  126  DGMLSFEEFRIMM  138



>emb|CAN78146.1| hypothetical protein VITISV_039878 [Vitis vinifera]
Length=135

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = -2

Query  436  CYERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            C   +F  FDEDGDG++S +EL+R +  +G EL  EEA+E V   DSDGDG+ G+E+F  
Sbjct  2    CMNAIFKRFDEDGDGKLSPSELRRCLGTIGEELLMEEAQEVVESMDSDGDGLPGLEEFVG  61

Query  256  LME--GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
             ME  GE ++ ELREAF MY ++G+  IT KSLK+ML RLGES +   C  MI +FD+NG
Sbjct  62   WMEREGEDRKMELREAFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECSVMIGQFDVNG  121

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  122  DGVLSFDEFKLMM  134



>ref|XP_009804674.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
sylvestris]
Length=141

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            + R+F  FDE+ DG++SA ELQ+ V  +G +++ EEA+ AV L+DSD DG+LG EDF +L
Sbjct  7    HRRLFERFDENRDGKISAEELQQCVHLIGKDMSYEEAKAAVELNDSDNDGLLGFEDFVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +E    E K  EL+EAF MY ++G   ITP+SL +ML RLGES T   C+ MI R+D++G
Sbjct  67   IEDGSEEEKAHELKEAFRMYEMEGCGCITPESLNRMLARLGESRTIDECRGMICRYDIDG  126

Query  82   DGVLGFDEFKIMM  44
            DG+L FDEF+IMM
Sbjct  127  DGLLNFDEFEIMM  139



>gb|KFK42082.1| hypothetical protein AALP_AA2G208800 [Arabis alpina]
Length=178

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 114/173 (66%), Gaps = 11/173 (6%)
 Frame = -2

Query  529  SGFVSFCTKLT--RKRAKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRAVR  356
            S F  FC  L+  RK +K +  +++   ++     E VFAY D + DGR+S  ELQ + +
Sbjct  5    SSFKKFCQTLSPERKDSKRQQHNNNNGDQDKNKDLEAVFAYMDANKDGRISPQELQNSFK  64

Query  355  AVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG--------ERKEDELREAFGMYA  200
             +G +L+ EEAE AVRLSD++GDGML  ++F++L++G        E  + EL+EAF MY 
Sbjct  65   TLGEQLSDEEAESAVRLSDTNGDGMLDFQEFSQLIKGSNGDEFNEEENKIELKEAFRMYI  124

Query  199  IKGTDY-ITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
             +G +  ITP+SLK ML +LGES TT +CK MI+ FDLN DGVL FDEF +MM
Sbjct  125  GEGDEECITPRSLKIMLKKLGESRTTDDCKVMIQAFDLNADGVLSFDEFALMM  177



>ref|XP_008805121.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=183

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E+VF +FD+DGDG++SA+EL+  +  +G EL+AE AE  V  +DS+GDG+L +EDF +L
Sbjct  49   FEQVFRWFDKDGDGKISASELRLCMGTIGEELSAEGAENLVESADSNGDGLLELEDFMRL  108

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +E E +E+   +LR AF MY ++G   IT KSLK+ML RLG S     C+AMI RFDLNG
Sbjct  109  VEVEGEEERSKDLRAAFEMYEMEGEGCITAKSLKRMLSRLGASRGLDECRAMICRFDLNG  168

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF+IMM
Sbjct  169  DGVLSFDEFRIMM  181



>ref|XP_010927470.1| PREDICTED: putative calcium-binding protein CML19 [Elaeis guineensis]
Length=194

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            ERVF YFD + DG +S AELQR +R +G EL+ E+A   V  +DSDGDG+LG +DF KL+
Sbjct  62   ERVFRYFDSNDDGNISPAELQRCMRTIGEELSLEDAAALVESTDSDGDGLLGFDDFVKLL  121

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
              E +E++   LREAF +Y +   + ITP SLK+ L +LG S T  +C  MI RFD+NGD
Sbjct  122  GPEGEEEKGRHLREAFRVYEMDDQECITPTSLKRALGKLGVSKTIEDCMIMIHRFDINGD  181

Query  79   GVLGFDEFKIMM  44
            GV+ FDEF+IMM
Sbjct  182  GVISFDEFRIMM  193



>gb|AAM64535.1| putative calmodulin [Arabidopsis thaliana]
Length=177

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRA  362
             S F   C KL+ KR   A      +S + E+     E VF+Y D + DGR+S  ELQ++
Sbjct  8    QSSFKKLCRKLSPKRKDSAGEIQQHNSSNGEDKNRELEAVFSYMDANRDGRISPEELQKS  67

Query  361  VRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM---EGERKEDELREAFGMYAIKG  191
               +G +L+ EEA  AVRLSD+DGDGML  E+F++L+   + E K+ EL+ AF +Y  +G
Sbjct  68   FMTLGEQLSDEEAVAAVRLSDTDGDGMLDFEEFSQLIKVDDEEEKKMELKGAFRLYITEG  127

Query  190  TDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
             D ITP+SLK ML +LGES TT +C+ MI  FDLN DGVL FDEF +MM
Sbjct  128  EDCITPRSLKMMLKKLGESRTTDDCRVMISAFDLNADGVLSFDEFALMM  176



>ref|XP_009106330.1| PREDICTED: calcium-binding protein CML39 [Brassica rapa]
Length=169

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VFAY D + DGR+SA EL+++ + +G +L+ +EAE AV+LSD DGDGML  E+F +L++G
Sbjct  35   VFAYMDANRDGRISAEELKKSFKTLGEQLSDQEAEAAVKLSDLDGDGMLDFEEFAQLLKG  94

Query  244  ------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
                  E K+ ++ EAF MY  +G D ITP+SLK ML +LGES TT +C  MI+ FDLN 
Sbjct  95   GDEFTEEEKKSKIMEAFRMYIAEGEDCITPRSLKMMLMKLGESRTTDDCVVMIKAFDLNA  154

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF +MM
Sbjct  155  DGVLSFDEFALMM  167



>ref|NP_177791.1| calcium-binding protein CML38 [Arabidopsis thaliana]
 ref|NP_001185413.1| calcium-binding protein CML38 [Arabidopsis thaliana]
 sp|Q9SRE6.1|CML38_ARATH RecName: Full=Calcium-binding protein CML38; AltName: Full=Calmodulin-like 
protein 38 [Arabidopsis thaliana]
 gb|AAF04447.1|AC010718_16 putative calmodulin; 4214-3681 [Arabidopsis thaliana]
 gb|AAO00781.1| putative calmodulin [Arabidopsis thaliana]
 gb|AAP21364.1| At1g76650 [Arabidopsis thaliana]
 gb|AEE35869.1| calcium-binding protein CML38 [Arabidopsis thaliana]
 gb|AEE35871.1| calcium-binding protein CML38 [Arabidopsis thaliana]
Length=177

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRA  362
             S F   C KL+ KR   A      +S + E+     E VF+Y D + DGR+S  ELQ++
Sbjct  8    QSSFKKLCRKLSPKREDSAGEIQQHNSSNGEDKNRELEAVFSYMDANRDGRISPEELQKS  67

Query  361  VRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM---EGERKEDELREAFGMYAIKG  191
               +G +L+ EEA  AVRLSD+DGDGML  E+F++L+   + E K+ EL+ AF +Y  +G
Sbjct  68   FMTLGEQLSDEEAVAAVRLSDTDGDGMLDFEEFSQLIKVDDEEEKKMELKGAFRLYIAEG  127

Query  190  TDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
             D ITP+SLK ML +LGES TT +C+ MI  FDLN DGVL FDEF +MM
Sbjct  128  EDCITPRSLKMMLKKLGESRTTDDCRVMISAFDLNADGVLSFDEFALMM  176



>ref|XP_006435500.1| hypothetical protein CICLE_v10002523mg [Citrus clementina]
 ref|XP_006494431.1| PREDICTED: calcium-binding protein CML37-like [Citrus sinensis]
 gb|ESR48740.1| hypothetical protein CICLE_v10002523mg [Citrus clementina]
Length=203

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 101/138 (73%), Gaps = 10/138 (7%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGG----ELTaeeaeeAVRLSDSDGDGMLGIEDFT  260
            +VF +FDE+GDGR++AAELQ  +  VGG     ++  +AE A++ SD +GDG+L  ++F 
Sbjct  65   KVFNFFDENGDGRITAAELQSCLMTVGGGGELSISVADAEAAIQSSDLNGDGVLDFDEFL  124

Query  259  KLMEGERKEDE----LREAFGMYAIKGTDYITPKSLKKMLCRLG--ESTTTHNCKAMIRR  98
            KLMEG ++E+E    LR+AF +Y + G++ ITP SLK+ML RLG  ES +  +CKAMIR 
Sbjct  125  KLMEGNQEEEEKNCELRDAFALYVMDGSNSITPASLKRMLTRLGLGESKSIDDCKAMIRP  184

Query  97   FDLNGDGVLGFDEFKIMM  44
            FD+NGDGVL F+EF +MM
Sbjct  185  FDINGDGVLSFEEFSLMM  202



>ref|XP_007151537.1| hypothetical protein PHAVU_004G055200g [Phaseolus vulgaris]
 gb|ESW23531.1| hypothetical protein PHAVU_004G055200g [Phaseolus vulgaris]
Length=141

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y  VF +FDE+GDG++SA+EL++ V A+GG+L+ +EAE  V + DSD DG++G++DF + 
Sbjct  8    YVCVFNHFDENGDGKISASELRQCVEAIGGKLSWKEAESLVEVLDSDKDGLVGLDDFVRF  67

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +E   +E+   +LREAF MY ++G   ITPKSLK+ML RLGE  +   C+ MI RFDLNG
Sbjct  68   VEEVEEEEKVEDLREAFKMYEMEGCGCITPKSLKRMLGRLGECKSIDECQGMIARFDLNG  127

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF++MM
Sbjct  128  DGVLTFDEFRVMM  140



>ref|XP_004231789.1| PREDICTED: putative calcium-binding protein CML19 [Solanum lycopersicum]
Length=141

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            ++R+F  FDE+ DG++SA ELQ+ V  +G +++ EEA+ AV  +DSD DG+L  EDF +L
Sbjct  7    HQRLFDRFDENRDGKISAEELQQCVHLIGKDMSYEEAKAAVEHNDSDNDGLLDFEDFVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  EL+EAF MY ++G   ITP+SL +ML RLGESTT   C+ MI R+D++G
Sbjct  67   IEGGSEEEKAHELKEAFKMYEMEGCGCITPESLNRMLSRLGESTTIDECRGMICRYDIDG  126

Query  82   DGVLGFDEFKIMM  44
            DG+L F EF+IMM
Sbjct  127  DGLLNFHEFEIMM  139



>ref|XP_006338687.1| PREDICTED: putative calcium-binding protein CML19-like [Solanum 
tuberosum]
Length=141

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            ++R+F  FDE+ DG++SA ELQ+ V  +G +++ EEA+ AV  +DSD DG+L  EDF +L
Sbjct  7    HQRLFDRFDENRDGKISAEELQQCVHLIGKDMSYEEAKAAVEHNDSDNDGLLDFEDFVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  EL+EAF MY ++G   ITP+SL +ML RLGESTT   C+ MI R+D++G
Sbjct  67   IEGGSEEEKAHELKEAFRMYEMEGCGCITPESLNRMLARLGESTTIDECRGMICRYDIDG  126

Query  82   DGVLGFDEFKIMM  44
            DG+L F EF+IMM
Sbjct  127  DGLLNFHEFEIMM  139



>ref|XP_002264716.1| PREDICTED: putative calcium-binding protein CML23 [Vitis vinifera]
Length=140

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+  +  +G E   EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRCCLGTIGEEQPMEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK ++LREAF MY ++G+  IT KSLK+ML RLGES +   C  MI +FD+NG
Sbjct  67   MEREGEERKMEDLREAFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECSVMIGQFDVNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK MM
Sbjct  127  DGVLSFDEFKRMM  139



>ref|XP_010932174.1| PREDICTED: putative calcium-binding protein CML19 [Elaeis guineensis]
Length=192

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERVF  FDE+GDG++S  ELQ  +R  G EL+ E+    V+  DSDGDG+LG +DF KL
Sbjct  59   FERVFHCFDENGDGKISPVELQSCMRMTGEELSLEDTAALVKSMDSDGDGLLGFDDFIKL  118

Query  253  MEGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +  E +E++   LREAF +Y +   + ITP SLK+ L +LGES T   C  M+ RFD+NG
Sbjct  119  VGPEGEEEKGRSLREAFQVYKMDDQECITPTSLKRALGKLGESKTMEECTVMVHRFDING  178

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEF+IMM
Sbjct  179  DGVISFDEFQIMM  191



>emb|CDY72264.1| BnaCnng76780D [Brassica napus]
 emb|CDX84557.1| BnaA03g16730D [Brassica napus]
 emb|CDX68090.1| BnaA07g21300D [Brassica napus]
Length=179

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 109/171 (64%), Gaps = 8/171 (5%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKRAKgedssssfss--eedgSCYERVFAYFDEDGDGRVSAAELQRAV  359
             S F+  C KL+ KR           +   +     E VFAY D + DGR+S  ELQ++ 
Sbjct  8    QSSFMKLCRKLSPKRKDSAAERQHIKNGDHDKNRDIEAVFAYMDANKDGRISPDELQKSF  67

Query  358  RAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERK------EDELREAFGMYAI  197
              +G +L+ EEAE AVRLSD+DGDGML  E+F +L++G+ K      + EL+EAF MY  
Sbjct  68   MTLGEQLSDEEAEAAVRLSDTDGDGMLDFEEFAQLVKGDDKCSEEEKKMELKEAFKMYIA  127

Query  196  KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            +G + ITP+SLK ML +LGES TT NC+ MIR FDLN DGVL FDEF +MM
Sbjct  128  EGEECITPRSLKMMLKKLGESRTTDNCRVMIRAFDLNHDGVLSFDEFALMM  178



>ref|XP_010250768.1| PREDICTED: calcium-binding protein CML38-like [Nelumbo nucifera]
Length=141

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF +FDED DG++S  E+Q  V  +GGE+  EEAE  +   D+DGDG+L +EDF  LME 
Sbjct  10   VFHFFDEDRDGKISPIEMQHCVMRIGGEMLPEEAEAVIESLDADGDGLLALEDFVGLMEA  69

Query  244  ERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGV  74
            + +E+   ++R+ F MY + G+ +ITPKSLK+ML RLG S     C+ MI +FDLNGDGV
Sbjct  70   QGEEEKMKDMRDVFEMYEMDGSGFITPKSLKRMLSRLGMSRPIDECRLMISQFDLNGDGV  129

Query  73   LGFDEFKIMM  44
            L FDEF IMM
Sbjct  130  LSFDEFSIMM  139



>ref|XP_004145714.1| PREDICTED: putative calcium-binding protein CML19 [Cucumis sativus]
 gb|KGN58193.1| hypothetical protein Csa_3G588520 [Cucumis sativus]
Length=141

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  436  CYERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFT  260
            CY+RVF +FD DGDG++S +EL+  +  V GE L+  EA+EAV   DSDGDG L  EDF 
Sbjct  6    CYKRVFEHFDSDGDGKISPSELRECIAVVSGEKLSVLEAQEAVAEFDSDGDGQLKEEDFV  65

