BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8191

Length=1283
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797250.1|  PREDICTED: high mobility group B protein 7-like    183   2e-51   Nicotiana sylvestris
ref|XP_009630975.1|  PREDICTED: high mobility group B protein 7-like    184   2e-51   Nicotiana tomentosiformis
ref|XP_004236870.1|  PREDICTED: high mobility group B protein 7         179   1e-49   Solanum lycopersicum
ref|XP_011070479.1|  PREDICTED: high mobility group B protein 7-like    176   9e-49   Sesamum indicum [beniseed]
ref|XP_006360847.1|  PREDICTED: high mobility group B protein 7-like    169   1e-45   Solanum tuberosum [potatoes]
gb|EYU35548.1|  hypothetical protein MIMGU_mgv1a012961mg                167   7e-45   Erythranthe guttata [common monkey flower]
ref|XP_010248937.1|  PREDICTED: high mobility group B protein 7-like    163   7e-44   Nelumbo nucifera [Indian lotus]
ref|XP_011031229.1|  PREDICTED: high mobility group B protein 7-like    163   7e-44   Populus euphratica
ref|XP_002310906.2|  hypothetical protein POPTR_0007s15320g             162   1e-43   Populus trichocarpa [western balsam poplar]
gb|ABK93630.1|  unknown                                                 162   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010034169.1|  PREDICTED: high mobility group B protein 7         162   5e-43   Eucalyptus grandis [rose gum]
ref|XP_004150195.1|  PREDICTED: high mobility group B protein 7         160   7e-43   Cucumis sativus [cucumbers]
ref|XP_010103584.1|  High mobility group B protein 7                    160   1e-42   Morus notabilis
ref|XP_007043200.1|  High-mobility group box 6                          160   2e-42   
ref|XP_002267697.2|  PREDICTED: high mobility group B protein 7         159   2e-42   
ref|XP_008810905.1|  PREDICTED: high mobility group B protein 7-like    159   3e-42   Phoenix dactylifera
ref|XP_006448478.1|  hypothetical protein CICLE_v10016587mg             158   9e-42   Citrus clementina [clementine]
ref|XP_006468697.1|  PREDICTED: high mobility group B protein 7-like    158   9e-42   
gb|KDO77000.1|  hypothetical protein CISIN_1g026850mg                   158   1e-41   Citrus sinensis [apfelsine]
gb|KDO77003.1|  hypothetical protein CISIN_1g026850mg                   157   2e-41   Citrus sinensis [apfelsine]
gb|KJB49541.1|  hypothetical protein B456_008G147700                    157   2e-41   Gossypium raimondii
emb|CDP16974.1|  unnamed protein product                                157   2e-41   Coffea canephora [robusta coffee]
ref|XP_008389062.1|  PREDICTED: high mobility group B protein 7-like    156   3e-41   
gb|KHG07657.1|  High mobility group B 7 -like protein                   155   7e-41   Gossypium arboreum [tree cotton]
ref|XP_007224613.1|  hypothetical protein PRUPE_ppa026912mg             154   1e-40   
ref|XP_010546256.1|  PREDICTED: high mobility group B protein 7         155   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_008221094.1|  PREDICTED: high mobility group B protein 7-like    154   1e-40   Prunus mume [ume]
ref|XP_009351762.1|  PREDICTED: high mobility group B protein 7-l...    155   2e-40   
ref|XP_009351760.1|  PREDICTED: high mobility group B protein 7-l...    154   2e-40   
ref|XP_010940378.1|  PREDICTED: high mobility group B protein 7-like    152   5e-40   Elaeis guineensis
ref|XP_012068568.1|  PREDICTED: high mobility group B protein 7-like    152   2e-39   Jatropha curcas
ref|XP_004297711.1|  PREDICTED: high mobility group B protein 7-like    150   6e-39   Fragaria vesca subsp. vesca
ref|XP_008802830.1|  PREDICTED: high mobility group B protein 7-like    149   9e-39   Phoenix dactylifera
ref|XP_004497257.1|  PREDICTED: high mobility group B protein 7-l...    149   9e-39   Cicer arietinum [garbanzo]
ref|XP_004497256.1|  PREDICTED: high mobility group B protein 7-l...    149   1e-38   Cicer arietinum [garbanzo]
ref|XP_006288568.1|  hypothetical protein CARUB_v10001858mg             150   1e-38   Capsella rubella
ref|XP_002513135.1|  DNA-binding protein MNB1B, putative                148   3e-38   Ricinus communis
gb|EPS72473.1|  hypothetical protein M569_02286                         146   5e-38   Genlisea aurea
emb|CDY64875.1|  BnaCnng45460D                                          148   9e-38   Brassica napus [oilseed rape]
ref|XP_009385984.1|  PREDICTED: high mobility group B protein 7-like    146   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001236719.1|  uncharacterized protein LOC100306558               146   2e-37   Glycine max [soybeans]
gb|KJB49542.1|  hypothetical protein B456_008G147700                    145   2e-37   Gossypium raimondii
ref|XP_007142737.1|  hypothetical protein PHAVU_007G012700g             145   2e-37   Phaseolus vulgaris [French bean]
gb|KEH44448.1|  high mobility group (HMG)-box protein                   145   3e-37   Medicago truncatula
gb|KHN23128.1|  High mobility group B protein 7                         145   4e-37   Glycine soja [wild soybean]
gb|KHN37346.1|  High mobility group B protein 7                         144   6e-37   Glycine soja [wild soybean]
gb|AFK37944.1|  unknown                                                 144   6e-37   Lotus japonicus
ref|XP_006394608.1|  hypothetical protein EUTSA_v10004817mg             145   9e-37   Eutrema salsugineum [saltwater cress]
gb|ACG31059.1|  HMG1/2-like protein                                     144   1e-36   Zea mays [maize]
ref|XP_006848664.1|  PREDICTED: high mobility group B protein 7         143   1e-36   Amborella trichopoda
ref|XP_003536758.1|  PREDICTED: high mobility group B protein 7-like    143   2e-36   Glycine max [soybeans]
gb|KFK27649.1|  hypothetical protein AALP_AA8G410700                    144   3e-36   Arabis alpina [alpine rockcress]
emb|CDY46957.1|  BnaA02g32890D                                          144   3e-36   Brassica napus [oilseed rape]
ref|XP_002444850.1|  hypothetical protein SORBIDRAFT_07g000230          143   4e-36   Sorghum bicolor [broomcorn]
ref|XP_009130114.1|  PREDICTED: high mobility group B protein 7-l...    143   8e-36   Brassica rapa
ref|XP_010421142.1|  PREDICTED: high mobility group B protein 7-l...    142   9e-36   Camelina sativa [gold-of-pleasure]
emb|CDY40795.1|  BnaC02g41640D                                          142   1e-35   Brassica napus [oilseed rape]
ref|XP_010454621.1|  PREDICTED: high mobility group B protein 7-like    142   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004972392.1|  PREDICTED: high mobility group B protein 7-l...    141   2e-35   Setaria italica
emb|CDY16851.1|  BnaA09g05310D                                          142   2e-35   Brassica napus [oilseed rape]
ref|XP_009141528.1|  PREDICTED: high mobility group B protein 7-like    142   2e-35   Brassica rapa
ref|XP_008677776.1|  PREDICTED: nucleosome/chromatin assembly fac...    142   2e-35   
ref|XP_010493464.1|  PREDICTED: high mobility group B protein 7-like    140   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010688617.1|  PREDICTED: high mobility group B protein 7         139   8e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ05273.1|  hypothetical protein OsI_27476                          137   3e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001060758.1|  Os08g0101100                                       137   4e-34   
ref|XP_002874129.1|  hypothetical protein ARALYDRAFT_910356             135   2e-33   
ref|XP_006659014.1|  PREDICTED: high mobility group B protein 7-like    133   5e-33   Oryza brachyantha
ref|NP_568431.1|  high-mobility group B6 protein                        134   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130115.1|  PREDICTED: high mobility group B protein 7-l...    129   5e-31   Brassica rapa
gb|EMS56844.1|  High mobility group B protein 7                         127   1e-30   Triticum urartu
dbj|BAK07893.1|  predicted protein                                      127   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004972391.1|  PREDICTED: high mobility group B protein 7-l...    129   2e-30   
gb|ABK23898.1|  unknown                                                 126   4e-30   Picea sitchensis
ref|XP_008465567.1|  PREDICTED: high mobility group B protein 7         124   4e-30   Cucumis melo [Oriental melon]
ref|XP_003573245.1|  PREDICTED: high mobility group B protein 7-like    125   9e-30   Brachypodium distachyon [annual false brome]
emb|CCW03275.1|  similar to high mobility group B protein 7             122   5e-28   Lupinus angustifolius
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                           115   7e-28   Ipomoea batatas [batate]
ref|XP_002873936.1|  hypothetical protein ARALYDRAFT_488801             116   2e-26   
ref|XP_008340418.1|  PREDICTED: high mobility group B protein 7-l...    114   9e-26   Malus domestica [apple tree]
ref|XP_008340417.1|  PREDICTED: high mobility group B protein 7-l...    105   2e-22   Malus domestica [apple tree]
ref|XP_006574164.1|  PREDICTED: high mobility group B protein 7-like    100   3e-21   
gb|KHM99982.1|  High mobility group B protein 7                       98.6    4e-21   Glycine soja [wild soybean]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            94.0    6e-20   Nicotiana tomentosiformis
dbj|BAA95697.1|  thionin like protein                                 94.0    6e-20   Nicotiana tabacum [American tobacco]
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            92.8    2e-19   Nicotiana sylvestris
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            90.9    9e-19   Nicotiana sylvestris
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            90.5    9e-19   Nicotiana sylvestris
ref|NP_001190371.1|  high-mobility group B6 protein                   90.9    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    87.8    1e-17   Nicotiana tomentosiformis
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    87.8    1e-17   Nicotiana tomentosiformis
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            87.4    1e-17   Nicotiana tomentosiformis
ref|XP_004297786.1|  PREDICTED: defensin Ec-AMP-D2-like               87.4    1e-17   Fragaria vesca subsp. vesca
ref|XP_004297787.1|  PREDICTED: defensin Ec-AMP-D2-like               87.0    2e-17   Fragaria vesca subsp. vesca
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       86.7    2e-17   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            86.7    3e-17   Cicer arietinum [garbanzo]
ref|XP_003628979.1|  Defensin                                         86.3    4e-17   Medicago truncatula
gb|ACJ26760.1|  protease inhibitor-related protein                    86.3    4e-17   Solanum tuberosum [potatoes]
gb|ACB32234.1|  gamma-thionin/defensin                                85.9    6e-17   Solanum chacoense
gb|AIT42148.1|  defensin-like protein                                 85.5    6e-17   Solanum tuberosum [potatoes]
gb|AFW90621.1|  protease inhibitor-related protein                    85.5    7e-17   Solanum tuberosum [potatoes]
gb|ABO36641.1|  defensin protein                                      85.5    8e-17   Solanum pimpinellifolium [currant tomato]
gb|ABO36637.1|  defensin protein                                      85.1    8e-17   Solanum lycopersicum
ref|NP_001234872.1|  gamma-thionin precursor                          85.1    9e-17   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    85.1    9e-17   Nicotiana sylvestris
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        84.7    1e-16   Sorghum bicolor [broomcorn]
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  84.7    1e-16   Solanum tuberosum [potatoes]
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      84.7    2e-16   Castanea sativa
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        84.0    3e-16   Sorghum bicolor [broomcorn]
gb|AAL35366.1|AF442388_1  defensin protein precursor                  84.0    3e-16   Capsicum annuum
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            83.6    4e-16   Solanum tuberosum [potatoes]
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    83.6    4e-16   Vitis vinifera
gb|AIT42147.1|  defensin-like protein                                 83.2    4e-16   Solanum tuberosum [potatoes]
gb|AFK44299.1|  unknown                                               83.2    5e-16   Lotus japonicus
ref|XP_010421143.1|  PREDICTED: high mobility group B protein 7-l...  85.5    5e-16   
gb|AIT42153.1|  defensin-like protein                                 83.2    5e-16   Solanum tuberosum [potatoes]
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           83.2    5e-16   Phaseolus vulgaris [French bean]
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    83.2    6e-16   
gb|AIT42152.1|  defensin-like protein                                 83.2    6e-16   Solanum tuberosum [potatoes]
ref|XP_003628977.1|  Defensin                                         82.8    7e-16   Medicago truncatula
gb|AIT42150.1|  defensin-like protein                                 82.4    7e-16   Solanum tuberosum [potatoes]
ref|NP_001105076.1|  nucleosome/chromatin assembly factor D           84.7    9e-16   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       82.4    9e-16   Cicer arietinum [garbanzo]
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 82.4    9e-16   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            82.4    1e-15   
ref|XP_003630421.1|  Defensin                                         82.0    1e-15   Medicago truncatula
ref|NP_001048853.1|  Os03g0130300                                     82.0    1e-15   
gb|EYU41881.1|  hypothetical protein MIMGU_mgv1a015087mg              84.0    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               81.6    2e-15   Elaeis guineensis
ref|XP_012078251.1|  PREDICTED: defensin Ec-AMP-D2-like               81.6    2e-15   Jatropha curcas
gb|KHN06998.1|  Defensin-like protein                                 81.6    2e-15   Glycine soja [wild soybean]
emb|CDP10468.1|  unnamed protein product                              81.3    2e-15   Coffea canephora [robusta coffee]
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    80.9    3e-15   Solanum tuberosum [potatoes]
gb|ABK93231.1|  unknown                                               80.9    3e-15   Populus trichocarpa [western balsam poplar]
gb|ACN93800.1|  defensin precursor                                    80.9    3e-15   Vigna unguiculata
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         80.9    4e-15   Nicotiana sylvestris
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         80.9    4e-15   Nicotiana tomentosiformis
gb|AFM82500.1|  defensin                                              80.9    4e-15   Nicotiana tabacum [American tobacco]
gb|AIT42149.1|  defensin-like protein                                 80.5    5e-15   Solanum tuberosum [potatoes]
dbj|BAK07043.1|  predicted protein                                    81.3    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325734.2|  defensin-like family protein                     80.5    6e-15   
emb|CAJ38371.1|  HMG-protein                                          83.2    6e-15   Plantago major [cart-track plant]
emb|CDP10467.1|  unnamed protein product                              80.9    7e-15   Coffea canephora [robusta coffee]
ref|XP_004151187.1|  PREDICTED: defensin Ec-AMP-D2-like               80.1    7e-15   Cucumis sativus [cucumbers]
gb|AFW65042.1|  hypothetical protein ZEAMMB73_846021                  81.3    7e-15   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 80.1    7e-15   Nelumbo nucifera [Indian lotus]
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  80.1    7e-15   Capsicum annuum
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        79.7    8e-15   Sorghum bicolor [broomcorn]
gb|AGT51229.1|  defensin                                              79.7    9e-15   Brassica napus [oilseed rape]
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     80.5    9e-15   Cucumis sativus [cucumbers]
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   80.1    1e-14   Jatropha curcas
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               79.3    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               79.3    1e-14   Populus euphratica
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            79.7    1e-14   Solanum tuberosum [potatoes]
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               79.3    1e-14   Sesamum indicum [beniseed]
gb|AIA67012.1|  defensin                                              79.3    1e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    79.3    1e-14   
ref|XP_012078250.1|  PREDICTED: defensin-like protein                 79.3    1e-14   Jatropha curcas
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           79.3    1e-14   Citrus clementina [clementine]
ref|XP_003628978.1|  Defensin                                         79.3    1e-14   Medicago truncatula
ref|XP_010262835.1|  PREDICTED: high mobility group B protein 1-like  81.6    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               79.3    1e-14   Elaeis guineensis
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               79.0    1e-14   
ref|XP_004232565.1|  PREDICTED: HMG1/2-like protein                   80.9    2e-14   Solanum lycopersicum
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            80.5    2e-14   Glycine max [soybeans]
ref|XP_006340837.1|  PREDICTED: HMG1/2-like protein-like              80.9    2e-14   Solanum tuberosum [potatoes]
emb|CAA05365.1|  high mobility group protein                          80.9    2e-14   Solanum tuberosum [potatoes]
gb|EPS72658.1|  hypothetical protein M569_02099                       81.3    2e-14   Genlisea aurea
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 79.0    2e-14   Nicotiana tomentosiformis
gb|KHN23780.1|  Defensin SD2                                          79.0    2e-14   Glycine soja [wild soybean]
gb|AAL85480.1|  defensin protein 1                                    79.0    2e-14   Prunus persica
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  78.6    2e-14   
ref|NP_001234987.1|  protease inhibitor precursor                     78.6    2e-14   
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           78.6    2e-14   Prunus persica
ref|XP_003629332.1|  Defensin                                         78.6    2e-14   
ref|XP_007046509.1|  High mobility group B4, putative                 80.5    2e-14   Theobroma cacao [chocolate]
gb|ACS96442.1|  defensin                                              78.6    3e-14   Jatropha curcas
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      78.2    3e-14   Nicotiana sylvestris
gb|ADK36631.1|  defensin-like protein                                 77.4    3e-14   Solanum lycopersicum var. cerasiforme [cherry tomato]
emb|CDP21129.1|  unnamed protein product                              79.7    3e-14   Coffea canephora [robusta coffee]
ref|XP_010692886.1|  PREDICTED: HMG1/2-like protein isoform X2        79.7    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               78.2    4e-14   Brassica rapa