Query  259  KLMEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            + ++G   E +  ELREAF MY +KG+  IT +SL++ML +LGE+ +  +C AMI +FD+
Sbjct  66   RFVDGGGEEERVKELREAFKMYEMKGSGLITAESLRRMLRKLGETKSLRDCTAMIAKFDI  125

Query  88   NGDGVLGFDEFKIMMS  41
            +GDGVL FDEF++MMS
Sbjct  126  DGDGVLSFDEFRVMMS  141



>emb|CDX95188.1| BnaC09g16820D [Brassica napus]
Length=184

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ EAEE V++SD DGDG++  E+F KLMEG
Sbjct  52   VFDYIDANSDGKISGTELQSCVSLLGGALSSSEAEEVVKISDVDGDGLMDFEEFLKLMEG  111

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     LREAF MY  +G ++IT  SL++ L RLGES T   CK MIR FD NGD
Sbjct  112  EDGSDEERRKELREAFRMYVTEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNGD  171

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  172  GVLSFDEFLLMM  183



>ref|XP_009104663.1| PREDICTED: calcium-binding protein CML38-like [Brassica rapa]
Length=179

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKRAKgedssssfss--eedgSCYERVFAYFDEDGDGRVSAAELQRAV  359
             S F+  C KL+ KR      S    +   +     E VFAY D + DGR+S  ELQ++ 
Sbjct  8    QSSFMKLCRKLSPKRKDSAAESQHIKNGDHDKNRHIEAVFAYMDANKDGRISPDELQKSF  67

Query  358  RAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERK------EDELREAFGMYAI  197
              +G +L+ EEAE AVRLSD+DGDGML  E+F +L++G+ K      + EL+EAF MY  
Sbjct  68   MTLGEQLSDEEAEAAVRLSDTDGDGMLDFEEFAQLIKGDDKCSEEEKKMELKEAFKMYIA  127

Query  196  KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            +G + ITP+SLK ML +LGES TT +C+ MIR FDLN DGVL FDEF +MM
Sbjct  128  EGEECITPRSLKMMLKKLGESRTTDDCRVMIRAFDLNDDGVLSFDEFALMM  178



>ref|XP_010026594.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus 
grandis]
 gb|KCW83170.1| hypothetical protein EUGRSUZ_B00123 [Eucalyptus grandis]
Length=143

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FDEDGDG++S +EL+R V   G EL  +EAE AV   DS GDG+L +EDF   
Sbjct  10   YERVFRCFDEDGDGKLSPSELRRHVGLTGRELLLKEAEVAVESLDSGGDGLLCLEDFVGF  69

Query  253  MEGER---KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG     K  +LREAFGMY   G  +IT +SLK+ML RLG+S    +C+AMIR FDL+G
Sbjct  70   MEGGGEEEKMSDLREAFGMYVTDGCGFITAQSLKRMLSRLGQSKAEDDCEAMIRHFDLDG  129

Query  82   DGVLGFDEFKIMM  44
            DGV+ FDEFK+MM
Sbjct  130  DGVISFDEFKVMM  142



>ref|XP_009113443.1| PREDICTED: calcium-binding protein CML37 [Brassica rapa]
Length=184

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ EAEE V++SD DGDG++  E+F KLMEG
Sbjct  52   VFDYIDANSDGKISGTELQNCVSLLGGALSSREAEEVVKISDVDGDGLMDFEEFLKLMEG  111

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     LREAF MY  +G ++IT  SL++ L RLGES T   CK MIR FD NGD
Sbjct  112  EDGSDEERRKELREAFRMYVTEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNGD  171

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  172  GVLSFDEFLLMM  183



>gb|AFK45118.1| unknown [Lotus japonicus]
Length=140

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV +YFDEDGD ++S +EL+R +  +GGEL  +EAE A+   DSDGDG L +ED  KL
Sbjct  7    FERVLSYFDEDGDSKISPSELKRRLAVMGGELRLKEAEMAIEAFDSDGDGFLCLEDLVKL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +   +IT +SLK+ML +LG+  +   CK MI RFDLNG
Sbjct  67   MESAGEEEKLKDLREAFEMYDTERCGFITQESLKRMLKKLGDLKSIEECKVMIDRFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL F+EF++MM 
Sbjct  127  DGVLSFEEFRVMMQ  140



>ref|XP_006301690.1| hypothetical protein CARUB_v10022145mg [Capsella rubella]
 gb|EOA34588.1| hypothetical protein CARUB_v10022145mg [Capsella rubella]
Length=185

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 111/185 (60%), Gaps = 19/185 (10%)
 Frame = -2

Query  550  SSSPSKNSGFVSFCTKLTRKRAKgedssssfsseedgSCY-------ERVFAYFDEDGDG  392
            S++    S F  FC KL+ +R                + +       E VFAY D + DG
Sbjct  3    SNNTQPQSSFKKFCRKLSPERKASSAGEGEIQQHISSNAHDDKNRDLEAVFAYMDANRDG  62

Query  391  RVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKEDEL----  224
            R+SA EL+++ R +G +L+ EEAE AV+LSDSDGDGML  E+F +L+   +++DE     
Sbjct  63   RISAEELKKSFRTLGEQLSDEEAEAAVKLSDSDGDGMLDFEEFAQLI---KRDDEFTEEE  119

Query  223  -----REAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDE  59
                 +EAF MY  +G + ITP+SLK ML +LGES TT +CK MI  FDLN DGVL FDE
Sbjct  120  KKMELKEAFRMYISEGEECITPRSLKVMLNKLGESKTTDDCKVMISAFDLNADGVLSFDE  179

Query  58   FKIMM  44
            F +MM
Sbjct  180  FALMM  184



>emb|CDY69441.1| BnaA09g53510D [Brassica napus]
Length=184

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ EAEE V++SD DGDG++  E+F KLMEG
Sbjct  52   VFDYIDANSDGKISGTELQSCVSLLGGALSSREAEEVVKISDVDGDGLMDFEEFLKLMEG  111

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     LREAF MY  +G ++IT  SL++ L RLGES T   CK MIR FD NGD
Sbjct  112  EDGSDEERRKELREAFRMYVTEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNGD  171

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  172  GVLSFDEFLLMM  183



>gb|KJB08025.1| hypothetical protein B456_001G059500 [Gossypium raimondii]
Length=141

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  YFD+DGDG++SA+EL   +  +G  L   EA+ AV   DS+GDG+L +ED   L
Sbjct  8    YERVLRYFDKDGDGKISASELIHRLNQMGENLLFNEAKVAVEALDSNGDGLLDLEDLIAL  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +L+EAFGMY + G  +IT + LK+ML +LGE  +   CK MI++FDLNG
Sbjct  68   MEEGNEEEKLKDLKEAFGMYDVDGNGFITAQGLKRMLSKLGELKSIDECKVMIKKFDLNG  127

Query  82   DGVLGFDEFKIMMS  41
            DGVL F+EF++MM 
Sbjct  128  DGVLSFEEFRVMMQ  141



>gb|KFK42084.1| hypothetical protein AALP_AA2G209000 [Arabis alpina]
Length=177

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 116/174 (67%), Gaps = 12/174 (7%)
 Frame = -2

Query  529  SGFVSFCTKLT--RKRAKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRAVR  356
            S F  FC KL+  RK +K + ++ +    ++    E VFAY D + D R+S  ELQ + +
Sbjct  5    SSFKKFCQKLSPDRKDSKRQHNNINGDHGKNND-LEAVFAYMDANKDCRISPQELQNSFK  63

Query  355  AVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG--------ERKEDELREAFGMYA  200
             +G +L+ EEAE AVRLSD++GDGML  ++F++L++G        E K+ EL+EAF MY 
Sbjct  64   TLGEQLSDEEAEAAVRLSDTNGDGMLDFQEFSQLIKGNNNDENTEEDKKIELKEAFRMYI  123

Query  199  IKGTDY-ITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMMS  41
             +G +  ITP+SLK ML +LGES TT +CK MI+ FDLN DGVL FDEF +MMS
Sbjct  124  GEGDEECITPRSLKMMLKKLGESRTTDDCKVMIQAFDLNADGVLSFDEFALMMS  177



>emb|CDX85965.1| BnaC06g21690D [Brassica napus]
Length=179

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 110/171 (64%), Gaps = 8/171 (5%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKR--AKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRAV  359
             S F+  C KL+ KR  +  +         +     E VFAY D + DGR+S  ELQ++ 
Sbjct  8    QSSFMKLCRKLSPKRKDSAADRQHIKNVDHDKNRGIEAVFAYMDANKDGRISPDELQKSF  67

Query  358  RAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERK------EDELREAFGMYAI  197
              +G +L+ EEAE AVRLSD+DGDGML  E+F +L++G+ K      + EL+EAF MY  
Sbjct  68   MTLGEQLSDEEAEAAVRLSDTDGDGMLDFEEFAQLIKGDDKCSEEEKKMELKEAFKMYIA  127

Query  196  KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            +G + ITP+SLK ML +LGES TT +C+ MIR FDLN DGVL FDEF +MM
Sbjct  128  EGEECITPRSLKMMLKKLGESRTTDDCRVMIRAFDLNDDGVLSFDEFALMM  178



>ref|XP_003608849.1| Calmodulin [Medicago truncatula]
Length=266

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV +YFDEDGDG++S  EL+  +  +GGE   +E E A+   DSDGDG+L + D   L
Sbjct  133  FERVLSYFDEDGDGKISPNELRSRMAKIGGEFQLKEVEIAIEALDSDGDGLLSLGDLITL  192

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +G  +ITPKSLK+ML +LG+S +   CK MI+RFDL+G
Sbjct  193  MESGGEEEKLKDLREAFEMYDNEGCGFITPKSLKRMLKKLGDSKSIEECKLMIKRFDLDG  252

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF+IMM
Sbjct  253  DGVLSFEEFRIMM  265


 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV +YFDED DG++S  EL+  +  +GGE   +E E A+   DSDGDG+L +ED  KL
Sbjct  7    YERVLSYFDEDRDGKISPNELRSRMAKIGGEFQLKEVEIAIEALDSDGDGLLSLEDLIKL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY  +G  +ITPKSLK+ML +LG+S +   CK MI+RFDL+G
Sbjct  67   MESGGEEEKLKDLREAFEMYDNEGCGFITPKSLKRMLKKLGDSKSIEECKLMIKRFDLDG  126

Query  82   DGV  74
            DGV
Sbjct  127  DGV  129



>emb|CDX87577.1| BnaA07g32960D [Brassica napus]
Length=169

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VFAY D + DGR+SA EL+++ + +G +L+ EEAE AV+LSD DGDGML  E+F +L++G
Sbjct  35   VFAYMDANRDGRISAEELKKSFKTLGEQLSDEEAEAAVKLSDLDGDGMLDFEEFAQLLKG  94

Query  244  ------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
                  E ++ ++ EAF MY  +G D ITP+SLK ML +LGES TT +C  MI+ FDLN 
Sbjct  95   GDEFTEEEQKSKIMEAFRMYIAEGEDCITPRSLKMMLMKLGESRTTDDCVVMIKAFDLNA  154

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF +MM
Sbjct  155  DGVLSFDEFVLMM  167



>emb|CDX88304.1| BnaC06g37480D [Brassica napus]
Length=169

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VFAY D + DGR+SA EL+++ + +G +L+ EEAE AV+LSD DGDGML  E+F +L++G
Sbjct  35   VFAYMDANRDGRISAEELKKSFKTLGEQLSDEEAETAVKLSDIDGDGMLDFEEFAQLLKG  94

Query  244  ------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
                  E K+ ++ EAF MY  +G D ITP+SLK ML +LGES TT +C  MI+ FDLN 
Sbjct  95   GDEFTEEEKKSKIMEAFRMYIAEGEDCITPRSLKMMLMKLGESRTTDDCVVMIKAFDLNA  154

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEF +M+
Sbjct  155  DGVLSFDEFALMV  167



>ref|NP_177790.1| calcium-binding protein CML39 [Arabidopsis thaliana]
 sp|Q9SRE7.1|CML39_ARATH RecName: Full=Calcium-binding protein CML39; AltName: Full=Calmodulin-like 
protein 39 [Arabidopsis thaliana]
 gb|AAF04446.1|AC010718_15 putative calmodulin; 2575-2096 [Arabidopsis thaliana]
 gb|AEE35868.1| calcium-binding protein CML39 [Arabidopsis thaliana]
Length=159

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++ + +G +++ EEAE AV+LSD DGDGML I +F  L+
Sbjct  24   EAVFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAEAAVKLSDIDGDGMLDINEFALLI  83

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E K+ ++ EAF MY   G D ITP SLK ML +LGES TT +CK MI+ FDL
Sbjct  84   KGNDEFTEEEKKRKIMEAFRMYIADGEDCITPGSLKMMLMKLGESRTTDDCKVMIQAFDL  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|XP_010416589.1| PREDICTED: calcium-binding protein CML38 [Camelina sativa]
Length=182

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 114/181 (63%), Gaps = 14/181 (8%)
 Frame = -2

Query  550  SSSPSKNSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVSA  380
            +++  + S F  FC KL+ +R   A      SS + E      E VFAY D + DGR+SA
Sbjct  3    NNNTQRQSSFKKFCRKLSPERKDSAGEIQQHSSSNVENKNRDLEAVFAYLDANRDGRISA  62

Query  379  AELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKEDEL--------  224
             ELQ++   +G +L+ EEAE AV+LSD+DGDGML  E+F +L++  R +DE         
Sbjct  63   EELQKSFTTLGEQLSDEEAEAAVKLSDTDGDGMLDFEEFAQLIK--RDDDEFTEEEKKME  120

Query  223  -REAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIM  47
             +EAF +Y  +G + ITP+SLK ML +LGES TT +CK MI  FDLN DGVL FDEF +M
Sbjct  121  LKEAFRLYISEGEECITPRSLKMMLKKLGESRTTDDCKVMINAFDLNADGVLSFDEFALM  180

Query  46   M  44
            M
Sbjct  181  M  181



>gb|KJB11648.1| hypothetical protein B456_001G269500 [Gossypium raimondii]
Length=139

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLS-DSDGDGMLGIEDFTK  257
            YERVF   D++GDG++SAAEL + V+A+G E+   E E AV    D DGDG+LG+ED   
Sbjct  4    YERVFNDIDKNGDGKISAAELHQCVKAIGWEVPLVEVEMAVVEGLDRDGDGVLGLEDLIS  63

Query  256  LMEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTT-HNCKAMIRRFDL  89
            L+E    +D   +L+EAF MY ++G   ITP SLKKML RLGES+ +  +CK MI  FDL
Sbjct  64   LVEDVEDDDKMNDLKEAFKMYEMEGCGIITPLSLKKMLARLGESSWSLQDCKLMIAHFDL  123

Query  88   NGDGVLGFDEFKIMM  44
            NGDGVL FDEF++MM
Sbjct  124  NGDGVLDFDEFRLMM  138



>ref|XP_008450085.1| PREDICTED: putative calcium-binding protein CML19 [Cucumis melo]
Length=141

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  436  CYERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFT  260
            CY+RVF +FD DGDG++S +EL+  +  V GE L+  EA+EAV   DSDGDG L  EDF 
Sbjct  6    CYKRVFEHFDSDGDGKISPSELRECIAVVSGEKLSVVEAQEAVAEFDSDGDGQLEEEDFM  65