ref|XP_008243826.1|  PREDICTED: high mobility group B protein 1-l...  80.5    4e-14   Prunus mume [ume]
ref|XP_009420828.1|  PREDICTED: DNA-binding protein MNB1B-like        79.7    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387918.1|  PREDICTED: DNA-binding protein MNB1B-like is...  79.7    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              77.8    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_006833354.1|  PREDICTED: high mobility group B protein 1       79.0    4e-14   Amborella trichopoda
gb|AAS13434.1|  defensin                                              77.0    5e-14   Nicotiana attenuata
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           77.8    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011094996.1|  PREDICTED: high mobility group B protein 1       80.1    5e-14   Sesamum indicum [beniseed]
ref|NP_176302.2|  defensin-like protein                               77.8    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387916.1|  PREDICTED: HMG1/2-like protein isoform X4        79.7    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387914.1|  PREDICTED: HMG1/2-like protein isoform X2        79.7    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               77.8    5e-14   Eucalyptus grandis [rose gum]
ref|XP_010692885.1|  PREDICTED: high mobility group B protein 3-l...  79.3    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008243819.1|  PREDICTED: high mobility group B protein 1-l...  80.1    5e-14   Prunus mume [ume]
ref|XP_009383540.1|  PREDICTED: HMG1/2-like protein                   79.7    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387915.1|  PREDICTED: HMG1/2-like protein isoform X3        79.7    5e-14   
gb|ABK28445.1|  unknown                                               77.4    6e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238631.1|  uncharacterized protein LOC100499704             79.7    6e-14   
ref|XP_006576167.1|  PREDICTED: uncharacterized protein LOC100499...  79.7    6e-14   
ref|XP_006576170.1|  PREDICTED: uncharacterized protein LOC100499...  79.7    6e-14   
gb|KJB10395.1|  hypothetical protein B456_001G198900                  79.0    6e-14   Gossypium raimondii
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               77.4    7e-14   Malus domestica [apple tree]
gb|ADD74180.2|  high mobility group box 3 protein                     79.0    7e-14   Gossypium hirsutum [American cotton]
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 77.0    7e-14   Nicotiana tomentosiformis
ref|XP_004246321.1|  PREDICTED: high mobility group B protein 1       79.7    7e-14   Solanum lycopersicum
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           77.4    7e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               77.4    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_009387913.1|  PREDICTED: HMG1/2-like protein isoform X1        79.3    7e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      77.4    8e-14   Nicotiana sylvestris
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    77.0    8e-14   
gb|KCW88103.1|  hypothetical protein EUGRSUZ_A00506                   79.3    8e-14   Eucalyptus grandis [rose gum]
ref|XP_010028985.1|  PREDICTED: high mobility group B protein 1       79.3    8e-14   Eucalyptus grandis [rose gum]
ref|XP_006425283.1|  hypothetical protein CICLE_v10026715mg           79.0    8e-14   Citrus clementina [clementine]
gb|EMS65298.1|  Defensin-like protein 1                               77.4    8e-14   Triticum urartu
ref|XP_010100630.1|  High mobility group B protein 1                  79.0    8e-14   Morus notabilis
dbj|BAK07823.1|  predicted protein                                    77.8    9e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009103331.1|  PREDICTED: high mobility group B protein 3-like  78.6    9e-14   Brassica rapa
ref|XP_007133904.1|  hypothetical protein PHAVU_010G001800g           79.3    9e-14   Phaseolus vulgaris [French bean]
emb|CDY01357.1|  BnaA07g11300D                                        78.6    9e-14   
ref|XP_006366341.1|  PREDICTED: high mobility group B protein 1-l...  79.3    9e-14   Solanum tuberosum [potatoes]
gb|KDO69008.1|  hypothetical protein CISIN_1g029982mg                 78.2    1e-13   Citrus sinensis [apfelsine]
ref|XP_004492431.1|  PREDICTED: high mobility group B protein 1-l...  79.3    1e-13   Cicer arietinum [garbanzo]
gb|AGV54591.1|  high mobility group B protein 1                       79.0    1e-13   Phaseolus vulgaris [French bean]
tpg|DAA62631.1|  TPA: hypothetical protein ZEAMMB73_230922            77.8    1e-13   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 76.6    1e-13   Vernicia fordii [tung oil tree]
gb|KDO69009.1|  hypothetical protein CISIN_1g029982mg                 78.2    1e-13   Citrus sinensis [apfelsine]
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               76.6    1e-13   Solanum lycopersicum
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    76.6    1e-13   Vitis vinifera
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  77.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 76.6    1e-13   Nicotiana sylvestris
gb|EPS64999.1|  hypothetical protein M569_09780                       78.6    1e-13   Genlisea aurea
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               76.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            76.6    1e-13   Solanum tuberosum [potatoes]
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  76.6    1e-13   Helianthus annuus
ref|XP_010088525.1|  Defensin-like protein 2                          76.6    1e-13   Morus notabilis
ref|NP_001148158.1|  LOC100281766 precursor                           76.6    1e-13   
ref|XP_003623293.1|  HMG1/2-like protein                              79.0    1e-13   Medicago truncatula
tpg|DAA62629.1|  TPA: hypothetical protein ZEAMMB73_230922            77.8    1e-13   
ref|XP_002886566.1|  protease inhibitor II                            76.3    1e-13   Arabidopsis lyrata subsp. lyrata
gb|AAM93217.1|AF527616_1  nucleasome/chromatin assembly factor D ...  77.8    1e-13   Zea mays [maize]
tpg|DAA62628.1|  TPA: hypothetical protein ZEAMMB73_230922            77.4    1e-13   
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    76.3    2e-13   Phoenix dactylifera
ref|XP_009588564.1|  PREDICTED: high mobility group B protein 1       78.6    2e-13   Nicotiana tomentosiformis
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           78.2    2e-13   Phaseolus vulgaris [French bean]
gb|AHA50468.1|  defensin-like protein 2                               76.3    2e-13   Citrullus lanatus [wild melon]
gb|AAC50019.1|  high mobility group protein 2 HMG2                    78.2    2e-13   Ipomoea nil [qian niu]
ref|NP_001275787.1|  group B HMG-box protein                          78.6    2e-13   Citrus sinensis [apfelsine]
ref|XP_011074084.1|  PREDICTED: HMG1/2-like protein                   77.8    2e-13   Sesamum indicum [beniseed]
gb|AFK49192.1|  unknown                                               78.6    2e-13   Lotus japonicus
gb|KCW88102.1|  hypothetical protein EUGRSUZ_A00506                   78.6    2e-13   Eucalyptus grandis [rose gum]
ref|NP_001105649.1|  HMG-like nucleosome/chromatin assembly factor D  77.4    2e-13   
ref|XP_009773209.1|  PREDICTED: high mobility group B protein 1       78.2    2e-13   Nicotiana sylvestris
ref|XP_009397968.1|  PREDICTED: HMG1/2-like protein                   77.8    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    75.9    2e-13   Vitis vinifera
ref|XP_011100443.1|  PREDICTED: HMG1/2-like protein                   77.8    2e-13   Sesamum indicum [beniseed]
gb|ADK87340.1|  defensin                                              75.9    2e-13   Pyrus pyrifolia [sha li]
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    75.9    2e-13   Phoenix dactylifera
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               75.9    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_010923050.1|  PREDICTED: high mobility group B protein 1-like  77.8    2e-13   
gb|ABA81896.1|  putative defensin                                     75.5    2e-13   Aquilegia formosa
emb|CAH58740.1|  defensin                                             75.5    2e-13   Plantago major [cart-track plant]
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    75.9    2e-13   Sesamum indicum [beniseed]
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  75.9    3e-13   Petunia integrifolia [violet-flowered petunia]
ref|XP_008651871.1|  PREDICTED: HMG-like nucleosome/chromatin ass...  78.2    3e-13   
gb|AAM62652.1|  protease inhibitor II                                 75.5    3e-13   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA40705.1|  TPA: hypothetical protein ZEAMMB73_374315            76.6    3e-13   
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               75.5    3e-13   Populus euphratica
ref|XP_003630422.1|  Defensin                                         75.5    3e-13   Medicago truncatula
ref|XP_010063137.1|  PREDICTED: high mobility group B protein 3-like  77.0    3e-13   Eucalyptus grandis [rose gum]
gb|ACR37707.1|  unknown                                               76.6    3e-13   Zea mays [maize]
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            74.7    4e-13   Medicago truncatula
gb|KDO69006.1|  hypothetical protein CISIN_1g029982mg                 77.8    4e-13   Citrus sinensis [apfelsine]
ref|XP_010908531.1|  PREDICTED: high mobility group B protein 1-l...  77.4    4e-13   Elaeis guineensis
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    4e-13   Pyrus x bretschneideri [bai li]
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   75.1    4e-13   Torenia fournieri [bluewings]
gb|KDO71476.1|  hypothetical protein CISIN_1g031973mg                 77.0    4e-13   Citrus sinensis [apfelsine]
gb|KEH35661.1|  Defensin                                              75.1    4e-13   Medicago truncatula
ref|XP_008668095.1|  PREDICTED: LOC100284781 isoform X2               77.0    5e-13   
gb|EYU36574.1|  hypothetical protein MIMGU_mgv1a015928mg              76.6    5e-13   
ref|XP_007026725.1|  High mobility group B1 isoform 5                 77.0    5e-13   
gb|KDO69011.1|  hypothetical protein CISIN_1g029982mg                 76.3    5e-13   
gb|EYU36572.1|  hypothetical protein MIMGU_mgv1a015928mg              76.6    5e-13   
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    5e-13   
ref|XP_007026723.1|  High mobility group B1 isoform 3                 77.4    5e-13   
ref|XP_007026722.1|  High mobility group B1 isoform 2                 77.0    5e-13   
ref|XP_012086327.1|  PREDICTED: high mobility group B protein 3-like  76.6    5e-13   
ref|XP_006572804.1|  PREDICTED: uncharacterized protein LOC100305...  77.0    5e-13   
tpg|DAA40704.1|  TPA: hypothetical protein ZEAMMB73_374315            76.6    5e-13   
ref|XP_007026721.1|  High mobility group B1, putative isoform 1       77.4    5e-13   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            74.7    5e-13   
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           74.7    5e-13   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               75.1    5e-13   
ref|NP_178319.1|  defensin-like protein 2                             74.7    5e-13   
ref|XP_009382744.1|  PREDICTED: DNA-binding protein MNB1B             76.6    5e-13   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               75.1    5e-13   
ref|XP_010109616.1|  hypothetical protein L484_015571                 77.0    6e-13   
ref|XP_008668094.1|  PREDICTED: LOC100284781 isoform X1               77.0    6e-13   
gb|KDO71479.1|  hypothetical protein CISIN_1g031973mg                 76.3    6e-13   
gb|KDO69010.1|  hypothetical protein CISIN_1g029982mg                 75.9    6e-13   
ref|XP_002528104.1|  DNA-binding protein MNB1B, putative              77.0    6e-13   
gb|KDO71478.1|  hypothetical protein CISIN_1g031973mg                 76.6    6e-13   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          74.3    6e-13   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    74.3    7e-13   
ref|XP_011654535.1|  PREDICTED: defensin J1-2-like                    74.3    7e-13   
ref|XP_002976963.1|  hypothetical protein SELMODRAFT_175895           76.6    7e-13   
ref|XP_012079607.1|  PREDICTED: defensin-like protein 1               74.3    7e-13   
gb|KCW70329.1|  hypothetical protein EUGRSUZ_F03571                   75.9    7e-13   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  76.3    7e-13   
ref|XP_011462172.1|  PREDICTED: uncharacterized protein LOC105350880  75.9    7e-13   
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               74.3    8e-13   
ref|XP_009803525.1|  PREDICTED: HMG1/2-like protein                   75.9    8e-13   
ref|XP_006855734.1|  PREDICTED: HMG1/2-like protein                   76.3    8e-13   
ref|XP_009418293.1|  PREDICTED: HMG1/2-like protein                   76.3    8e-13   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           74.3    9e-13   
ref|XP_012087872.1|  PREDICTED: high mobility group B protein 1 i...  76.3    9e-13   
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     74.3    9e-13   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           74.3    9e-13   
emb|CAN69975.1|  hypothetical protein VITISV_020776                   73.9    9e-13   
ref|NP_178321.1|  defensin-like protein 1                             74.3    9e-13   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    73.9    9e-13   
gb|ABS72000.1|  putative defensin protein 1                           73.6    1e-12   
ref|XP_006848200.1|  PREDICTED: high mobility group B protein 1       76.3    1e-12   
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           73.9    1e-12   
ref|XP_008812347.1|  PREDICTED: DNA-binding protein MNB1B-like        75.9    1e-12   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               73.9    1e-12   
ref|NP_001031074.1|  high mobility group B2 protein                   75.9    1e-12   
ref|XP_010940219.1|  PREDICTED: DNA-binding protein MNB1B-like        75.9    1e-12   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               73.9    1e-12   
gb|AFK36965.1|  unknown                                               76.3    1e-12   
ref|NP_001235312.1|  uncharacterized protein LOC100499992             75.5    1e-12   
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               73.9    1e-12   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  73.9    1e-12   
gb|ABK21026.1|  unknown                                               75.9    1e-12   
emb|CDY31871.1|  BnaC07g15210D                                        76.3    1e-12   
ref|XP_004512268.1|  PREDICTED: HMG1/2-like protein-like              75.5    1e-12   
gb|KHN38836.1|  HMG1/2-like protein                                   75.5    1e-12   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               73.9    1e-12   
ref|XP_010498507.1|  PREDICTED: high mobility group B protein 2       75.5    1e-12   
ref|NP_001077569.1|  high mobility group B2 protein                   75.5    1e-12   
ref|NP_564123.1|  high mobility group B2 protein                      75.5    1e-12   
gb|EPS69148.1|  hypothetical protein M569_05619                       75.9    1e-12   
ref|XP_012087871.1|  PREDICTED: high mobility group B protein 1 i...  76.3    1e-12   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               73.9    1e-12   
ref|XP_011096978.1|  PREDICTED: HMG1/2-like protein                   75.9    1e-12   
ref|NP_001031075.1|  high mobility group B3 protein                   75.5    1e-12   
gb|EMS67848.1|  HMG1/2-like protein                                   76.3    1e-12   
ref|XP_008781302.1|  PREDICTED: HMG1/2-like protein                   75.9    1e-12   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           73.6    1e-12   
ref|XP_011653690.1|  PREDICTED: high mobility group B protein 1       75.9    1e-12   
ref|NP_001267705.1|  HMG1/2-like protein-like                         75.5    1e-12   
ref|NP_178320.1|  defensin-like protein 4                             73.6    1e-12   
emb|CDP01791.1|  unnamed protein product                              75.5    1e-12   
gb|ADK91098.1|  PCP17C2                                               73.2    1e-12   
ref|XP_010935409.1|  PREDICTED: DNA-binding protein MNB1B-like        75.5    1e-12   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           73.6    1e-12   
ref|XP_008449957.1|  PREDICTED: high mobility group B protein 1       75.9    1e-12   
ref|NP_564124.1|  high mobility group B3 protein                      75.1    2e-12   
ref|NP_001151148.1|  LOC100284781                                     74.7    2e-12   
ref|NP_001077570.1|  high mobility group B3 protein                   75.1    2e-12   
gb|ABA86586.1|  putative defensin 1                                   73.6    2e-12   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 73.6    2e-12   
ref|XP_006304292.1|  hypothetical protein CARUB_v10010586mg           75.1    2e-12   
ref|XP_009804084.1|  PREDICTED: HMG1/2-like protein                   75.1    2e-12   
gb|AHA50472.1|  defensin-like protein 5                               73.6    2e-12   
ref|XP_007205402.1|  hypothetical protein PRUPE_ppa007518mg           78.6    2e-12   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  73.2    2e-12   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        73.2    2e-12   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           73.2    2e-12   
sp|P40619.1|HMGL_IPONI  RecName: Full=HMG1/2-like protein             75.1    2e-12   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  73.2    2e-12   
ref|XP_004500864.1|  PREDICTED: HMG1/2-like protein-like isoform X4   75.1    2e-12   
gb|ADO34793.1|  high mobility group box 2 protein                     74.7    2e-12   
gb|KJB29491.1|  hypothetical protein B456_005G114500                  74.7    2e-12   
ref|XP_002316220.1|  hypothetical protein POPTR_0010s19720g           75.5    2e-12   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           73.2    2e-12   
dbj|BAJ33881.1|  unnamed protein product                              74.7    2e-12   
gb|ADQ43196.1|  unknown                                               73.2    2e-12   
ref|XP_006303878.1|  hypothetical protein CARUB_v10012681mg           74.7    2e-12   
ref|NP_001235556.1|  uncharacterized protein LOC100305961             75.1    2e-12   
ref|XP_004500862.1|  PREDICTED: HMG1/2-like protein-like isoform X2   75.1    2e-12   
ref|XP_007009011.1|  High mobility group B1 isoform 2                 75.1    2e-12   
ref|XP_010477319.1|  PREDICTED: high mobility group B protein 3-like  74.7    2e-12   
ref|XP_010253860.1|  PREDICTED: high mobility group B protein 1-l...  75.1    2e-12   
gb|EMT03365.1|  Defensin-like protein 1                               73.2    2e-12   
gb|AIA67010.1|  defensin                                              73.2    2e-12   
ref|XP_002270185.1|  PREDICTED: high mobility group B protein 1 i...  74.7    2e-12   