Query  259  KLMEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            + ++G   E K  ELREAF MY ++G+  IT +SL++ML ++GE+ +  +C AMI +FD+
Sbjct  66   RFVDGGGKEEKVKELREAFKMYEMEGSGLITAESLRRMLRKMGETRSLRDCMAMIAKFDV  125

Query  88   NGDGVLGFDEFKIMMS  41
            +GDGVL FDEFK+MMS
Sbjct  126  DGDGVLNFDEFKVMMS  141



>gb|KHN05761.1| Putative calcium-binding protein CML19 [Glycine soja]
Length=141

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YFDEDGDG++S +EL+  +  +GGEL  ++AE+ +   DSDGDG L +EDF K+
Sbjct  7    FERVLKYFDEDGDGKISPSELRNRLCMMGGELLFKDAEKLIEELDSDGDGFLSLEDFVKI  66

Query  253  MEGERKEDELR---EAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME   ++++L+   EAF MY   +   +ITPKSL++ML RLGES +   C+AMI  FDLN
Sbjct  67   MEAAGEDEKLKDLAEAFEMYHDTEMLGFITPKSLQRMLNRLGESKSMEQCRAMIGHFDLN  126

Query  85   GDGVLGFDEFKIMMS  41
            GDGVL FDEF +MM 
Sbjct  127  GDGVLSFDEFGVMMQ  141



>ref|XP_002889092.1| hypothetical protein ARALYDRAFT_895547 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65351.1| hypothetical protein ARALYDRAFT_895547 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++ + +G +++ EEAE AV+LSD DGDGML   +F +L+
Sbjct  24   EAVFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAEAAVKLSDIDGDGMLDFHEFAQLI  83

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E K+ ++ EAF MY   G D ITP SLK ML +LGES TT +CK MI+ FDL
Sbjct  84   KGNDEFTEEEKKRKIMEAFRMYIADGEDCITPGSLKMMLLKLGESRTTDDCKVMIQAFDL  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|XP_006403395.1| hypothetical protein EUTSA_v10003430mg [Eutrema salsugineum]
 gb|ESQ44848.1| hypothetical protein EUTSA_v10003430mg [Eutrema salsugineum]
Length=184

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L+  EAEE V++SD DGDG++   +F KLMEG
Sbjct  52   VFDYIDANSDGKISCTELQSCVSLLGGALSLSEAEEVVKISDVDGDGLMDFAEFMKLMEG  111

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     L+EAFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD NGD
Sbjct  112  EDGSDEERRRELKEAFGMYVMEGEEFITAASLQRTLSRLGESCTVDACKVMIRGFDQNGD  171

Query  79   GVLGFDEFKIMM  44
            GVL +DEF +MM
Sbjct  172  GVLSYDEFVLMM  183



>ref|XP_006301226.1| hypothetical protein CARUB_v10021626mg [Capsella rubella]
 gb|EOA34124.1| hypothetical protein CARUB_v10021626mg [Capsella rubella]
Length=159

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++ R +G  ++ EEAE AV+LSD DGDGML + +F +L+
Sbjct  24   EAVFAYMDANRDGRISAEELKKSFRTLGEPMSDEEAEAAVKLSDIDGDGMLDLHEFAQLI  83

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
             G      E K+ ++ EAF MY  +G D ITP SLK ML +LGES TT +C+ MI+ FDL
Sbjct  84   RGNDEFTEEEKKRKIMEAFRMYIAEGEDCITPGSLKMMLMKLGESRTTDDCRVMIQAFDL  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|XP_003602094.1| Calmodulin-like protein [Medicago truncatula]
 gb|AES72345.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=140

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E V  YFDEDGDG+VS AEL++ +R +G E+  +EAE A+   DSDGDG L +E+   L
Sbjct  7    FEHVLRYFDEDGDGKVSPAELRQRLRIMGEEILLKEAEMAIEAMDSDGDGYLSLEELIAL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E+K  +LREAF MY  +   +ITPKSLK+ML ++GES +   CKAMI+ FDL+G
Sbjct  67   MEEGGEEQKLKDLREAFEMYDSEKCGFITPKSLKRMLKKMGESKSIDECKAMIKHFDLDG  126

Query  82   DGVLGFDEFKIMMS  41
            DG+L FDEF  MM 
Sbjct  127  DGLLSFDEFITMMQ  140



>ref|XP_003602095.1| Calmodulin-like protein [Medicago truncatula]
 gb|AES72346.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK49585.1| unknown [Medicago truncatula]
Length=139

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E V  YFDEDGDG+VS AEL++ +R +G E+  +EAE A+   DSDGDG L +E+   L
Sbjct  6    FEHVLRYFDEDGDGKVSPAELRQRLRIMGEEILLKEAEMAIEAMDSDGDGYLSLEELIAL  65

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E+K  +LREAF MY  +   +ITPKSLK+ML ++GES +   CKAMI+ FDL+G
Sbjct  66   MEEGGEEQKLKDLREAFEMYDSEKCGFITPKSLKRMLKKMGESKSIDECKAMIKHFDLDG  125

Query  82   DGVLGFDEFKIMMS  41
            DG+L FDEF  MM 
Sbjct  126  DGLLSFDEFITMMQ  139



>ref|XP_010248956.1| PREDICTED: calcium-binding protein CML37-like [Nelumbo nucifera]
Length=144

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAV-RAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            YE VF YFDE+ DG++S +ELQ  V R  GGEL  EE+E  +   DSDGDGML ++DF  
Sbjct  9    YEGVFHYFDENRDGKISPSELQACVMRIGGGELLLEESEAVIECLDSDGDGMLELDDFVG  68

Query  256  LMEGERKEDELR---EAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            LME E +E+++R   +AFGMY + G+ +IT +SLK+ML RLG S     C  MI RFDLN
Sbjct  69   LMEAEGEEEKMRDTRQAFGMYEMDGSGFITARSLKRMLSRLGMSRPMDECSIMISRFDLN  128

Query  85   GDGVLGFDEFKIMM  44
             DG+L FDEF IMM
Sbjct  129  DDGMLSFDEFCIMM  142



>ref|XP_008239450.1| PREDICTED: putative calcium-binding protein CML19 [Prunus mume]
Length=140

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV +YFDEDGDG++S +EL+R +  +GGEL  +EAE AV L DSDGDG+LG+ED   L
Sbjct  7    FERVLSYFDEDGDGKISPSELRRGLGLMGGELLQKEAEVAVELLDSDGDGLLGLEDLVCL  66

Query  253  MEGER---KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG     K   LR+AF +Y  +G  +ITPKSLK+ML  LGES +   CK MI RFDLNG
Sbjct  67   MEGGEEEEKVKGLRDAFQVYDAEGCGFITPKSLKRMLSSLGESKSIDECKVMINRFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGV+ F+EF+IMM
Sbjct  127  DGVISFEEFRIMM  139



>ref|XP_006849867.1| PREDICTED: putative calcium-binding protein CML19 [Amborella 
trichopoda]
 gb|ERN11448.1| hypothetical protein AMTR_s00022p00067280 [Amborella trichopoda]
Length=220

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE VF YFD DGDG++S  EL   ++ +G   +  + +E V  +DSDGDG+L   DF +L
Sbjct  87   YEAVFRYFDTDGDGKISPQELGHCLQKMGENFSDFQLKELVTGTDSDGDGLLDFGDFFRL  146

Query  253  MEGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++ E++ED+   LREAF MY ++G   ITPKSLK+ML +LGE  +   C  MI+ +D+NG
Sbjct  147  IDTEKEEDKGRGLREAFVMYEMEGLGIITPKSLKRMLSKLGEHRSIEECTTMIQHYDING  206

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  207  DGVLSFDEFKLMM  219



>emb|CDY45939.1| BnaA02g17650D [Brassica napus]
Length=169

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +L+ EEAE AV+LSD DGDGML  E+F++L+
Sbjct  33   EAVFAYMDANRDGRISAEELKKSFNTLGDQLSDEEAEAAVKLSDIDGDGMLDFEEFSQLI  92

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E ++ ++ EAF MY  +G D ITP+SLK ML +LGES T+ +C  MI+ FDL
Sbjct  93   KGNDEFTEEEQKRKMMEAFRMYIDEGEDCITPRSLKTMLMKLGESRTSDDCVVMIKAFDL  152

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  153  NDDGVLSFDEFALMM  167



>ref|XP_009128188.1| PREDICTED: calcium-binding protein CML39-like [Brassica rapa]
Length=169

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +L+ EEAE AV+LSD DGDGML  E+F++L+
Sbjct  33   EAVFAYMDANRDGRISAEELKKSFNTLGDQLSDEEAEAAVKLSDIDGDGMLDFEEFSQLI  92

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E ++ ++ EAF MY  +G D ITP+SLK ML +LGES T+ +C  MI+ FDL
Sbjct  93   KGNDEFTEEEQKRKMMEAFRMYIDEGEDCITPRSLKTMLMKLGESRTSDDCVVMIKAFDL  152

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  153  NDDGVLSFDEFALMM  167



>ref|NP_199053.1| calcium-binding protein CML37 [Arabidopsis thaliana]
 sp|Q9FIH9.1|CML37_ARATH RecName: Full=Calcium-binding protein CML37; AltName: Full=Calmodulin-like 
protein 37 [Arabidopsis thaliana]
 dbj|BAB10479.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM10393.1| AT5g42380/MDH9_7 [Arabidopsis thaliana]
 gb|AAN28759.1| At5g42380/MDH9_7 [Arabidopsis thaliana]
 gb|AED94803.1| calcium-binding protein CML37 [Arabidopsis thaliana]
Length=185

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ E EE V+ SD DGDG +  E+F KLMEG
Sbjct  53   VFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKLMEG  112

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     L+EAFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD N D
Sbjct  113  EDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDD  172

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  173  GVLSFDEFVLMM  184



>ref|XP_004515822.1| PREDICTED: putative calcium-binding protein CML19-like [Cicer 
arietinum]
Length=140

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV +YFDEDGDG++S  EL+  +  +GGE   +EAE A+   DSDGDG+L +ED   L
Sbjct  7    FERVLSYFDEDGDGKISPYELRSRMTKIGGEFLLKEAEIAIESLDSDGDGLLSLEDLITL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +L+EAF MY  +   +ITPKSLK+ML +LG+  +   CK MI RFDL+G
Sbjct  67   MESGGEEEKLKDLKEAFEMYDTERCGFITPKSLKRMLKKLGDFKSIEECKVMIGRFDLDG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF++MM
Sbjct  127  DGVLSFEEFRVMM  139



>ref|XP_012070629.1| PREDICTED: putative calcium-binding protein CML19 [Jatropha curcas]
 gb|KDP46303.1| hypothetical protein JCGZ_10143 [Jatropha curcas]
Length=141

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE VF++FDE+GDG++SA+ELQ  V A+G +L+  EA  A+  SD DGDG+L +E+F + 
Sbjct  8    YELVFSHFDENGDGKISASELQNCVGAIGRQLSLAEAVAAIEHSDLDGDGLLDLEEFVRF  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++G   E K ++L+EAF MY ++ +  ITPKSLK+ML RLG+S++   CK MI +FDLNG
Sbjct  68   IDGGEEEEKVNDLKEAFKMYEMEESGCITPKSLKRMLSRLGQSSSIEECKTMIAKFDLNG  127

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  128  DGVLNFDEFKVMM  140



>emb|CBI27596.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FDEDGDG++S +EL+  +  +G E   EEA+E V   DSDGDG+LG+E+F   
Sbjct  7    YERIFKRFDEDGDGKLSPSELRCCLGTIGEEQPMEEAQEVVESMDSDGDGLLGLEEFVGW  66

Query  253  ME---GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    ERK ++LREAF MY ++G+  IT KSLK+ML RLGES +   C  MI +FD+NG
Sbjct  67   MEREGEERKMEDLREAFRMYEMEGSGCITAKSLKRMLSRLGESRSVEECSVMIGQFDVNG  126

Query  82   DGVLGFDEFK  53
            DGVL FDEFK
Sbjct  127  DGVLSFDEFK  136



>ref|XP_006282133.1| hypothetical protein CARUB_v10028385mg [Capsella rubella]
 gb|EOA15031.1| hypothetical protein CARUB_v10028385mg [Capsella rubella]
Length=179

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 89/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ     +GG L++ EAEE V++SD DGDG +   +F KLMEG
Sbjct  47   VFDYMDTNSDGKISGEELQSCFSLLGGALSSREAEEVVKISDVDGDGFIDFGEFLKLMEG  106

Query  244  -----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
                 E K  ELREAFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD NGD
Sbjct  107  DDGSDEEKRKELREAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKGMIRGFDQNGD  166

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  167  GVLSFDEFVLMM  178



>ref|XP_009603057.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
tomentosiformis]
Length=141

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            R+F  FDE+ D ++SA ELQ+ V  +G +++ EEA+ AV L+DSD DG+L  EDF +L+E
Sbjct  9    RLFERFDENRDRKISAEELQQCVHLIGKDMSYEEAKAAVELNDSDNDGLLDFEDFVRLIE  68

Query  247  G---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDG  77
                E K  EL+EAF MY ++G   ITP+SL +ML RLGES T   C+ MI R+D++GDG
Sbjct  69   DGSEEEKAHELKEAFRMYEMEGCGCITPESLNRMLARLGESRTIDECRGMICRYDIDGDG  128

Query  76   VLGFDEFKIMM  44
            +L FDEF+IMM
Sbjct  129  LLNFDEFEIMM  139



>gb|AAM67214.1| putative calmodulin [Arabidopsis thaliana]
Length=185

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ E EE V+ SD DGDG +  E+F KLMEG
Sbjct  53   VFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEFLKLMEG  112

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     L+EAFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD N D
Sbjct  113  EDGSDEERRKELKEAFGMYLMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDD  172

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  173  GVLSFDEFVLMM  184



>gb|KHN21325.1| Putative calcium-binding protein CML19 [Glycine soja]
Length=139

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YFDEDGDG++S  EL+  +  +GGEL A++AE+ +   DSDGDG L +EDF KL
Sbjct  5    FERVLKYFDEDGDGKISPCELRNRLGMIGGELLAKDAEKLIEELDSDGDGFLSLEDFVKL  64

Query  253  MEG---ERKEDELREAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME    + K  +L EAF MY   +   +ITPKSL++ML RLGES +   C  MI  FDLN
Sbjct  65   MEAAGEDEKLKDLEEAFEMYNDTEMFGFITPKSLQRMLGRLGESKSMEQCTTMIGHFDLN  124

Query  85   GDGVLGFDEFKIMMS  41
            GDG+L FDEF++MM 
Sbjct  125  GDGLLCFDEFRVMMQ  139



>gb|KHN21326.1| Putative calcium-binding protein CML19 [Glycine soja]
Length=141

 Score =   130 bits (327),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YFDEDGDG++S  EL+  +  +GGEL +++AE+ +   DSDGDG L +EDF KL
Sbjct  7    FERVLKYFDEDGDGKISPCELRNRLGMIGGELLSKDAEKLIEELDSDGDGFLSLEDFVKL  66

Query  253  MEG---ERKEDELREAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME    + K  +L EAF MY   +   +ITPKSL++ML RLGES +   C  MI  FDLN
Sbjct  67   MEAAGEDEKLKDLEEAFEMYNDTEMFGFITPKSLQRMLGRLGESKSMEQCTTMIGHFDLN  126

Query  85   GDGVLGFDEFKIMMS  41
            GDG+L FDEF++MM 
Sbjct  127  GDGLLCFDEFRVMMQ  141



>ref|XP_010428729.1| PREDICTED: calcium-binding protein CML38-like [Camelina sativa]
Length=183

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 120/184 (65%), Gaps = 17/184 (9%)
 Frame = -2

Query  556  HSSSSPSKNSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRV  386
            +++++P + S F  FC KL+ +R   ++     SS + ++     E VFAY D + DGR+
Sbjct  3    NNNNTP-RQSSFKKFCRKLSPERKDSSREIQQHSSSNVDDKNRDLEAVFAYLDANRDGRI  61

Query  385  SAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKEDEL------  224
            SA ELQ++   +G +L+ EEAE AV+LSD+DGDGML  E+F +L+   +++D++      
Sbjct  62   SAEELQKSFTTLGEQLSDEEAEAAVKLSDTDGDGMLDFEEFAQLI---KRDDDVFTEEEK  118

Query  223  ----REAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEF  56
                +EAF +Y  +G + ITP+SLK ML +LGES TT +CK MI  FDLN DGVL FDEF
Sbjct  119  KMELKEAFRLYISEGEECITPRSLKLMLKKLGESRTTDDCKVMISAFDLNADGVLSFDEF  178

Query  55   KIMM  44
             +MM
Sbjct  179  ALMM  182



>ref|XP_004500649.1| PREDICTED: calcium-binding protein CML38-like [Cicer arietinum]
Length=143

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 94/137 (69%), Gaps = 8/137 (6%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E V  YFDEDGDG+VS  EL++ +R +G E+  +EAE A+   DSDGDG L +ED   L
Sbjct  9    FEHVLRYFDEDGDGKVSPKELRQKLREMGEEVLLKEAEMAIEAMDSDGDGYLSLEDLVTL  68

Query  253  MEG---ERKEDELREAFGMYAIKGTD---YITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            ME    E+K  +LREAF MY    +D   +ITPKSLK+ML ++GES +   CKAMI+ FD
Sbjct  69   MEEGGEEQKLKDLREAFEMY--NDSDKCGFITPKSLKRMLKKIGESKSIDECKAMIKHFD  126

Query  91   LNGDGVLGFDEFKIMMS  41
            LNGDGVL FDEF  MM 
Sbjct  127  LNGDGVLSFDEFTQMMQ  143



>ref|XP_002881678.1| hypothetical protein ARALYDRAFT_903237 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57937.1| hypothetical protein ARALYDRAFT_903237 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +++ EEAE AV+LSD DGDGML   +F +L+
Sbjct  24   EAVFAYMDANRDGRISAEELKKSFNTLGEQISDEEAEAAVKLSDIDGDGMLDFHEFAQLI  83

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E K+ ++ EAF MY   G D ITP+SLK ML +LGES TT +CK MI+ FD 
Sbjct  84   KGNDEFTEEEKKRKIMEAFRMYIADGEDCITPESLKMMLMKLGESRTTDDCKVMIQAFDN  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|XP_006440091.1| hypothetical protein CICLE_v10022753mg [Citrus clementina]
 ref|XP_006477012.1| PREDICTED: calcium-binding protein CML37-like [Citrus sinensis]
 gb|ESR53331.1| hypothetical protein CICLE_v10022753mg [Citrus clementina]
 gb|KDO52628.1| hypothetical protein CISIN_1g032375mg [Citrus sinensis]
Length=142

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAV--GGELTaeeaeeAVRLSDSDGDGMLGIEDFT  260
            YERVF YFDE+GDG+VS +E++  +  +  GG++   E E A+   D DGDG L +ED  
Sbjct  7    YERVFVYFDENGDGKVSPSEIKNRMGMIVGGGDVLLNEVEVAIESLDKDGDGFLDLEDLV  66

Query  259  KLMEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
             L+EG   E K  +LREAFG+Y      +I+P  LK+ML +LGES +   C+ MI RFDL
Sbjct  67   GLIEGASAEEKLKDLREAFGLYDFDNRGFISPNDLKRMLAKLGESKSIDECRMMIDRFDL  126

Query  88   NGDGVLGFDEFKIMMS  41
            NGDGVL F+EF+IMM 
Sbjct  127  NGDGVLSFEEFRIMMQ  142



>ref|XP_010442165.1| PREDICTED: calcium-binding protein CML37 [Camelina sativa]
Length=184

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ EAEE V++SD DGDG +   +F KLMEG
Sbjct  52   VFDYMDSNSDGKISGEELQSCVSLLGGSLSSREAEEVVKISDVDGDGFIDFGEFLKLMEG  111

Query  244  -----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
                 E +  ELREAFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD N D
Sbjct  112  DDGSDEERRKELREAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKGMIRGFDQNDD  171

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  172  GVLSFDEFVLMM  183



>ref|XP_006599038.1| PREDICTED: putative calcium-binding protein CML23-like [Glycine 
max]
 gb|KHN10821.1| Putative calcium-binding protein CML19 [Glycine soja]
Length=140

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y+RVF  FDE+GD ++S +EL++ V A+GGEL+ ++AE AV L D DGDG++G EDF + 
Sbjct  7    YKRVFNQFDENGDSKISPSELRQCVEAIGGELSEKDAEVAVTLLDRDGDGLVGFEDFVRF  66

Query  253  MEGERKEDELRE---AFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +E  ++E++  +   AF  Y + G+  ITP+SLK+ML RLGES +   CK MI RFDL+G
Sbjct  67   LEEGKEEEKEDDLKEAFKRYEMDGSGCITPRSLKRMLSRLGESRSLDECKVMIARFDLDG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLTFDEFKVMM  139



>ref|XP_010523259.1| PREDICTED: calcium-binding protein CML37 [Tarenaya hassleriana]
Length=204

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 8/135 (6%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DGR+SAAELQ  V  +GG  +A +AEEAV++ D DGDG +   +F +LMEG
Sbjct  69   VFDYMDANSDGRISAAELQTCVGLLGGAFSARDAEEAVKMVDLDGDGFMDFAEFLRLMEG  128

Query  244  E--------RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            E         +  EL+EAFGMY  +G ++IT  SL++ L RLGES T  +CKAMIR FD 
Sbjct  129  EGENSYGEDERRRELKEAFGMYTPEGDEFITAASLRRTLSRLGESRTVDDCKAMIRAFDK  188

Query  88   NGDGVLGFDEFKIMM  44
            NGDGVL FDEF +MM
Sbjct  189  NGDGVLSFDEFFLMM  203



>ref|XP_008796461.1| PREDICTED: probable calcium-binding protein CML31 [Phoenix dactylifera]
Length=194

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            +R+F YFD +GDG++S AELQ  +R +G EL+ E+A   V  +DSDGDG+L  ++F +L+
Sbjct  62   QRLFRYFDGNGDGKISPAELQSCMRTIGEELSPEDAAALVESTDSDGDGLLAFDEFVELV  121

Query  250  EGERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
              E +E++   LREAF +Y +   + ITP SLK+ L  LG S T  +C  MIR+FD+NGD
Sbjct  122  TPEGEEEKGRNLREAFRVYEMDDQECITPTSLKRALGNLGVSKTIEDCTIMIRQFDINGD  181

Query  79   GVLGFDEFKIMM  44
            GV+ FDEF+IMM
Sbjct  182  GVISFDEFRIMM  193



>ref|XP_010481992.1| PREDICTED: calcium-binding protein CML37-like [Camelina sativa]
Length=186

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ EAEE V++SD DGDG +   +F KLMEG
Sbjct  52   VFDYMDSNSDGKISGEELQSCVSLLGGSLSSREAEEVVKISDVDGDGFIDFGEFLKLMEG  111

Query  244  -----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
                 E +  ELREAFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD N D
Sbjct  112  DDGSDEERRKELREAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKGMIRGFDQNDD  171

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  172  GVLSFDEFVLMM  183



>ref|XP_009397097.1| PREDICTED: putative calcium-binding protein CML19 [Musa acuminata 
subsp. malaccensis]
Length=147

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
             + VF  FD+DGDG++SAAEL   +R +G EL+ E+AE  V L+D DGDG+L +EDF KL
Sbjct  11   LDSVFHSFDKDGDGKISAAELTACMRNIGEELSLEDAEAFVELADRDGDGLLDLEDFVKL  70

Query  253  MEGERKED---ELREAFGMYAIKGTD-YITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            +E E +E+   +LR AF MY  +G D  ITP SLK+ML RLG S     C+ MI RFDLN
Sbjct  71   VEVEGEEERDRDLRAAFKMYEDEGDDGCITPGSLKRMLSRLGTSRGIDECRTMICRFDLN  130

Query  85   GDGVLGFDEFKIMM  44
            GDGVL FDEF+ MM
Sbjct  131  GDGVLSFDEFRNMM  144



>ref|NP_001235017.1| uncharacterized protein LOC100526852 [Glycine max]
 gb|ACU15858.1| unknown [Glycine max]
Length=141

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YFDEDGDG++S +EL+  +  +GGEL  ++AE+ +   DSDGDG L +EDF K+
Sbjct  7    FERVLKYFDEDGDGKISPSELRNRLCMMGGELLFKDAEKLIEELDSDGDGFLSLEDFVKI  66

Query  253  MEGERKEDELR---EAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME   ++++L+   EAF MY   +   +ITPKSL++ML RLGES +   C+AMI  FDLN
Sbjct  67   MEAAGEDEKLKDLAEAFEMYHDTEMLGFITPKSLQRMLNRLGESKSMEQCRAMIGHFDLN  126

Query  85   GDGVLGFDEFKIMMS  41
            G GVL FDEF +MM 
Sbjct  127  GGGVLSFDEFGVMMQ  141



>ref|XP_009371666.1| PREDICTED: calcium-binding protein CML38 [Pyrus x bretschneideri]
Length=140

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FD +GDG++S  ELQ+ V A+GGEL+  EAE AV   DSDGDG+LG++DF K 
Sbjct  7    YERVFKQFDANGDGKISPMELQQCVGAIGGELSLTEAEVAVEYLDSDGDGLLGLDDFVKF  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++G   E K + LREAF MY   G+  ITPKSLK+ML RLGES     CK MI RFDLNG
Sbjct  67   VDGGCDEEKVNVLREAFNMYVTDGSGCITPKSLKRMLSRLGESKRVDECKNMIARFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLNFDEFKVMM  139



>gb|KFK32927.1| hypothetical protein AALP_AA6G307400 [Arabis alpina]
Length=187

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG LT  EAEE V++SD DGDG +  E+F KLMEG
Sbjct  54   VFEYIDTNSDGKISGEELQSCVGLLGGALTTREAEEVVKVSDMDGDGFIDFEEFVKLMEG  113

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     L+ AFGMY ++G ++IT  SL++ L RLGES++  +CK MI  FD +GD
Sbjct  114  EDSSDEERRKELKVAFGMYVMEGEEFITAASLRRTLSRLGESSSVESCKVMIGGFDQDGD  173

Query  79   GVLGFDEFKIMM  44
            GVL FDEF +MM
Sbjct  174  GVLSFDEFLLMM  185



>ref|XP_010471819.1| PREDICTED: calcium-binding protein CML39 [Camelina sativa]
Length=159

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +++ EEAE AV+LSD DGDGML + +F +L+
Sbjct  24   EAVFAYMDANRDGRISADELKKSFMTMGEQMSDEEAEAAVKLSDIDGDGMLDLHEFAQLI  83

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E K+ ++ EAF MY   G D ITP SLK ML +LGES TT +C+ MI+ FDL
Sbjct  84   KGNDDFTEEEKKMKIMEAFRMYIADGEDCITPGSLKMMLMKLGESRTTDDCRDMIQAFDL  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|XP_010428728.1| PREDICTED: calcium-binding protein CML39-like [Camelina sativa]
Length=159

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +++ EEAE AV+LSD DGDGML + +F +L+
Sbjct  24   EAVFAYMDANRDGRISADELKKSFMTMGEQMSDEEAEAAVKLSDIDGDGMLDLHEFAQLI  83

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
             G      E K+ ++ EAF MY  +G D ITP SLK ML +LGES TT +C+ MI+ FDL
Sbjct  84   RGNDDFTEEEKKMKIMEAFRMYIAEGEDCITPGSLKMMLMKLGESRTTDDCRDMIQAFDL  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|XP_007148928.1| hypothetical protein PHAVU_005G026000g [Phaseolus vulgaris]
 gb|ESW20922.1| hypothetical protein PHAVU_005G026000g [Phaseolus vulgaris]
Length=143

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  +FDEDGDG++S  EL++ +  +GGEL  +E E  +   D DGDG L +ED  K+
Sbjct  8    FERVLKHFDEDGDGKISPWELRKKLGMMGGELGLKEVELLMEELDCDGDGFLSLEDLVKV  67

Query  253  MEGERKEDELR---EAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME   +E++LR   EAF MY   +   +ITPKSL+ ML RLGES + H C AMI  FDLN
Sbjct  68   MEAAGEEEKLRDLGEAFEMYNDCEMLGFITPKSLQMMLSRLGESKSIHQCTAMIHHFDLN  127

Query  85   GDGVLGFDEFKIMMS  41
            GDG+L F EF +MM+
Sbjct  128  GDGLLNFHEFALMMN  142



>ref|XP_008348163.1| PREDICTED: LOW QUALITY PROTEIN: putative calcium-binding protein 
CML19 [Malus domestica]
Length=145

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FD +GDG++S  ELQ+ V A+GGEL+  EAE  V   DSDGDG+LG++DF K 
Sbjct  12   YERVFKQFDANGDGKISPMELQQCVGAIGGELSLTEAEVVVEYLDSDGDGLLGLDDFVKF  71

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++G   E K   LREAF MY + G+  ITPKSLK+ML RLGES +   CK MI RFDLNG
Sbjct  72   VDGGCDEEKVCVLREAFKMYVMDGSGCITPKSLKRMLSRLGESKSVDECKNMIARFDLNG  131

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  132  DGVLNFDEFKVMM  144



>ref|XP_010471823.1| PREDICTED: calcium-binding protein CML38-like [Camelina sativa]
Length=183

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 116/182 (64%), Gaps = 14/182 (8%)
 Frame = -2

Query  553  SSSSPSKNSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVS  383
            ++++  + S F  FC KL+ +R   A      SS + E+     E VFAY D + DGR+S
Sbjct  3    NNNNTRRQSSFKKFCRKLSPERQDSAGDIQQHSSSNVEDKNRDLEAVFAYLDANRDGRIS  62

Query  382  AAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKEDEL-------  224
            A ELQ++   +G EL+ EEAE AV+LSD+DGDGML  E+F +L++  R +D+        
Sbjct  63   AEELQKSFTTLGEELSDEEAEAAVKLSDTDGDGMLDFEEFAQLIK--RDDDQFTEEEKKM  120

Query  223  --REAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKI  50
              +EAF +Y  +G + ITP+SLK ML +LGES TT +C+ MI  FD+N DGVL FDEF +
Sbjct  121  ELKEAFRLYRSEGEECITPRSLKLMLKKLGESRTTDDCQVMISAFDVNADGVLSFDEFAL  180