gb|ABV48883.1|  high mobility group protein B1                        75.9    2e-12   
ref|NP_001063869.1|  Os09g0551600                                     73.9    3e-12   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           72.8    3e-12   
ref|XP_004500863.1|  PREDICTED: HMG1/2-like protein-like isoform X3   74.7    3e-12   
ref|XP_002890402.1|  hypothetical protein ARALYDRAFT_472304           74.3    3e-12   
ref|XP_009759477.1|  PREDICTED: HMG1/2-like protein                   74.3    3e-12   
gb|KJB36899.1|  hypothetical protein B456_006G181900                  74.3    3e-12   
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  72.4    3e-12   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            72.8    3e-12   
ref|XP_004500861.1|  PREDICTED: HMG1/2-like protein-like isoform X1   75.1    3e-12   
gb|AEX55234.1|  HMG transcription factor                              73.6    3e-12   
gb|KJB12028.1|  hypothetical protein B456_002G263800                  75.1    3e-12   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               72.4    3e-12   
ref|XP_002269398.1|  PREDICTED: high mobility group B protein 1 i...  74.7    3e-12   
gb|ADO34794.1|  high mobility group box 4 protein                     74.3    3e-12   
ref|XP_011035966.1|  PREDICTED: high mobility group B protein 1       75.1    3e-12   
ref|XP_008779789.1|  PREDICTED: high mobility group B protein 1-like  73.6    3e-12   
ref|XP_002279947.2|  PREDICTED: high mobility group B protein 1 i...  74.7    3e-12   
ref|XP_010550497.1|  PREDICTED: high mobility group B protein 4-like  74.3    3e-12   
emb|CDY33643.1|  BnaC08g19430D                                        74.3    3e-12   
ref|XP_009589000.1|  PREDICTED: HMG1/2-like protein                   73.9    3e-12   
ref|XP_010654160.1|  PREDICTED: high mobility group B protein 1 i...  74.7    3e-12   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               72.4    3e-12   
gb|KJB36900.1|  hypothetical protein B456_006G181900                  74.3    3e-12   
ref|XP_004953412.1|  PREDICTED: HMG1/2-like protein-like              74.3    4e-12   
gb|KHN09675.1|  Defensin-like protein                                 72.0    4e-12   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  72.4    4e-12   
gb|KHN38869.1|  HMG1/2-like protein                                   73.9    4e-12   
gb|EMT15409.1|  HMG1/2-like protein                                   73.9    4e-12   
gb|KHG02391.1|  High mobility group B 1 -like protein                 74.3    4e-12   
gb|KJB29495.1|  hypothetical protein B456_005G114500                  75.1    4e-12   
ref|XP_003578598.1|  PREDICTED: HMG1/2-like protein                   73.6    4e-12   
gb|KJB29494.1|  hypothetical protein B456_005G114500                  75.1    4e-12   
ref|XP_006364026.1|  PREDICTED: HMG1/2-like protein-like              73.2    4e-12   
ref|XP_004234511.1|  PREDICTED: HMG1/2-like protein                   73.9    4e-12   
ref|XP_004957577.1|  PREDICTED: HMG1/2-like protein-like              73.6    4e-12   
ref|XP_009590625.1|  PREDICTED: HMG1/2-like protein                   73.9    4e-12   
ref|XP_006343329.1|  PREDICTED: HMG1/2-like protein-like              73.6    5e-12   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    72.0    5e-12   
ref|XP_006416372.1|  hypothetical protein EUTSA_v10009371mg           74.7    5e-12   
gb|ABA86587.1|  putative defensin 1                                   72.0    5e-12   
gb|AHA50470.1|  defensin-like protein 1                               72.0    5e-12   
gb|KJB30731.1|  hypothetical protein B456_005G157500                  72.0    5e-12   
ref|XP_010477318.1|  PREDICTED: high mobility group B protein 2-like  73.9    5e-12   
gb|KJB29493.1|  hypothetical protein B456_005G114500                  74.7    5e-12   
emb|CDY65900.1|  BnaCnng49050D                                        73.6    5e-12   
ref|XP_009110216.1|  PREDICTED: high mobility group B protein 2       73.6    6e-12   
ref|XP_010253859.1|  PREDICTED: high mobility group B protein 1-l...  74.7    6e-12   
gb|ABA86589.1|  putative defensin 1                                   71.6    6e-12   
gb|AGT51227.1|  defensin                                              71.6    6e-12   
emb|CDX96626.1|  BnaA08g21690D                                        73.6    7e-12   
ref|XP_001766891.1|  predicted protein                                73.6    7e-12   
gb|KJB10396.1|  hypothetical protein B456_001G198900                  72.0    7e-12   
ref|XP_006660948.1|  PREDICTED: HMG1/2-like protein-like              72.8    7e-12   
ref|XP_009597873.1|  PREDICTED: HMG1/2-like protein                   73.2    7e-12   
ref|XP_004145545.1|  PREDICTED: HMG1/2-like protein                   73.2    7e-12   
ref|XP_003599384.1|  Defensin                                         71.6    7e-12   
emb|CDY48618.1|  BnaC09g20670D                                        71.6    8e-12   
ref|XP_008452974.1|  PREDICTED: HMG1/2-like protein isoform X2        73.2    8e-12   
ref|XP_008452973.1|  PREDICTED: HMG1/2-like protein isoform X1        73.2    8e-12   
ref|XP_009794035.1|  PREDICTED: HMG1/2-like protein                   73.2    8e-12   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  71.6    8e-12   
ref|XP_004512267.1|  PREDICTED: HMG1/2-like protein-like              74.3    8e-12   
ref|XP_008776662.1|  PREDICTED: high mobility group B protein 1       73.6    8e-12   
ref|XP_007156239.1|  hypothetical protein PHAVU_003G270000g           73.2    8e-12   
ref|XP_004287727.1|  PREDICTED: HMG1/2-like protein                   73.2    9e-12   
ref|XP_002979815.1|  hypothetical protein SELMODRAFT_18312            71.6    9e-12   
gb|KJB57948.1|  hypothetical protein B456_009G186800                  73.2    9e-12   
gb|ABV48884.1|  high mobility group protein B2                        73.6    9e-12   
ref|XP_010271821.1|  PREDICTED: HMG1/2-like protein                   73.2    9e-12   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  71.2    9e-12   
ref|XP_001768855.1|  predicted protein                                72.0    1e-11   
ref|XP_010267869.1|  PREDICTED: high mobility group B protein 3-like  73.2    1e-11   
ref|XP_010069611.1|  PREDICTED: high mobility group B protein 3-like  72.8    1e-11   
gb|AHA50471.1|  defensin-like protein 4                               71.2    1e-11   
ref|XP_007202726.1|  hypothetical protein PRUPE_ppa012972mg           72.4    1e-11   
ref|XP_009149548.1|  PREDICTED: high mobility group B protein 3-like  72.8    1e-11   
ref|XP_001780376.1|  predicted protein                                73.9    1e-11   
gb|AET87126.1|  high mobility group B2 protein                        72.8    1e-11   
ref|XP_007202727.1|  hypothetical protein PRUPE_ppa012972mg           72.8    1e-11   
gb|KHG26324.1|  High mobility group B 3 -like protein                 72.8    1e-11   
dbj|BAB09558.1|  unnamed protein product                              73.9    1e-11   
gb|AFE88173.1|  g-thionin                                             70.9    1e-11   
emb|CDY29512.1|  BnaA06g14580D                                        72.4    1e-11   
ref|XP_010266190.1|  PREDICTED: HMG1/2-like protein                   72.8    1e-11   
ref|XP_008241942.1|  PREDICTED: HMG1/2-like protein isoform X2        72.4    1e-11   
gb|EMS48945.1|  High mobility group B protein 4                       72.4    1e-11   
gb|KJB57949.1|  hypothetical protein B456_009G186800                  73.6    1e-11   
ref|XP_007202584.1|  hypothetical protein PRUPE_ppa011596mg           72.0    1e-11   
emb|CDP06494.1|  unnamed protein product                              73.2    1e-11   
ref|XP_009115889.1|  PREDICTED: high mobility group B protein 1-like  73.2    1e-11   
gb|AIX10954.1|  high mobility group B protein                         72.8    1e-11   
ref|XP_001777538.1|  predicted protein                                75.1    1e-11   
gb|ABK25570.1|  unknown                                               72.8    1e-11   
gb|AGT51228.1|  defensin                                              70.9    1e-11   
ref|XP_009359590.1|  PREDICTED: high mobility group B protein 3-like  72.4    1e-11   
ref|XP_002960644.1|  hypothetical protein SELMODRAFT_75453            72.4    1e-11   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               70.9    1e-11   
ref|XP_004966522.1|  PREDICTED: DNA-binding protein MNB1B-like        72.8    2e-11   
gb|KJB11914.1|  hypothetical protein B456_002G029700                  70.9    2e-11   
gb|KJB11913.1|  hypothetical protein B456_002G029700                  70.9    2e-11   
emb|CDX78045.1|  BnaA09g32400D                                        72.8    2e-11   
ref|XP_008361330.1|  PREDICTED: high mobility group B protein 3-like  72.4    2e-11   
gb|AHA50473.1|  defensin-like protein 6                               70.5    2e-11   
ref|XP_010557429.1|  PREDICTED: high mobility group B protein 4-like  72.0    2e-11   
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  70.5    2e-11   
ref|XP_002983394.1|  hypothetical protein SELMODRAFT_117986           71.6    2e-11   
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              70.5    2e-11   
ref|XP_011044288.1|  PREDICTED: high mobility group B protein 1-like  72.8    2e-11   
gb|EYU18232.1|  hypothetical protein MIMGU_mgv1a015502mg              72.4    2e-11   
ref|NP_001235499.1|  uncharacterized protein LOC100305957             72.0    2e-11   
gb|EPS70747.1|  high mobility group family                            72.4    2e-11   