Query  49   MM  44
            MM
Sbjct  181  MM  182



>ref|XP_002511206.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF51808.1| Polcalcin Jun o, putative [Ricinus communis]
Length=140

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E +F + D++GDG++S +EL   V  +GG+L  +EAE AV L DSDGDG+L +ED  +LM
Sbjct  8    ELIFRHLDKNGDGKISPSELSDHVSLIGGKLFVKEAEMAVGLVDSDGDGLLELEDLVRLM  67

Query  250  EG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E    E K  +L+EAF MY      +ITP +L+KML RLG+S +   CK MI +FDLNGD
Sbjct  68   EAGGEEEKLQDLKEAFAMYDEDNCGFITPNNLRKMLKRLGDSKSIDECKVMINQFDLNGD  127

Query  79   GVLGFDEFKIMM  44
            GVL F+EF++MM
Sbjct  128  GVLSFEEFRVMM  139



>ref|XP_008341320.1| PREDICTED: putative calcium-binding protein CML19 [Malus domestica]
Length=140

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF  FD +GDG++S  ELQ+ V A+GGEL+  EAE AV   DSDGDG+LG++DF K 
Sbjct  7    YERVFKQFDGNGDGKISPIELQQCVGAIGGELSLTEAEVAVEYLDSDGDGLLGLDDFVKF  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++G   E K   L+EAF MY + G+  ITPKSLK+ML RLGES +   CK MI RFDLNG
Sbjct  67   VDGGCDEEKVSVLKEAFKMYVMDGSGCITPKSLKRMLSRLGESKSVDECKNMIARFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  127  DGVLNFDEFKVMM  139



>emb|CDY20397.1| BnaC02g24190D [Brassica napus]
Length=169

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +L+ EEAE  V+LSD DGDGML  E+F +L+
Sbjct  33   EAVFAYMDANRDGRISAEELKKSFNTLGDQLSDEEAEATVKLSDIDGDGMLDFEEFAQLI  92

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E ++ ++ EAF MY  +G D ITP+SLK ML +LGE  T+ +C  MI+ FDL
Sbjct  93   KGNDEFTEEEQKRKMMEAFRMYIDEGEDCITPRSLKTMLMKLGELRTSDDCVVMIKAFDL  152

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  153  NDDGVLSFDEFALMM  167



>ref|XP_002321694.2| hypothetical protein POPTR_0015s10590g [Populus trichocarpa]
 gb|EEF05821.2| hypothetical protein POPTR_0015s10590g [Populus trichocarpa]
Length=140

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E VF + DE+GDG+VS +EL R +  + GE   +EAE AV   DSDGDG+LG+ED  +L
Sbjct  7    FEVVFRHLDENGDGKVSPSELSRCLGLIAGEFLVKEAELAVESLDSDGDGLLGLEDLVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF +Y I    +I  K+LK ML RLGES +   C+ MI +FDLNG
Sbjct  67   MEAGGEEEKLHDLREAFRLYDIDNCGFIRAKALKTMLGRLGESRSIDECEVMINKFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF +MM
Sbjct  127  DGVLSFEEFMVMM  139



>ref|XP_002302467.1| hypothetical protein POPTR_0002s13360g [Populus trichocarpa]
 gb|EEE81740.1| hypothetical protein POPTR_0002s13360g [Populus trichocarpa]
Length=140

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E VF   DEDGDG+VS +EL   +  +GG+L  +EAE AV   DSDGDG+LG+ED  +L
Sbjct  7    FEVVFRCLDEDGDGKVSPSELSHRLSLIGGDLLMKEAELAVESLDSDGDGLLGLEDLVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF +Y I    +I  K LK ML RLGES +   C+ MI +FDLNG
Sbjct  67   MEAGGEEEKLHDLREAFHLYDIDNCGFIRAKDLKTMLGRLGESRSIDECEVMINKFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF +MM
Sbjct  127  DGVLSFEEFMVMM  139



>ref|XP_004971306.1| PREDICTED: probable calcium-binding protein CML31-like [Setaria 
italica]
Length=151

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 96/133 (72%), Gaps = 5/133 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA FD+D DGR+SAAEL+  +RA  GE ++AE+AE  V   D+DGDG+L  ++F +L+ 
Sbjct  18   LFAAFDKDADGRISAAELRLCMRATLGEDVSAEDAEALVASVDADGDGLLDGDEFARLVH  77

Query  247  GERKEDE----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
             E +E+E    LR AFGMY ++G   ITP SLK+ML RLG      +C+AMI RFDL+GD
Sbjct  78   AEVEEEERHRGLRLAFGMYEMEGEGCITPTSLKRMLSRLGAHQEIDDCRAMICRFDLDGD  137

Query  79   GVLGFDEFKIMMS  41
            GVL FDEFKIMMS
Sbjct  138  GVLSFDEFKIMMS  150



>gb|EAY77274.1| hypothetical protein OsI_05248 [Oryza sativa Indica Group]
Length=151

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA FD DGDGR+SAAEL+  ++A +G E++ EEA + V   D+DGDG+L   +F +L++
Sbjct  15   LFAAFDHDGDGRISAAELRLCMKATLGEEVSDEEAGQLVASVDADGDGLLCEAEFVRLVQ  74

Query  247  GERKEDE-------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
                E+E       LREAFGMY ++G   ITP SL++ML RLG      +C+AMI RFDL
Sbjct  75   AAEVEEEDERRGTGLREAFGMYEMEGEGCITPTSLRRMLRRLGSDQDIDDCRAMICRFDL  134

Query  88   NGDGVLGFDEFKIMMS  41
            NGDGVL FDEFKIMM+
Sbjct  135  NGDGVLSFDEFKIMMN  150



>ref|XP_002889093.1| hypothetical protein ARALYDRAFT_476823 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65352.1| hypothetical protein ARALYDRAFT_476823, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=165

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 6/163 (4%)
 Frame = -2

Query  514  FCTKLTRKRAKg---edssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRAVRAVGG  344
            FC KL+ KR          +S + E+  S  E VF Y D + DGR+SA ELQ++   +G 
Sbjct  2    FCRKLSPKRKDSGGKIQQHNSNNGEDKNSDLEAVFDYMDANKDGRISAEELQKSFMTLGE  61

Query  343  ELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGE---RKEDELREAFGMYAIKGTDYITP  173
            +L+ EEAE AVRLSD+DGDGML  E+FT+L++ +    K+ EL+EAF +Y  +G + ITP
Sbjct  62   QLSDEEAEAAVRLSDTDGDGMLDFEEFTQLIKADDEEEKKIELKEAFKLYISEGEECITP  121

Query  172  KSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
            +SLK ML +LGES TT +CK MI  FDLN DGVL FDEF +MM
Sbjct  122  RSLKMMLKKLGESRTTDDCKVMISAFDLNADGVLSFDEFALMM  164



>ref|XP_010922578.1| PREDICTED: putative calcium-binding protein CML19 [Elaeis guineensis]
Length=145

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E+VF  FD+DGDG++SA+EL+  +  +G EL+AE+AE  V  +DS+ DG+L +E+F +L
Sbjct  11   FEQVFRLFDKDGDGKISASELRLCMGMIGEELSAEDAECLVESADSNSDGLLELEEFQRL  70

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++ E +E+   +LR AF MY ++G   IT KSLK+ML RLG S     C+AMI RFDLNG
Sbjct  71   VDAEGEEERRRDLRAAFEMYEMEGEGCITDKSLKRMLSRLGTSKGLEECRAMICRFDLNG  130

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF+IMM
Sbjct  131  DGVLSFEEFRIMM  143



>ref|XP_006390168.1| hypothetical protein EUTSA_v10019832mg [Eutrema salsugineum]
 gb|ESQ27454.1| hypothetical protein EUTSA_v10019832mg [Eutrema salsugineum]
Length=168

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA E+++ ++ +G +L+ EEAE AV+LSD DGDGML  E+F +L+
Sbjct  33   EDVFAYMDANRDGRISAQEVKKILKTLGEQLSDEEAEAAVKLSDMDGDGMLDFEEFAQLI  92

Query  250  EG------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G      E K+ ++ EAF MY  +G D ITP+SLK ML +LGE+ T  +C  MI+ FD 
Sbjct  93   KGSDEFTEEEKKIKIMEAFRMYIAEGEDCITPRSLKMMLMKLGEARTIDDCILMIKAFDT  152

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  153  NADGVLSFDEFVLMM  167



>ref|XP_010660785.1| PREDICTED: putative calcium-binding protein CML19 [Vitis vinifera]
Length=142

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERVF +FD++GDG++SA+ELQ         +T EEAE A+   DSDGDG+L + D  +L
Sbjct  13   YERVFKHFDDNGDGKISASELQGHCDG----MTLEEAEAALESLDSDGDGLLELGDLVRL  68

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E + ++L+EAF MY   G   ITPKSL +ML RLGES +   C  MI +FDLNG
Sbjct  69   VEGVEEEERINDLKEAFKMYENDGCGCITPKSLNRMLSRLGESRSIDECTVMISQFDLNG  128

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  129  DGVLNFDEFKVMM  141



>ref|XP_007148929.1| hypothetical protein PHAVU_005G026100g [Phaseolus vulgaris]
 gb|ESW20923.1| hypothetical protein PHAVU_005G026100g [Phaseolus vulgaris]
Length=141

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 90/135 (67%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV   FDEDGDG++S  EL++ +  +GGEL  +E E  +   D DGDG L +ED  K+
Sbjct  6    FERVLKCFDEDGDGKISPWELRKKLGMMGGELGMKEVELLMEELDCDGDGFLSLEDLVKV  65

Query  253  MEGERKEDELR---EAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME   +E++LR   EAF MY   +   +ITPKSL+ ML RLGES + H C AMI  FDLN
Sbjct  66   MEAAGEEEKLRDLGEAFEMYNDCEMLGFITPKSLQMMLSRLGESKSIHQCTAMIHHFDLN  125

Query  85   GDGVLGFDEFKIMMS  41
            GDG+L F EF +MM+
Sbjct  126  GDGLLNFHEFTLMMN  140



>ref|XP_008789178.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=163

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
             ERVF  FD DGD ++S+AEL+  +RAVG E++ EEAE  VR +D DG+G+L +E+F  L
Sbjct  31   LERVFGRFDVDGDAKISSAELRLIMRAVGEEMSLEEAEAVVRSADKDGNGLLDLEEFVGL  90

Query  253  M--EGERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            +  E E KE EL EAFGMY ++G   ITP+SLK+ML RLG S     C+AMI RFDLNGD
Sbjct  91   VGVEEEEKERELMEAFGMYEMEGEGCITPRSLKRMLSRLGASRELEECRAMICRFDLNGD  150

Query  79   GVLGFDEFKIMM  44
            GV+ FDEFK+MM
Sbjct  151  GVISFDEFKVMM  162



>ref|XP_012079860.1| PREDICTED: calcium-binding protein CML38-like [Jatropha curcas]
 gb|KDP30935.1| hypothetical protein JCGZ_11311 [Jatropha curcas]
Length=141

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGEL-TaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            E +F + D++GDG++S +EL   + ++GG++   +EAE AV L DSDGDG+LG+ED  +L
Sbjct  8    EIIFRHLDKNGDGKISPSELSDQLSSIGGKVFMVKEAEMAVELLDSDGDGLLGLEDLVRL  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF MY      +ITPK+LK+ML RLGES +   CK MI  FDL+G
Sbjct  68   MEAGGEEEKLQDLREAFAMYDTDNCGFITPKNLKRMLKRLGESKSIDECKIMISEFDLDG  127

Query  82   DGVLGFDEFKIMMS  41
            DGVL F+EF +MM 
Sbjct  128  DGVLSFEEFLVMMQ  141



>ref|XP_006579175.1| PREDICTED: probable calcium-binding protein CML25/26-like [Glycine 
max]
Length=139

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YF+EDGDG++S +EL+  +  +GGEL  ++AE+ +   DSDGDG+L +E+F K+
Sbjct  7    FERVLKYFNEDGDGKISPSELRNRLGMMGGELLFKDAEKLIEELDSDGDGLLSLENFVKI  66

Query  253  ME--GERKEDELREAFGMY-AIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME  GE K  +L EAF MY   +   +IT KSL++ML RLGES +   C  MI  FDLNG
Sbjct  67   MEDAGEEKLKDLAEAFEMYRNTEMYGFITTKSLQRMLRRLGESKSMEQCTTMIDHFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DG+L FDEF++MM
Sbjct  127  DGLLCFDEFRVMM  139



>ref|XP_004971308.1| PREDICTED: putative calcium-binding protein CML19-like [Setaria 
italica]
Length=142

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            + RVF+ FD D DG++SAAEL+  ++A  GE ++AE+A+E V  +D+DGDG+L  E+F K
Sbjct  5    FSRVFSAFDRDDDGKISAAELRLCMKAALGEDVSAEDADELVASADTDGDGLLSQEEFLK  64

Query  256  LMEGERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            L++ E   +E     L+EAFGMY +KG   ITP SLK+ML +LG       CKAMI RFD
Sbjct  65   LVQLEAAAEEERCRGLKEAFGMYEMKGEGCITPLSLKRMLSKLGSHQEIDECKAMICRFD  124

Query  91   LNGDGVLGFDEFKIMM  44
            L+GDGVL F+EFK+MM
Sbjct  125  LDGDGVLSFEEFKVMM  140



>ref|XP_003538266.2| PREDICTED: calmodulin-like protein 12-like [Glycine max]
Length=272

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YFDEDGDG++S  EL+  +  +GGEL  ++AE+ +   DSDGDG L +EDF KL
Sbjct  138  FERVLKYFDEDGDGKISPCELRNRLGMIGGELLTKDAEKLIEELDSDGDGFLSLEDFVKL  197

Query  253  MEG---ERKEDELREAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME    + K  +L EAF MY   +   +ITPKSL++ML RLGES +   C  MI  FDLN
Sbjct  198  MEAAGEDEKLKDLEEAFEMYNDTEMFGFITPKSLQRMLGRLGESKSMEQCTTMIGHFDLN  257

Query  85   GDGVLGFDEFKIMMS  41
            GDG+L FDEF++MM 
Sbjct  258  GDGLLCFDEFRVMMQ  272


 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 4/132 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YFDEDGDG++S  EL+  +  +GGEL A++AE+ +   DSDGDG L +EDF KL
Sbjct  7    FERVLKYFDEDGDGKISPCELRNRLGMIGGELLAKDAEKLIEELDSDGDGFLSLEDFVKL  66

Query  253  MEG---ERKEDELREAFGMYA-IKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            ME    + K  +L EAF MY   +   +ITPKSL++ML RLGES +   C  MI  FDLN
Sbjct  67   MEAAGEDEKLKDLEEAFEMYNDTEMFGFITPKSLQRMLGRLGESKSMEQCTTMIGHFDLN  126

Query  85   GDGVLGFDEFKI  50
            GDG+L FDEF+ 
Sbjct  127  GDGLLCFDEFRF  138



>ref|XP_006645374.1| PREDICTED: putative calcium-binding protein CML19-like [Oryza 
brachyantha]
Length=144

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 5/135 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            + RVF  FD D DG++SAAEL+  ++A  GE ++AEEAE  V  +D+DGDG+L  E+FT+
Sbjct  8    FRRVFTAFDRDADGKISAAELRLCMKAALGEDMSAEEAEALVSSADADGDGLLDEEEFTR  67

Query  256  LMEGERKEDE----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            L++    E+E    LREAF MY ++G + ITP SLK+ML +LG       C+AMI RFDL
Sbjct  68   LVQLGMDEEERCRGLREAFRMYEMEGEERITPVSLKRMLSKLGSHQDIEECQAMICRFDL  127

Query  88   NGDGVLGFDEFKIMM  44
            NGDGV+ F+EFKIMM
Sbjct  128  NGDGVISFEEFKIMM  142



>ref|XP_011017282.1| PREDICTED: calcium-binding protein CML37-like [Populus euphratica]
Length=140

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E VF   DEDGDG+VS +EL   +  +GG+L  +EAE AV   DSDGDG+LG+ED  +L
Sbjct  7    FEVVFRRLDEDGDGKVSPSELSHRLSLIGGDLLMKEAELAVESLDSDGDGLLGLEDLVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF +Y +    +I  K LK ML RLGES +   C+ MI +FDLNG
Sbjct  67   MEAGGEEEKLHDLREAFRLYDMDNCGFIRAKDLKTMLGRLGESRSIDECEVMINKFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF +MM
Sbjct  127  DGVLSFEEFMVMM  139



>ref|XP_002863793.1| hypothetical protein ARALYDRAFT_917538 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40052.1| hypothetical protein ARALYDRAFT_917538 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DG++S  ELQ  V  +GG L++ EAEE V++SD DGDG +   +F KLMEG
Sbjct  53   VFDYMDANSDGKISGEELQSCVSLLGGALSSREAEEVVKISDVDGDGFIDFGEFLKLMEG  112

Query  244  ERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGD  80
            E   DE     LR AFGMY ++G ++IT  SL++ L RLGES T   CK MIR FD N D
Sbjct  113  EDGNDEERRKELRVAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFDQNDD  172

Query  79   GVLGFDEFKIMM  44
            GVL F+EF +MM
Sbjct  173  GVLSFEEFVLMM  184



>ref|XP_011024043.1| PREDICTED: calcium-binding protein CML38-like [Populus euphratica]
Length=140

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E VF + DE+GDG+VS +EL R +  + GE   +EAE AV   DSDGDG+LG+ED  +L
Sbjct  7    FEVVFRHLDENGDGKVSPSELSRRLGLIAGEFLVKEAELAVESLDSDGDGLLGLEDLVRL  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E K  +LREAF +Y +    +I  K LK ML RLGES +   C+ MI +FDLNG
Sbjct  67   MEAGGEEEKLHDLREAFRLYDMDNCGFIRAKDLKTMLGRLGESRSIDECEVMINKFDLNG  126

Query  82   DGVLGFDEFKIMM  44
            DGVL F+EF IMM
Sbjct  127  DGVLSFEEFMIMM  139



>ref|NP_001045436.1| Os01g0955100 [Oryza sativa Japonica Group]
 sp|Q8RYK0.1|CML31_ORYSJ RecName: Full=Probable calcium-binding protein CML31; AltName: 
Full=Calmodulin-like protein 31 [Oryza sativa Japonica Group]
 dbj|BAB90781.1| putative regulator of gene silencing [Oryza sativa Japonica Group]
 dbj|BAF07350.1| Os01g0955100 [Oryza sativa Japonica Group]
 gb|ACD99648.1| putative calmodulin [Oryza sativa Indica Group]
 dbj|BAG88406.1| unnamed protein product [Oryza sativa Japonica Group]
Length=151

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 8/136 (6%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA FD DGDGR+SAAEL+  ++  +G E++ EEA + V   D+DGDG+L   +F +L++
Sbjct  15   LFATFDHDGDGRISAAELRLCMKTTLGEEVSDEEAGQLVASVDADGDGLLCEAEFVRLVQ  74

Query  247  GERKEDE-------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
                E+E       LREAFGMY ++G   ITP SL++ML RLG      +C+AMI RFDL
Sbjct  75   AAEVEEEDERRGTGLREAFGMYEMEGEGCITPTSLRRMLRRLGSDQDIDDCRAMICRFDL  134

Query  88   NGDGVLGFDEFKIMMS  41
            NGDGVL FDEFKIMM+
Sbjct  135  NGDGVLSFDEFKIMMN  150



>gb|EAZ14873.1| hypothetical protein OsJ_04802 [Oryza sativa Japonica Group]
Length=158

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 8/136 (6%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA FD DGDGR+SAAEL+  ++  +G E++ EEA + V   D+DGDG+L   +F +L++
Sbjct  22   LFATFDHDGDGRISAAELRLCMKTTLGEEVSDEEAGQLVASVDADGDGLLCEAEFVRLVQ  81

Query  247  GERKEDE-------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
                E+E       LREAFGMY ++G   ITP SL++ML RLG      +C+AMI RFDL
Sbjct  82   AAEVEEEDERRGTGLREAFGMYEMEGEGCITPTSLRRMLRRLGSDQDIDDCRAMICRFDL  141

Query  88   NGDGVLGFDEFKIMMS  41
            NGDGVL FDEFKIMM+
Sbjct  142  NGDGVLSFDEFKIMMN  157



>ref|XP_010530254.1| PREDICTED: calcium-binding protein CML37-like [Tarenaya hassleriana]
Length=200

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 90/135 (67%), Gaps = 8/135 (6%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF Y D + DGR+SAAELQ  V   GG LTA +AEEAV++ D DGDG +   +F KLM+G
Sbjct  64   VFDYMDTNSDGRISAAELQSCVGLFGGALTASDAEEAVKVMDLDGDGFVDFAEFLKLMKG  123

Query  244  ERKE--------DELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            E  E         EL +AFG+Y  +G ++IT  SL++ L RLGES T   CKAMIR FD 
Sbjct  124  EGDEFYGEDERRKELLDAFGVYVTEGDEFITAASLRRTLSRLGESRTVDECKAMIRVFDK  183

Query  88   NGDGVLGFDEFKIMM  44
            NGDGVL FDEF +MM
Sbjct  184  NGDGVLSFDEFVLMM  198



>ref|XP_010416584.1| PREDICTED: calcium-binding protein CML39-like [Camelina sativa]
Length=159

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            E VFAY D + DGR+SA EL+++   +G +++ EEAE AV+LSD DGDGML + +F +L+
Sbjct  24   EAVFAYMDANRDGRISADELKKSFMTMGEQMSDEEAEAAVKLSDIDGDGMLDLHEFAQLI  83

Query  250  EGERK------EDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +G  +      + ++ EAF MY  +G D ITP SLK ML +LGES TT +C+ MI+ FDL
Sbjct  84   KGNDEFTEEEKKKKILEAFRMYIAEGEDCITPGSLKMMLMKLGESRTTDDCRDMIQAFDL  143

Query  88   NGDGVLGFDEFKIMM  44
            N DGVL FDEF +MM
Sbjct  144  NADGVLSFDEFALMM  158



>ref|NP_001077834.1| calcium-binding protein CML38 [Arabidopsis thaliana]
 gb|AEE35870.1| calcium-binding protein CML38 [Arabidopsis thaliana]
Length=167

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 102/169 (60%), Gaps = 16/169 (9%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKR---AKgedssssfsseedgSCYERVFAYFDEDGDGRVSAAELQRA  362
             S F   C KL+ KR   A      +S + E+     E VF+Y D + DGR+S  ELQ++
Sbjct  8    QSSFKKLCRKLSPKREDSAGEIQQHNSSNGEDKNRELEAVFSYMDANRDGRISPEELQKS  67

Query  361  VRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM---EGERKEDELREAFGMYAIKG  191
               +G +L          LSD+DGDGML  E+F++L+   + E K+ EL+ AF +Y  +G
Sbjct  68   FMTLGEQL----------LSDTDGDGMLDFEEFSQLIKVDDEEEKKMELKGAFRLYIAEG  117

Query  190  TDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGFDEFKIMM  44
             D ITP+SLK ML +LGES TT +C+ MI  FDLN DGVL FDEF +MM
Sbjct  118  EDCITPRSLKMMLKKLGESRTTDDCRVMISAFDLNADGVLSFDEFALMM  166



>gb|EMS51536.1| Putative calcium-binding protein CML23 [Triticum urartu]
Length=145

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            + RVF+ FD+DG+G++SAAEL+  ++A +GG+++AEE +  +  +D+DGDG+L  E+F +
Sbjct  7    FTRVFSAFDQDGNGKISAAELRLCMKAALGGDMSAEEVQALMASADADGDGLLDEEEFVR  66

Query  256  LMEGERKE-----DELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            L+           D  REAFGMY ++G   ITP SLK M+ RLG       C+AMIRRFD
Sbjct  67   LVREAEAGQEEEGDRCREAFGMYEMEGRGCITPLSLKLMMSRLGLHLDVDECQAMIRRFD  126

Query  91   LNGDGVLGFDEFKIMM  44
            LNGDGVL FDEFK MM
Sbjct  127  LNGDGVLTFDEFKTMM  142



>gb|EMT24237.1| Putative calcium-binding protein CML23 [Aegilops tauschii]
Length=145

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 6/136 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            + RVF+ FD+DGDG++S AEL+  ++A +GG+++AEE +  +  +D+DGDG+L  E+F +
Sbjct  7    FRRVFSAFDQDGDGKISTAELRLCMKAALGGDMSAEEVQALMASADADGDGLLDEEEFLR  66

Query  256  LME-----GERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFD  92
            L+       E + D  REAFGMY ++G   ITP SLK M+ RLG       C+AMIRRFD
Sbjct  67   LVRETDAGKEEQGDRCREAFGMYEMEGRGCITPLSLKLMMSRLGLHLDVVECQAMIRRFD  126

Query  91   LNGDGVLGFDEFKIMM  44
            LNGDG+L FDEFK MM
Sbjct  127  LNGDGLLTFDEFKTMM  142



>ref|XP_006645375.1| PREDICTED: probable calcium-binding protein CML31-like [Oryza 
brachyantha]
Length=150

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 96/136 (71%), Gaps = 8/136 (6%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA FD+DGDG++SAAEL+  ++A +G E++ EEAE+ V   D+DGDG+L   +F +L++
Sbjct  14   LFAAFDQDGDGKISAAELRVCMKATLGEEVSGEEAEQLVWSVDADGDGLLCEAEFVRLVQ  73

Query  247  GE-------RKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
                     ++   LREAFGMY ++G   ITP SLK+ML RLG      +C+AMI RFDL
Sbjct  74   AAEAAEEEEQRSSGLREAFGMYEMEGEGCITPTSLKRMLRRLGSEQDIDDCRAMICRFDL  133

Query  88   NGDGVLGFDEFKIMMS  41
            NGDGVL FDEFKIMM+
Sbjct  134  NGDGVLSFDEFKIMMN  149



>ref|XP_004138612.1| PREDICTED: calcium-binding protein CML38-like [Cucumis sativus]
 gb|KGN63180.1| hypothetical protein Csa_2G406780 [Cucumis sativus]
Length=140

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE+VF   D DGDG++S  ELQR +  VGG LT EEAE  V   DSDGDG++G ++F + 
Sbjct  7    YEKVFKQVDGDGDGKLSPPELQRCILGVGGSLTIEEAETVVEKLDSDGDGLVGWDEFVEF  66

Query  253  MEGER---KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG     K ++L+EAF MY + G  +IT KSLK+ML +LGES +  +CK MI +FDL+ 
Sbjct  67   VEGVGEEEKVNDLKEAFRMYEMDGCGFITTKSLKRMLSKLGESRSIDDCKKMIAKFDLDS  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MMS
Sbjct  127  DGVLNFDEFKFMMS  140



>ref|XP_008441354.1| PREDICTED: putative calcium-binding protein CML19 [Cucumis melo]
Length=140

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE+VF   D DGDG++S  ELQR +  VGG LT EEAE  V   DS+GDG++G ++F + 
Sbjct  7    YEKVFKQVDGDGDGKLSPPELQRCILGVGGSLTIEEAETVVEKLDSNGDGLVGWDEFVEF  66

Query  253  MEGER---KEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG     K ++L+EAF MY + G  +IT KSLK+ML +LGES +  +CK MI +FDL+ 
Sbjct  67   VEGVGEEEKVNDLKEAFRMYEMDGCGFITTKSLKRMLSKLGESRSIEDCKKMIAKFDLDS  126

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MMS
Sbjct  127  DGVLNFDEFKFMMS  140



>ref|XP_006581875.1| PREDICTED: calcium-binding protein CML38-like [Glycine max]
Length=144

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +E V  YFDEDGDG+VS +EL+  +  +GGEL  +EAE A+   DSDGDG+L +EDF  L
Sbjct  11   FEDVLRYFDEDGDGKVSPSELKHGLGMMGGELPMKEAEMAIAALDSDGDGLLSLEDFIAL  70

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ME    E+K ++L+ AF MY  +   +ITPKSLKKML ++GES +   CK+MI++FDLNG
Sbjct  71   MEAGGEEQKLNDLKVAFEMYDTERCGFITPKSLKKMLKKMGESKSIDECKSMIKQFDLNG  130

Query  82   DGVLGFDEFKIMMS  41
            DGVL F+EF+IMM 
Sbjct  131  DGVLSFEEFRIMMQ  144



>ref|XP_010937895.1| PREDICTED: putative calcium-binding protein CML19 [Elaeis guineensis]
Length=168

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 97/135 (72%), Gaps = 5/135 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ER+F  FD D D ++S+AEL+  +R VG +L+ EEAE  VR +D DGDG+L +E+F  L
Sbjct  31   FERLFGRFDVDADAKISSAELRLMMRTVGEDLSLEEAEAVVRSADKDGDGLLDLEEFVGL  90

Query  253  MEGERKEDELRE-----AFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            +  E +E+E +E     AFGMY ++G   ITP+SLK+ML RLG S    +C+AMI RFDL
Sbjct  91   VGVEGEEEEEKERELREAFGMYEMEGEGCITPRSLKRMLSRLGASRELEDCQAMICRFDL  150

Query  88   NGDGVLGFDEFKIMM  44
            NGDGV+ FDEFK+MM
Sbjct  151  NGDGVISFDEFKVMM  165



>ref|XP_009128187.1| PREDICTED: calcium-binding protein CML39-like [Brassica rapa]
Length=170

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 7/134 (5%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VFAY D + DGR+S  EL ++   +G +L+ EEA+  V+LSD DGDGML  E+F +L++G
Sbjct  35   VFAYMDANRDGRISVEELTKSFNTLGEQLSDEEAKVVVKLSDIDGDGMLDFEEFAQLIKG  94

Query  244  -------ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
                   E K+ ++ EAF MY  +  D ITP+SLK ML +LGE  T  +C+ MI+ FDLN
Sbjct  95   SGDEFTEEEKKRKMLEAFRMYIDESEDCITPRSLKTMLMKLGELRTNDDCRVMIKVFDLN  154

Query  85   GDGVLGFDEFKIMM  44
             DGVL FDEF  MM
Sbjct  155  DDGVLSFDEFAHMM  168



>ref|XP_010537257.1| PREDICTED: calcium-binding protein CML38-like [Tarenaya hassleriana]
Length=191

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 104/187 (56%), Gaps = 24/187 (13%)
 Frame = -2