>ref|XP_009797250.1| PREDICTED: high mobility group B protein 7-like [Nicotiana sylvestris]
Length=203

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 5/151 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            RVRKRVEV     S   ASLKRAKDGSAFARC+ECNKDVP+ALI+FH+CSLDAKIKMNLE
Sbjct  15   RVRKRVEV----VSATAASLKRAKDGSAFARCEECNKDVPIALINFHSCSLDAKIKMNLE  70

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++ + A   KKP  K K +STEPKAK+EKKAK+PNAPKRPPTAFFVFM+EFR+TFK  
Sbjct  71   AQVV-ENASETKKPAAKGKEKSTEPKAKREKKAKNPNAPKRPPTAFFVFMDEFRQTFKAA  129

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            NPD KSV+ VAKEGGEKWKSLTDEEKK Y D
Sbjct  130  NPDCKSVSMVAKEGGEKWKSLTDEEKKPYQD  160



>ref|XP_009630975.1| PREDICTED: high mobility group B protein 7-like [Nicotiana tomentosiformis]
Length=223

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 5/151 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            RVRKRVEV+S  +    ASLKRAKDGSAFARC+ECNKDVP+ALI+FH+CSLDAKIKMNLE
Sbjct  15   RVRKRVEVESATA----ASLKRAKDGSAFARCEECNKDVPIALINFHSCSLDAKIKMNLE  70

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++ + A   KKP  K K + TEPKAK+EKKAK+PNAPKRPPTAFFVFM+EFR+TFK  
Sbjct  71   AQVV-ENASETKKPASKSKEKLTEPKAKREKKAKNPNAPKRPPTAFFVFMDEFRQTFKAA  129

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            NPD KSV+TVAKEGGEKWKS+TDEEKK Y D
Sbjct  130  NPDCKSVSTVAKEGGEKWKSMTDEEKKPYQD  160



>ref|XP_004236870.1| PREDICTED: high mobility group B protein 7 [Solanum lycopersicum]
Length=215

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 4/149 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            RVRKRVEV+S  S+   ASLKRAKDGSAFARC+EC+KDVP+ALISFHNCSLDAKIKMNLE
Sbjct  17   RVRKRVEVESAASA---ASLKRAKDGSAFARCEECSKDVPIALISFHNCSLDAKIKMNLE  73

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++ +     KKP  K K +STEPKAK+EKK K+PNAPKRPP+AFFVFM +FR+ FK  
Sbjct  74   AQVV-ENQTEVKKPAAKSKEKSTEPKAKREKKPKNPNAPKRPPSAFFVFMNDFRQEFKAA  132

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            NPD KSV+ VAKEGGEKWKS+TDEEKK Y
Sbjct  133  NPDCKSVSMVAKEGGEKWKSMTDEEKKPY  161



>ref|XP_011070479.1| PREDICTED: high mobility group B protein 7-like [Sesamum indicum]
Length=210

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 128/152 (84%), Gaps = 5/152 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R+RKRV       S  +++LKRAKDGSAFA+C+ECNKDVPVALISFHNCSLDAKIKMNLE
Sbjct  8    RLRKRV----EAESSSSSALKRAKDGSAFAKCEECNKDVPVALISFHNCSLDAKIKMNLE  63

Query  572  AQIIek-paepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKE  396
            AQI+E      KK   EK+K + TEP+ KKEKKAK+PNAPKRPPTAFFVFMEEFRK+FKE
Sbjct  64   AQIVEMPSEAKKKSAPEKKKTKQTEPRVKKEKKAKNPNAPKRPPTAFFVFMEEFRKSFKE  123

Query  395  ENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
             NP+ KSVA VAKEGGEKWKS+TDE+KK+YID
Sbjct  124  ANPECKSVAMVAKEGGEKWKSMTDEDKKVYID  155



>ref|XP_006360847.1| PREDICTED: high mobility group B protein 7-like [Solanum tuberosum]
Length=215

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 4/149 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            RVRKRV     ES+   ASLKRAKDGSAFARC+EC+KDVP+ALISFHNCSLDAKIKMNLE
Sbjct  17   RVRKRV---EVESAAAAASLKRAKDGSAFARCEECSKDVPIALISFHNCSLDAKIKMNLE  73

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++ +     KKP  K + +STEPKAK+EKK K+PNAPKRPPTAFFVFM++FR+ FK  
Sbjct  74   AQVV-ENQTEVKKPAAKSREKSTEPKAKREKKPKNPNAPKRPPTAFFVFMDDFRQEFKAA  132

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            NPD KSV+TVAKEGGEKWKS+TDEEKK Y
Sbjct  133  NPDCKSVSTVAKEGGEKWKSMTDEEKKPY  161



>gb|EYU35548.1| hypothetical protein MIMGU_mgv1a012961mg [Erythranthe guttata]
Length=234

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R+RKRVEVD++ SS    +LKRA+DGSAFA+C+ECNKDVPVALISFHNCSLDAKIKMNLE
Sbjct  13   RLRKRVEVDTD-SSATTMALKRARDGSAFAKCEECNKDVPVALISFHNCSLDAKIKMNLE  71

Query  572  AQIIekpaepkk--kptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            +Q++E  +E KK   P +++  ++    +KK KKAKDPNAPKRP TAFF+FME+FRK+FK
Sbjct  72   SQVVEMASEAKKKPAPQKRKANQTQSTSSKKTKKAKDPNAPKRPATAFFIFMEDFRKSFK  131

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NPD K  + VAKEGGEKWKSLT+EE+++Y D
Sbjct  132  EANPDNKRGSEVAKEGGEKWKSLTEEERQVYRD  164



>ref|XP_010248937.1| PREDICTED: high mobility group B protein 7-like [Nelumbo nucifera]
Length=195

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 118/155 (76%), Gaps = 10/155 (6%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRVEV+        ++LKRAKDGSAF RC+ECNKDVPV LI  H+CSLD+KIKMNL
Sbjct  10   PRARKRVEVE-------KSTLKRAKDGSAFTRCEECNKDVPVVLIDMHSCSLDSKIKMNL  62