Query  532  NSGFVSFCTKLTRKRAKgedssssfsseedgSC-----------------YERVFAYFDE  404
            +S FV FC KL+RKR   E                                + VF + D 
Sbjct  4    SSSFVKFCKKLSRKRKITEKQEEGIEEIIQRRSGNNGNGDGRSHGDGKRELQAVFDHMDA  63

Query  403  DGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEGERKE---  233
            D DGR+S  EL+R+  ++GG+L+ EEAE AVRLSDSDGDGML  E+F  +M  +  E   
Sbjct  64   DRDGRISPEELRRSFESLGGKLSEEEAEVAVRLSDSDGDGMLDFEEFLNMMTMDDDEWSE  123

Query  232  ----DELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGVLGF  65
                 E+  AF MY  +G + IT  SLKKML +LGE  T  +C+AMIR FDLN DGVL F
Sbjct  124  EERRGEIEGAFRMYTCEGRECITAASLKKMLGKLGEFRTMDDCRAMIRVFDLNSDGVLSF  183

Query  64   DEFKIMM  44
            DEF +MM
Sbjct  184  DEFALMM  190



>ref|XP_011098857.1| PREDICTED: putative calcium-binding protein CML23, partial [Sesamum 
indicum]
Length=125

 Score =   119 bits (299),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y+RVF  FD +GDG++   ELQR V ++GGE+T EEA  AV L DSDGDG+L ++DF ++
Sbjct  7    YKRVFHRFDSNGDGKICPVELQRCVGSIGGEMTEEEAVAAVVLMDSDGDGLLCLDDFVRI  66

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            +EG   E K  +L+ AF MY ++G+  ITPKSL++ML RLGE  +   C  MI +FDLN
Sbjct  67   VEGAGEEEKASDLKAAFKMYEMEGSGCITPKSLRRMLSRLGERKSVEQCTDMIAQFDLN  125



>gb|EMS48746.1| Putative calcium-binding protein CML19 [Triticum urartu]
Length=157

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 88/134 (66%), Gaps = 7/134 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            +  VFA FD D DG++SAAEL++ ++A  GE ++ E+AE  V  +D+DGD +L  E+F K
Sbjct  10   FSSVFASFDRDADGKISAAELRQCMKAALGEDVSVEDAEALVASADADGDRLLNEEEFLK  69

Query  256  LMEGERKEDE------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
            L+     E E      LREAF MY +KG   ITP SL +ML RLG       C+AMIRRF
Sbjct  70   LLARPETEAEEERCRGLREAFAMYEVKGEGCITPASLMRMLGRLGSEQGIEECRAMIRRF  129

Query  94   DLNGDGVLGFDEFK  53
            DLNGDGV+ FDEFK
Sbjct  130  DLNGDGVVCFDEFK  143



>gb|EMT29767.1| Putative calcium-binding protein CML19 [Aegilops tauschii]
Length=148

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 89/137 (65%), Gaps = 7/137 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            +  VF+ FD D DGR+SAAEL+  ++A  GE ++AE+AE  V  +D+D D +L  E+F +
Sbjct  10   FSSVFSSFDRDADGRISAAELRLCMKAALGEDVSAEDAEALVASADADRDRLLNEEEFLR  69

Query  256  LMEGERKEDE------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
            L+     E E      LREAF MY +KG   ITP SL +ML RLG       C+AMIRRF
Sbjct  70   LVARPETEAEEERCRGLREAFAMYEVKGEGCITPASLMRMLARLGSEQGIEECRAMIRRF  129

Query  94   DLNGDGVLGFDEFKIMM  44
            DLNGDG + FDEFK+MM
Sbjct  130  DLNGDGAVCFDEFKVMM  146



>gb|EYU45393.1| hypothetical protein MIMGU_mgv1a021519mg [Erythranthe guttata]
Length=138

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YER+F  FD +GDG++   EL+R V +VGGE+T EEA  AV L D DGDG+LG+EDF ++
Sbjct  5    YERIFNRFDSNGDGKICPVELRRCVGSVGGEMTEEEAAAAVVLMDGDGDGLLGLEDFVRI  64

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +EG   E K  +L+EAF MY ++G+  ITPKSLK+ML RLGE      C  MI RFDLNG
Sbjct  65   VEGAGDEEKASDLKEAFKMYEMEGSGCITPKSLKRMLSRLGERRDVDECTGMIARFDLNG  124

Query  82   DGVLGFDEFKIMMS  41
            DGVL FDEFK MM+
Sbjct  125  DGVLNFDEFKEMMA  138



>ref|XP_007155535.1| hypothetical protein PHAVU_003G210000g [Phaseolus vulgaris]
 gb|ESW27529.1| hypothetical protein PHAVU_003G210000g [Phaseolus vulgaris]
Length=140

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YERV  Y D DGDG++SA+EL+  +  +GGE+   E E A+   DSDGDG L +ED  K+
Sbjct  7    YERVLRYLDRDGDGKISASELRNGIGMLGGEVGVREVEMAIEGLDSDGDGFLCLEDLMKM  66

Query  253  MEGERKED---ELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            MEG  +E+   +LREAF +Y  +   +ITPK+LK+ML +LG+ T+   C+AMI RFDLNG
Sbjct  67   MEGVEEEEKVKDLREAFDLYDTERCGFITPKALKRMLKKLGDFTSMDQCRAMIARFDLNG  126

Query  82   DGVLGFDEFKIMMS  41
            DG+L F+EF++MM+
Sbjct  127  DGMLSFEEFRVMMN  140



>ref|XP_003567156.2| PREDICTED: putative calcium-binding protein CML23 [Brachypodium 
distachyon]
Length=151

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAV--GG--ELTaeeaeeAVRLSDSDGDGMLGIED  266
            +  +FA FD+DGDG+VSAAEL+  V+A   GG  +++AEE +  +  +D+DGDG+L  E+
Sbjct  9    FRSIFASFDQDGDGKVSAAELRLCVQAALSGGADDMSAEEVQALMASADTDGDGLLDEEE  68

Query  265  FTKLMEGERKEDE------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMI  104
            F +L++    ++E      LREAFGMY ++G   IT  SLK M+ RLG       C+AMI
Sbjct  69   FVRLVQDHIHKEEGDRCRSLREAFGMYEMEGKGCITSLSLKLMMSRLGLPLDVDECQAMI  128

Query  103  RRFDLNGDGVLGFDEFKIMMS  41
             RFDLNGDGVL FDEFK MM+
Sbjct  129  CRFDLNGDGVLTFDEFKTMMT  149



>gb|AFK41707.1| unknown [Lotus japonicus]
Length=146

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 92/138 (67%), Gaps = 8/138 (6%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGG----ELTaeeaeeAVRLSDSDGDGMLGIED  266
            +ERV  YFDEDGDG+VS  E++  V  +GG    E   +E E AV   DSDGDG+L +ED
Sbjct  7    FERVIKYFDEDGDGKVSPTEIRNKVVMMGGCGGGEFLFKEFEMAVEELDSDGDGLLSLED  66

Query  265  FTKLMEGERKED---ELREAFGMYAIKGT-DYITPKSLKKMLCRLGESTTTHNCKAMIRR  98
            F +LMEG  K++   +LREAF MY  K    +ITPKSLK ML +LGE  +   C+ MI  
Sbjct  67   FVELMEGAGKDEKLRDLREAFEMYHDKEMCGFITPKSLKIMLGKLGEFKSLEECRLMINH  126

Query  97   FDLNGDGVLGFDEFKIMM  44
            FDLNGDG+L F+EF+ MM
Sbjct  127  FDLNGDGLLCFEEFRTMM  144



>ref|XP_008792681.1| PREDICTED: probable calcium-binding protein CML31 [Phoenix dactylifera]
Length=167

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -2

Query  430  ERVFAYFDEDGDGRVSAAELQRAV-RAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            E+VF  FD DGDG++S AEL+  + R VG EL  EEAE  VR +D DGDG+L +E+F  L
Sbjct  32   EQVFGQFDVDGDGKISPAELRLTMMRTVGEELNLEEAEAVVRSADKDGDGLLDLEEFVGL  91

Query  253  MEGERKEDELRE---AFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            +  E +E++ RE   AFGMY ++G   ITP+SLK+ML RLG S     C+AMI RFDLNG
Sbjct  92   VGVEGEEEKERELREAFGMYEMEGEGCITPRSLKRMLSRLGASRELEECRAMICRFDLNG  151

Query  82   DGVLGFDEFKIMM  44
            DGVL FDEFK+MM
Sbjct  152  DGVLSFDEFKVMM  164



>gb|EMT24799.1| Putative calcium-binding protein CML31 [Aegilops tauschii]
Length=151

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 12/140 (9%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA  D+D DGR+SAAEL+  +RA  GE + AEEAE  V  +D+DGDG+L   +F +L +
Sbjct  12   LFASLDQDADGRISAAELRGCMRATLGEDVPAEEAEALVASADADGDGLLCEAEFLELAQ  71

Query  247  G------ERKEDELR-----EAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIR  101
                   E  +DELR     EAFGMY ++G   ITP SL +ML RLG       C+AMI 
Sbjct  72   QASWAGVEEGDDELRTRALREAFGMYEMEGQGCITPTSLGRMLGRLGAERGAGECRAMIC  131

Query  100  RFDLNGDGVLGFDEFKIMMS  41
            RFDL+GDGVL FDEFKIMMS
Sbjct  132  RFDLDGDGVLSFDEFKIMMS  151



>ref|XP_009400775.1| PREDICTED: putative calcium-binding protein CML19 [Musa acuminata 
subsp. malaccensis]
Length=146

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 95/131 (73%), Gaps = 3/131 (2%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF +FD+DGDG++SAAEL   +R VG EL+ E+AE  V L D DGDG+LG E+F K++E 
Sbjct  14   VFRFFDKDGDGKISAAELTLCMRTVGEELSLEDAEAFVALVDGDGDGLLGFEEFVKVVEV  73

Query  244  ERKEDE---LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGV  74
            E +E+    LR AF MY  +G   ITP+SLK+ML RLG S+  H C AMI R+DL+GDGV
Sbjct  74   EGEEETERGLRAAFEMYESEGEGCITPRSLKRMLSRLGTSSGIHECAAMICRYDLDGDGV  133

Query  73   LGFDEFKIMMS  41
            L F+EF+ MM+
Sbjct  134  LSFEEFRSMMT  144



>gb|EAY77276.1| hypothetical protein OsI_05250 [Oryza sativa Indica Group]
Length=146

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 91/137 (66%), Gaps = 7/137 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            + RVF+ FD D DG++SAAEL+  ++A  GE ++AEEAE  V  +D+DGDG+L  E+FTK
Sbjct  8    FRRVFSAFDRDADGKISAAELRLCMKAALGEDMSAEEAEALVSSADTDGDGLLDEEEFTK  67

Query  256  LMEGERKEDE------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
            L       DE      L EAF MY ++G   ITP SLK+ML +LG       C+ MI RF
Sbjct  68   LAVQLEMGDEEERCRGLMEAFRMYEMEGEGRITPASLKRMLSKLGSHQGIEECQTMICRF  127

Query  94   DLNGDGVLGFDEFKIMM  44
            DL+GDGV+ F+EFKIMM
Sbjct  128  DLDGDGVISFEEFKIMM  144



>gb|EMS51537.1| putative calcium-binding protein CML31 [Triticum urartu]
Length=142

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            R F+ FD D DG++SAAEL+  V A  G+ ++AE+A   V   D+DGDG+L  E+F KL 
Sbjct  6    RAFSSFDRDSDGKISAAELRLCVEATLGDGISAEDAAALVESVDADGDGLLSEEEFLKLA  65

Query  250  -EGERKEDE-----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
             EGE  E++     LR+AFG+Y ++G   ITP SL++ L RLG S    +C+AMI+RFDL
Sbjct  66   AEGEGGEEDQRRRGLRDAFGVYEVEGRGCITPASLRRALSRLGASRDVGDCRAMIQRFDL  125

Query  88   NGDGVLGFDEFKIMM  44
            NG GVL FDEF+ MM
Sbjct  126  NGVGVLTFDEFETMM  140



>ref|XP_009803565.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
sylvestris]
 ref|XP_009803566.1| PREDICTED: putative calcium-binding protein CML19 [Nicotiana 
sylvestris]
Length=142

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 96/134 (72%), Gaps = 3/134 (2%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            Y R+F   DE+GDG++SA+ELQ+ V  +G +++ +EA+ AV   DSD DG++  +DF +L
Sbjct  8    YRRLFDRLDENGDGKISASELQQCVHLIGKDMSFDEAKAAVAAHDSDDDGLMDFDDFVRL  67

Query  253  MEG---ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNG  83
            ++    E K  EL+EAF MY ++G   ITP+SL++ML +LGES T   C+ MI R+D+NG
Sbjct  68   VDDGTEEEKARELKEAFRMYEMEGCGCITPESLQRMLDKLGESRTIDECRGMISRYDING  127

Query  82   DGVLGFDEFKIMMS  41
            DG+L FDEF IMMS
Sbjct  128  DGLLNFDEFVIMMS  141



>ref|XP_008796222.1| PREDICTED: putative calcium-binding protein CML19 [Phoenix dactylifera]
Length=145

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 95/134 (71%), Gaps = 7/134 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERVF +FDEDGDG++S  +L+R +R +G E +AE+ E    L + +G+ ++G ++FT++
Sbjct  13   FERVFLHFDEDGDGKISQDDLRRCLRTIGEEPSAEQVEL---LLEGNGESLIGFDEFTRV  69

Query  253  M----EGERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLN  86
            +    + E K  ELREAFG++ + G   ITP+SL++ L RLG S +  +C  MI+ FD++
Sbjct  70   VGVVGDEEGKTRELREAFGVFVMDGEGRITPESLRRALSRLGWSRSLEDCIVMIQSFDID  129

Query  85   GDGVLGFDEFKIMM  44
            GDGVLGF+EF+ MM
Sbjct  130  GDGVLGFEEFRNMM  143



>gb|KHN06645.1| Putative calcium-binding protein CML19 [Glycine soja]
Length=144

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 88/126 (70%), Gaps = 7/126 (6%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            +ERV  YF+EDGDG++S +EL+  +  +GGEL  ++AE+ +   DSDGDG+L +E+F K+
Sbjct  7    FERVLKYFNEDGDGKISPSELRNRLGMMGGELLFKDAEKLIEELDSDGDGLLSLENFVKI  66

Query  253  ME--GERKEDELREAFGMYAIKGTD---YITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            ME  GE K  +L EAF MY  + T+   +IT KSL++ML RLGES +   C  MI  FDL
Sbjct  67   MEDAGEEKLKDLAEAFEMY--RNTEMYGFITTKSLQRMLRRLGESKSMEQCTTMIDHFDL  124

Query  88   NGDGVL  71
            NGDG+L
Sbjct  125  NGDGLL  130



>ref|XP_008676053.1| PREDICTED: putative calcium-binding protein CML23 [Zea mays]
 tpg|DAA55313.1| TPA: hypothetical protein ZEAMMB73_669589 [Zea mays]
Length=150

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 92/140 (66%), Gaps = 12/140 (9%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRA-VGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM  251
            RVFA FD+DGDGRVSAAEL+  + A +G +++ E+   A+   D+DGDGML  E+F +L+
Sbjct  9    RVFASFDQDGDGRVSAAELRLCMEAAIGEDVSTEDVRVAMASVDADGDGMLDEEEFLQLV  68

Query  250  EGERKEDE----------LREAFGMYAIKGT-DYITPKSLKKMLCRLGESTTTHNCKAMI  104
            E  +++ +          LREAFGMY +      ITP SLK ML +LGE      C+AMI
Sbjct  69   EASQQQQQQEEEGGRCRWLREAFGMYEMADCRGCITPLSLKLMLAKLGEHRDIAECQAMI  128

Query  103  RRFDLNGDGVLGFDEFKIMM  44
             RFDL+GDGVL FDEFK MM
Sbjct  129  CRFDLDGDGVLSFDEFKTMM  148



>ref|XP_003565101.1| PREDICTED: probable calcium-binding protein CML31 [Brachypodium 
distachyon]
Length=153

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 90/138 (65%), Gaps = 10/138 (7%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +FA  D+D DGR+SA+EL+  + A  GE + AEEAE  V  +D+DGDGML  E+F +L +
Sbjct  16   LFAALDKDADGRISASELRACMGATLGEDVPAEEAEALVASADADGDGMLCEEEFVRLAQ  75

Query  247  GERKEDE---------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
                  E         L+EAFGMY ++G   ITP SL++ML RLG       C+AMI RF
Sbjct  76   QASWAGEEEEEERCRVLKEAFGMYEMEGLGCITPASLRRMLGRLGSDRPVGECRAMICRF  135

Query  94   DLNGDGVLGFDEFKIMMS  41
            DL+GDGVL FDEFKIMMS
Sbjct  136  DLDGDGVLSFDEFKIMMS  153



>gb|EMT24800.1| Putative calcium-binding protein CML31 [Aegilops tauschii]
Length=152

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 89/141 (63%), Gaps = 13/141 (9%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +F   D D DGR+SAAELQ  +RA  GE +  EEAE  V  +D+DGDG+L   +F +L +
Sbjct  12   LFLSLDRDADGRISAAELQGCMRATLGEDVPVEEAEALVVSADADGDGLLCEAEFLELAQ  71

Query  247  --------GERKEDE----LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMI  104
                    GE  +D+    LREAFGMY ++G   ITP SL +ML RLG       C A+I
Sbjct  72   QAAWAGDAGEEDDDQRIRALREAFGMYEMEGQRCITPASLGRMLGRLGAERGAGECHAII  131

Query  103  RRFDLNGDGVLGFDEFKIMMS  41
             RFDL+GDGVL FDEFKIMMS
Sbjct  132  CRFDLDGDGVLSFDEFKIMMS  152



>gb|EMT21075.1| Putative calcium-binding protein CML25/26 [Aegilops tauschii]
Length=149

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 15/142 (11%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            VFA FD+DGDG+VS +EL+R + A  GE ++ EEA  A+ + D+DGDG+L  E+F++L  
Sbjct  6    VFAAFDKDGDGKVSTSELRRCMEATLGEYVSEEEAVAALAVVDTDGDGLLNQEEFSRLAA  65

Query  247  GERKEDE-------LREAFGMYA------IKGTDYITPKSLKKMLCRLGESTT-THNCKA  110
            G  +ED+       LREAFG+YA         T  ITP SL++ L RLG        C+A
Sbjct  66   GAHEEDDADVKRRCLREAFGIYASSSVEDTATTTMITPASLRRTLSRLGSHELGVEECRA  125

Query  109  MIRRFDLNGDGVLGFDEFKIMM  44
            MI RFDL+GDG L FDEF++MM
Sbjct  126  MICRFDLDGDGKLSFDEFQVMM  147



>sp|Q8RYJ8.1|CML19_ORYSJ RecName: Full=Putative calcium-binding protein CML19; AltName: 
Full=Calmodulin-like protein 19 [Oryza sativa Japonica Group]
 dbj|BAB90783.1| putative regulator of gene silencing [Oryza sativa Japonica Group]
 gb|EAZ14875.1| hypothetical protein OsJ_04804 [Oryza sativa Japonica Group]
Length=146

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            + RVF+ FD D DG++SAAEL+  ++A  GE ++AEEAE  V  +D+D DG+L  E+FTK
Sbjct  8    FRRVFSAFDRDADGKISAAELRLCMKAALGEDMSAEEAEALVSSADTDDDGLLDEEEFTK  67

Query  256  LMEGERKEDE------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
            L       DE      L EAF MY ++G   ITP SLK+ML +LG       C+ MI RF
Sbjct  68   LAVQLEMGDEEERCRGLMEAFRMYEMEGEGRITPASLKRMLSKLGSHQGIEECQTMICRF  127

Query  94   DLNGDGVLGFDEFKIMM  44
            DL+GDGV+ F+EFKIMM
Sbjct  128  DLDGDGVISFEEFKIMM  144



>ref|XP_010999941.1| PREDICTED: probable calcium-binding protein CML41 [Populus euphratica]
Length=188

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLMEG  245
            VF +FD DGDGR+SA EL+   R++G  ++ EEA+ A+   D+D D ML  +DF +LM+ 
Sbjct  58   VFRHFDSDGDGRISALELRAYFRSIGEYMSHEEAQSAINDLDADQDNMLDFQDFLRLMQR  117

Query  244  ERKE--DELREAFGMYAI-KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGV  74
            E  +  D+L+ AF M+ + KG+ YITPK L++ML RLG++ +  +C AMI+ FD++G+GV
Sbjct  118  EANDCDDDLKMAFEMFEMEKGSGYITPKGLQRMLHRLGDAKSYDDCVAMIQVFDIDGNGV  177

Query  73   LGFDEFKIMMS  41
            L F EF  MM+
Sbjct  178  LDFHEFNQMMA  188



>ref|XP_006383258.1| hypothetical protein POPTR_0005s12930g [Populus trichocarpa]
 gb|ERP61055.1| hypothetical protein POPTR_0005s12930g [Populus trichocarpa]
Length=188

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM--  251
            VF +FD DGDGR+SA EL+   R++G  ++ EEA+ A+   D+D D ML  +DF +LM  
Sbjct  58   VFRHFDSDGDGRISALELRAYFRSIGESMSHEEAQSAINDLDADQDNMLDFQDFLRLMKR  117

Query  250  EGERKEDELREAFGMYAI-KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGV  74
            E    +D+L+ AF M+ + KG+ YITPK L++ML RLG++ +  +C AMI  FD++G+GV
Sbjct  118  EANDYDDDLKMAFEMFEMEKGSGYITPKGLQRMLHRLGDAKSYDDCVAMIHVFDIDGNGV  177

Query  73   LGFDEFKIMMS  41
            L F EF  MM+
Sbjct  178  LDFHEFNQMMA  188



>ref|XP_004983744.1| PREDICTED: putative calcium-binding protein CML19-like [Setaria 
italica]
Length=157

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 93/144 (65%), Gaps = 13/144 (9%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            +  +FA FD+D DGR+SAAEL+  + A  GE + A++AE  V  +D+DGDG+L  ++F +
Sbjct  13   FGSLFAAFDKDADGRISAAELRLCMGAALGEDVAAKDAEALVASADADGDGLLDGDEFAR  72

Query  256  LMEGE---------RKEDELREAFGMYAIKGTDY---ITPKSLKKMLCRLGESTTTHNCK  113
            L+  +          +   L  AFGMYA +G      ITP SLK+ML RLG      +C+
Sbjct  73   LVRAQAGDGDDEEEERRRGLEAAFGMYAAEGEGARMRITPASLKRMLGRLGAHREVDDCR  132

Query  112  AMIRRFDLNGDGVLGFDEFKIMMS  41
            AMIRRFDL+GDGVL FDEF+IMMS
Sbjct  133  AMIRRFDLDGDGVLSFDEFEIMMS  156



>emb|CBI27594.3| unnamed protein product [Vitis vinifera]
Length=103

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 75/130 (58%), Gaps = 34/130 (26%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKL  254
            YE +F  FDEDGDG++S  ELQR V    GE                             
Sbjct  7    YELIFKRFDEDGDGKLSPWELQRCV----GE-----------------------------  33

Query  253  MEGERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGV  74
             + ERK  ELREAFGMY + G+  ITPKSLK+ML RLGES +   C  M+R+FD+NGDGV
Sbjct  34   -DEERKMKELREAFGMYEMDGSGCITPKSLKRMLSRLGESRSVEECGVMLRQFDVNGDGV  92

Query  73   LGFDEFKIMM  44
            L FDEFK+MM
Sbjct  93   LSFDEFKLMM  102



>gb|EMT21529.1| Putative calcium-binding protein CML19 [Aegilops tauschii]
Length=148

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 92/137 (67%), Gaps = 7/137 (5%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            +  VFA FD + DGR+SAAEL+  ++A  GE ++AE+AE  V L+D+DGD +L  ++F +
Sbjct  10   FSSVFASFDRNADGRISAAELRLCMKAALGEDVSAEDAEALVALADTDGDRLLDEQEFLR  69

Query  256  LM------EGERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
            L+      E E +   LREAF MY +KG   ITP SL +ML  LG       C+AMIRRF
Sbjct  70   LVARPETEEEEERCRGLREAFAMYEVKGEGSITPASLMRMLAMLGSEQGIEECRAMIRRF  129

Query  94   DLNGDGVLGFDEFKIMM  44
            DLNGDGV+ FDEFKIMM
Sbjct  130  DLNGDGVVCFDEFKIMM  146



>ref|XP_006356024.1| PREDICTED: putative calcium-binding protein CML19-like [Solanum 
tuberosum]
Length=140

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = -2

Query  433  YERVFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTK  257
            Y+R+F + DE+GDG++SA ELQ+ V  +G + L  EEAE A+   DSD DG+L  +DF +
Sbjct  4    YKRLFEHIDENGDGKISALELQQCVHLIGKDILLFEEAEAAIVAHDSDNDGLLDFDDFMR  63

Query  256  LMEG----ERKEDELREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDL  89
            L+E     E KE EL+EAF MY ++G   ITP+SLK+ML +LGE  T   C+ MI R+D+
Sbjct  64   LVEDGGTEEEKERELKEAFRMYEMEGCGCITPESLKRMLHKLGEKRTVDECRGMIARYDI  123

Query  88   NGDGVLGFDEFKIMM  44
            NGDG+L F+EF IMM
Sbjct  124  NGDGLLNFEEFVIMM  138



>ref|NP_190646.1| putative calcium-binding protein CML41 [Arabidopsis thaliana]
 sp|Q8L3R2.2|CML41_ARATH RecName: Full=Probable calcium-binding protein CML41; AltName: 
Full=Calmodulin-like protein 41 [Arabidopsis thaliana]
 emb|CAB42906.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AEE78708.1| putative calcium-binding protein CML41 [Arabidopsis thaliana]
Length=205

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 9/138 (7%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM-  251
            +VF++FD DGDG++SA EL+    +VG  ++ E A+EA+   D+D DG LG EDF  LM 
Sbjct  67   QVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFVGLMT  126

Query  250  ------EGERKED-ELREAFGMYAI-KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
                  +GE   D EL+ AF M+ + KG+  ITPK L+KML +LGES T   C+AMI+ +
Sbjct  127  RRDLYGDGEVDGDGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFY  186

Query  94   DLNGDGVLGFDEFKIMMS  41
            D++G+G+L F EF+ MM+
Sbjct  187  DIDGNGILDFHEFRQMMT  204



>gb|AAM20498.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAM91235.1| calmodulin-like protein [Arabidopsis thaliana]
Length=205

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 9/138 (7%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLM-  251
            +VF++FD DGDG++SA EL+    +VG  ++ E A+EA+   D+D DG LG EDF  LM 
Sbjct  67   QVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFVGLMT  126

Query  250  ------EGERKED-ELREAFGMYAI-KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRF  95
                  +GE   D EL+ AF M+ + KG+  ITPK L+KML +LGES T   C+AMI+ +
Sbjct  127  RRDLYGDGEVDGDGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFY  186

Query  94   DLNGDGVLGFDEFKIMMS  41
            D++G+G+L F EF+ MM+
Sbjct  187  DIDGNGILDFHEFRQMMT  204



>gb|EMS52172.1| putative calcium-binding protein CML31 [Triticum urartu]
Length=154

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 89/143 (62%), Gaps = 15/143 (10%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRL---SDSDGDGMLGIEDFTKL  254
            +F   D D DGR+SAAEL+  +RA  GE    E  EA+ L   +D+DGDG+L   +F +L
Sbjct  12   LFLSLDRDADGRISAAELRGCMRATLGEDVPVEEAEALALGASADADGDGLLCEAEFLEL  71

Query  253  ME-----GERKEDE-------LREAFGMYAIKGTDYITPKSLKKMLCRLGESTTTHNCKA  110
             +     G+  E++       LREAFGMY ++G   ITP SL +ML RLG       C+A
Sbjct  72   AQQAAWAGDAGEEDDELRIRALREAFGMYEMEGQGCITPASLGRMLGRLGAERGAGECRA  131

Query  109  MIRRFDLNGDGVLGFDEFKIMMS  41
            MI RFDL+GDGVL FDEFKIMMS
Sbjct  132  MICRFDLDGDGVLSFDEFKIMMS  154



>gb|EMT21110.1| Putative calcium-binding protein CML31 [Aegilops tauschii]
Length=148

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 90/141 (64%), Gaps = 14/141 (10%)
 Frame = -2

Query  424  VFAYFDEDGDGRVSAAELQRAVRAVGGE-LTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            VFA FD+DGDG+VSA++L+  + A  GE ++ EEA   +   D+DGDG+L  E+F++L  
Sbjct  6    VFAAFDKDGDGKVSASDLRCGMAATLGEDVSEEEAAVILAAVDADGDGLLTQEEFSRLAA  65

Query  247  GERKEDE-------LREAFGMYAIKGTD-----YITPKSLKKMLCRLG-ESTTTHNCKAM  107
            G  +ED+       LREAFGMYA   T+      ITP SL++ L RLG        C AM
Sbjct  66   GAHEEDDVDVRQRCLREAFGMYASSSTEATMTTMITPASLRRTLSRLGSHELGVDECTAM  125

Query  106  IRRFDLNGDGVLGFDEFKIMM  44
            I RFDL+GDG L FDEF++MM
Sbjct  126  ICRFDLDGDGALSFDEFQVMM  146



>ref|XP_002283570.1| PREDICTED: probable calcium-binding protein CML41 [Vitis vinifera]
Length=191

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = -2

Query  427  RVFAYFDEDGDGRVSAAELQRAVRAVGGELTaeeaeeAVRLSDSDGDGMLGIEDFTKLME  248
            +VF YFD DGDGR+S  EL+   +++G  ++ EEA++ +   D DGD +L  +DF +LME
Sbjct  61   QVFGYFDSDGDGRISGEELRVYFQSIGESMSHEEAQKVIGDFDVDGDSLLEFQDFVRLME  120

Query  247  GERK-EDELREAFGMYAI-KGTDYITPKSLKKMLCRLGESTTTHNCKAMIRRFDLNGDGV  74
               + +D+L+ AF M+ + KG   ITPK L++M  RLG+S T   C AMIR FDL+G+GV
Sbjct  121  QSSEMDDDLKRAFQMFEVEKGCGCITPKGLQQMFNRLGDSKTYEECVAMIRVFDLDGNGV  180

Query  73   LGFDEFKIMMS  41
            L F EF  MM+
Sbjct  181  LDFHEFHRMMT  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1510973279075