Query  575  EAQIIekpaepkkkptekekARSTEpkakkekkakdpna---pKRPPTAFFVFMEEFRKT  405
            +AQ++E+  E  K   +K KA S+EPK KK KK K       PKRPPTAFFVFMEEFRK 
Sbjct  63   DAQVVERVTEVNKPTEKKRKAVSSEPKTKKSKKEKKVKDPNIPKRPPTAFFVFMEEFRKV  122

Query  404  FKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +KEE+PD K+V+ V+KE GEKWKS++DEEKK Y+D
Sbjct  123  YKEEHPDNKNVSVVSKEAGEKWKSMSDEEKKPYLD  157



>ref|XP_011031229.1| PREDICTED: high mobility group B protein 7-like [Populus euphratica]
Length=194

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = -1

Query  749  VRKRVEVDSNESS---QINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMN  579
             +KRVE +S + S       SL RAKDGSAFA+C+EC KDVPVALISFH+CSLDAKIKMN
Sbjct  2    AKKRVEAESTDGSVDANTTTSLVRAKDGSAFAKCEECKKDVPVALISFHSCSLDAKIKMN  61

Query  578  LEAQIIekpaepkkkptekekARSTEpkakkekkak---dpnapKRPPTAFFVFMEEFRK  408
            LEAQ++EKP E K+KP E++K  STEPK KK KK K   DPNAPKRPPTAFF+FM++FRK
Sbjct  62   LEAQVVEKPTEAKQKPAERKKGSSTEPKLKKAKKEKKGRDPNAPKRPPTAFFLFMDDFRK  121

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
             +KE NPD K V  VAKEGG +WKS+TDEEKK Y+D+AAE KAEY+KALES+NA
Sbjct  122  EYKEANPDSKDVKKVAKEGGVRWKSMTDEEKKQYVDKAAELKAEYDKALESDNA  175



>ref|XP_002310906.2| hypothetical protein POPTR_0007s15320g [Populus trichocarpa]
 gb|EEE91356.2| hypothetical protein POPTR_0007s15320g [Populus trichocarpa]
Length=201

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 6/174 (3%)
 Frame = -1

Query  749  VRKRVEVDSNESS---QINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMN  579
             RKRVE +S + S       SL RAKDGSAF +C+EC KDVPVALISFH+CSLDAKIKMN
Sbjct  2    ARKRVEAESTDGSVDANTTTSLVRAKDGSAFTKCEECKKDVPVALISFHSCSLDAKIKMN  61

Query  578  LEAQIIekpaepkkkptekekARSTEpkakkekkak---dpnapKRPPTAFFVFMEEFRK  408
            LEAQ++EKP E K+KP E++K  STEPK KK KK K   DPNA KRPPTAFF+FM++FRK
Sbjct  62   LEAQVVEKPTEAKQKPAERKKGSSTEPKLKKAKKEKKGRDPNASKRPPTAFFLFMDDFRK  121

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
             +KE NPD K V  VAKEGG +WKS+TDEEKK Y+D+AAE KAE +KALES+NA
Sbjct  122  EYKEANPDSKDVKKVAKEGGVRWKSMTDEEKKQYVDKAAELKAENDKALESDNA  175



>gb|ABK93630.1| unknown [Populus trichocarpa]
Length=201

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = -1

Query  749  VRKRVEVDSNESS---QINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMN  579
             RKRVE +S + S       SL RAKDGSAF +C+EC KDVPVALISFH+CSLDAKIKMN
Sbjct  2    ARKRVEAESTDGSVDANTTTSLVRAKDGSAFTKCEECKKDVPVALISFHSCSLDAKIKMN  61

Query  578  LEAQIIekpaepkkkptekekARSTEpkakkekkak---dpnapKRPPTAFFVFMEEFRK  408
            LEAQ++EKP E K+KP E++K  STEPK KK KK K   DPNAPKRPPTAFF+FM++FRK
Sbjct  62   LEAQVVEKPTEAKQKPAERKKGSSTEPKLKKAKKEKKGRDPNAPKRPPTAFFLFMDDFRK  121

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
             +KE NPD K V  VAKEGG +WKS+TDEEKK Y+D+AAE KAE +KALES+NA
Sbjct  122  EYKEANPDSKDVKKVAKEGGVRWKSMTDEEKKQYVDKAAELKAENDKALESDNA  175



>ref|XP_010034169.1| PREDICTED: high mobility group B protein 7 [Eucalyptus grandis]
 gb|KCW50636.1| hypothetical protein EUGRSUZ_J00336 [Eucalyptus grandis]
Length=245

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 118/158 (75%), Gaps = 7/158 (4%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVEVD+  ++  ++SL R KDGSAFARC+ECNKDVPVALIS H+C LDAKIKMNL
Sbjct  12   PKARKRVEVDAAAAAAASSSLVRGKDGSAFARCEECNKDVPVALISMHSCGLDAKIKMNL  71

Query  575  EAQIIekpaepkkkptekekARSTE------pkakkekkakdpnapKRPPTAFFVFMEEF  414
            EAQ++ +     KK    ++ RS+E         KK KK KD NAPKRP TAFFVFM++F
Sbjct  72   EAQVM-ERPAEAKKKPAVDRKRSSEPKAKKAKTEKKSKKGKDANAPKRPATAFFVFMDDF  130

Query  413  RKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RK +KE NPD K V  VAK+GGEKWKS++DEEKK Y+D
Sbjct  131  RKAYKEANPDSKGVKEVAKQGGEKWKSMSDEEKKPYLD  168



>ref|XP_004150195.1| PREDICTED: high mobility group B protein 7 [Cucumis sativus]
Length=207

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 124/174 (71%), Gaps = 5/174 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            + RKRVE    + +    SL RAKDGSAFARCDEC K VPVALIS H+CSLDAKI+MNLE
Sbjct  8    KSRKRVEATPADVAATGPSLVRAKDGSAFARCDECGKSVPVALISMHSCSLDAKIRMNLE  67

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpn-----apKRPPTAFFVFMEEFRK  408
            +Q +EK  + KK   +K  A S     K   + K        APKRPPTAFF+FM++FRK
Sbjct  68   SQTVEKQTQSKKPAEKKRSASSEPKTKKSRTEKKGKKDKDPNAPKRPPTAFFIFMDDFRK  127

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNA  246
            ++KE NPD K V  VAKEGGEKWKS+TDEEKK Y D+AAE KAEYEKALES NA
Sbjct  128  SYKEANPDSKGVKEVAKEGGEKWKSMTDEEKKPYQDKAAELKAEYEKALESRNA  181



>ref|XP_010103584.1| High mobility group B protein 7 [Morus notabilis]
 gb|EXB96361.1| High mobility group B protein 7 [Morus notabilis]
Length=209

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 119/157 (76%), Gaps = 11/157 (7%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            + RKRVE  S ES+   ASL R KDGSAFARC+EC+KDVPVALISFH+CSLDAKIKMNLE
Sbjct  12   KTRKRVEA-SQESTA--ASLVRGKDGSAFARCEECSKDVPVALISFHSCSLDAKIKMNLE  68

Query  572  AQIIekpaepkkkptekekARSTE------pkakkekkakdpnapKRPPTAFFVFMEEFR  411
            AQ++EKP+E  K   +K    STE         KK KK KDPN PKRPPTAFF+FM++FR
Sbjct  69   AQVVEKPSETNKPEKKKSS--STEPKLKKSKVEKKGKKGKDPNKPKRPPTAFFLFMDDFR  126

Query  410  KTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            K FKE NPD K V  VAKEGGEKW SL+DEEKK+Y D
Sbjct  127  KEFKEANPDSKDVKKVAKEGGEKWNSLSDEEKKVYQD  163



>ref|XP_007043200.1| High-mobility group box 6 [Theobroma cacao]
 gb|EOX99031.1| High-mobility group box 6 [Theobroma cacao]
Length=210

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 127/155 (82%), Gaps = 5/155 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV  D+  ++   +SL RAKDGSAFA+C+ECNK VPVALIS H+CSLDAKIKMNL
Sbjct  10   PKPRKRV--DAASTAAPASSLVRAKDGSAFAKCEECNKTVPVALISMHSCSLDAKIKMNL  67

Query  575  EAQIIekpaepkkkptekekARSTEp---kakkekkakdpnapKRPPTAFFVFMEEFRKT  405
            EAQ+IEKPAE KKKP E++K  STE    K KK KK KDPNAPKRPPTAFF+FM++FRK+
Sbjct  68   EAQVIEKPAEVKKKPAERKKPASTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRKS  127

Query  404  FKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +KE NPD K V  VAKEGGEKWKS+++EEKK Y+D
Sbjct  128  YKEANPDAKGVTGVAKEGGEKWKSMSEEEKKPYVD  162



>ref|XP_002267697.2| PREDICTED: high mobility group B protein 7 [Vitis vinifera]
 emb|CAN61363.1| hypothetical protein VITISV_034306 [Vitis vinifera]
 emb|CBI35359.3| unnamed protein product [Vitis vinifera]
Length=190

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 120/155 (77%), Gaps = 10/155 (6%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE ++       +SLKRA+DGSAF RC+EC KDVPV LI  H+CSL+AKIK+NL
Sbjct  4    PKQRKRVEAET-------SSLKRARDGSAFIRCEECKKDVPVVLIDMHSCSLEAKIKLNL  56

Query  575  EAQIIekpaepkkkptekekARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKT  405
            EAQ++EK  + KKKP EK+ A +TEPK KK ++ +       PKRPPTAFF+FM++FRK 
Sbjct  57   EAQVVEKVTDVKKKPAEKKNATTTEPKPKKSRRLRKVKDPNMPKRPPTAFFLFMDDFRKE  116

Query  404  FKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +KE NPD K+V+ VAKEGGEKWKS+TDEEKK Y+D
Sbjct  117  YKESNPDSKNVSVVAKEGGEKWKSMTDEEKKPYVD  151



>ref|XP_008810905.1| PREDICTED: high mobility group B protein 7-like [Phoenix dactylifera]
Length=197

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 118/154 (77%), Gaps = 9/154 (6%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRVE ++N       +LKRA+DGSAF RC+ CNKDVPV LI  H+CSLD+KI+M+L
Sbjct  11   PRARKRVEAETN-------TLKRARDGSAFTRCEACNKDVPVVLIDMHSCSLDSKIRMSL  63

Query  575  EAQIIekpae--pkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTF  402
            EAQ++EK AE     +      A   E K KKEKK+KDP APKRPPTAFF+FM++FRK +
Sbjct  64   EAQVVEKAAEVNKPVERKRAAPAERKERKGKKEKKSKDPKAPKRPPTAFFLFMDDFRKQY  123

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD KSVATVAKEGGEKWKS+TDEE+K Y+D
Sbjct  124  KEAHPDSKSVATVAKEGGEKWKSMTDEERKPYLD  157



>ref|XP_006448478.1| hypothetical protein CICLE_v10016587mg [Citrus clementina]
 gb|ESR61718.1| hypothetical protein CICLE_v10016587mg [Citrus clementina]
Length=224

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV  D+  +S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNL
Sbjct  10   PKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNL  67

Query  575  EAQIIekpae-pkkkptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTF  402
            EAQ++EKPAE  KKKP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +
Sbjct  68   EAQVVEKPAEINKKKPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEY  127

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD K V  VAKE GEKWK++TDEEKK Y+D
Sbjct  128  KEAHPDSKGVTGVAKEAGEKWKNMTDEEKKPYLD  161



>ref|XP_006468697.1| PREDICTED: high mobility group B protein 7-like [Citrus sinensis]
Length=224

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV  D+  +S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNL
Sbjct  10   PKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNL  67

Query  575  EAQIIekpae-pkkkptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTF  402
            EAQ++EKPAE  KKKP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +
Sbjct  68   EAQVVEKPAEINKKKPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEY  127

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD K V  VAKE GEKWK++TDEEKK Y+D
Sbjct  128  KEAHPDSKGVTGVAKEAGEKWKNMTDEEKKPYLD  161



>gb|KDO77000.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
 gb|KDO77001.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
 gb|KDO77002.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
Length=232

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV  D+  +S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNL
Sbjct  10   PKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNL  67

Query  575  EAQIIekpae-pkkkptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTF  402
            EAQ++EKPAE  KKKP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +
Sbjct  68   EAQVVEKPAEINKKKPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEY  127

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD K V  VAKE GEKWK++TDEEKK Y+D
Sbjct  128  KEAHPDSKGVTGVAKEAGEKWKNMTDEEKKPYLD  161



>gb|KDO77003.1| hypothetical protein CISIN_1g026850mg [Citrus sinensis]
Length=220

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV  D+  +S  +A+L R +DGSAFARC+ECNK+VPVALIS H+CSLDAKIKMNL
Sbjct  10   PKPRKRV--DAQSASTSSATLMRGRDGSAFARCEECNKNVPVALISMHSCSLDAKIKMNL  67

Query  575  EAQIIekpae-pkkkptekekARSTEpkakk-ekkakdpnapKRPPTAFFVFMEEFRKTF  402
            EAQ++EKPAE  KKKP E++K  STEP+AK+  KK  D N PKRPPTAFF+FM++FRK +
Sbjct  68   EAQVVEKPAEINKKKPAERKKPTSTEPRAKRLRKKDSDSNKPKRPPTAFFLFMDDFRKEY  127

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD K V  VAKE GEKWK++TDEEKK Y+D
Sbjct  128  KEAHPDSKGVTGVAKEAGEKWKNMTDEEKKPYLD  161



>gb|KJB49541.1| hypothetical protein B456_008G147700 [Gossypium raimondii]
Length=214

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 125/156 (80%), Gaps = 4/156 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV+  S  +    +SL RAKDGSAFA+CDECNK VPVALI+ H+CSL+AKIKMNL
Sbjct  10   PKPRKRVDAASAPAPAPASSLVRAKDGSAFAKCDECNKTVPVALINMHSCSLEAKIKMNL  69

Query  575  EAQIIekpaepkkkptekekARST----EpkakkekkakdpnapKRPPTAFFVFMEEFRK  408
            E+Q+IEKPAE KKKP E++K  +T      K KK KK KDPNAPKRPPTAFF+FM++FRK
Sbjct  70   ESQVIEKPAEAKKKPAERKKPPTTTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRK  129

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            ++KE NPD K V  VAKEGGEKWKS+++EEKK Y+D
Sbjct  130  SYKEANPDAKGVTGVAKEGGEKWKSMSEEEKKCYVD  165



>emb|CDP16974.1| unnamed protein product [Coffea canephora]
Length=212

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 14/165 (8%)
 Frame = -1

Query  752  RVRKRVEVDSNE--------------SSQINASLKRAKDGSAFARCDECNKDVPVALISF  615
            R+RKRVEV+ N               ++  +++L RAKDGSAF +C ECNKDV VALIS 
Sbjct  5    RLRKRVEVEKNSSSSSTSPAASGKSNTTASSSTLLRAKDGSAFTKCGECNKDVAVALISM  64

Query  614  HNCSLDAKIKMNLEAQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAF  435
            H+CS +AKIKMNLEAQ++EK AE KKKP EK KA++ EPKAKK KKAK+PNA KRPPTAF
Sbjct  65   HDCSTEAKIKMNLEAQVVEKAAELKKKPAEKRKAKAAEPKAKKGKKAKNPNALKRPPTAF  124

Query  434  FVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            F+FM++FRK+FKE NPD KSV+ VAKEGGEKWKS+T+EEK+ Y+D
Sbjct  125  FIFMDDFRKSFKEANPDCKSVSVVAKEGGEKWKSMTEEEKQPYVD  169



>ref|XP_008389062.1| PREDICTED: high mobility group B protein 7-like [Malus domestica]
Length=217

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 112/158 (71%), Gaps = 7/158 (4%)
 Frame = -1

Query  752  RVRKRVE---VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKM  582
            + R+RVE      N  S +  SL R KDGSAFARC+ECNKDVPVALIS H+CSLDAKIK+
Sbjct  12   KARRRVEATETGENSLSTVPPSLVRGKDGSAFARCEECNKDVPVALISMHSCSLDAKIKL  71

Query  581  NLEAQIIekpaepkkkptekekARSTEpkakkekkakdpn----apKRPPTAFFVFMEEF  414
            NL+AQ++EKP E K+K     K  +T     K  K    +    APKRP TAFF+FM++F
Sbjct  72   NLKAQVVEKPPEVKRKLPADRKRSTTTTSQPKTSKRAKKDKDPNAPKRPLTAFFLFMDDF  131

Query  413  RKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RK++KE NPD K V  VAKEGGEKWKS+TDEEKK Y+D
Sbjct  132  RKSYKEANPDSKGVKMVAKEGGEKWKSMTDEEKKPYVD  169



>gb|KHG07657.1| High mobility group B 7 -like protein [Gossypium arboreum]
Length=214

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 125/156 (80%), Gaps = 4/156 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV+  S  +    +SL RAKDGSAFA+CDECNK VP+ALI+ H+CSL+AKIKMNL
Sbjct  10   PKPRKRVDAASAPAPAPASSLVRAKDGSAFAKCDECNKTVPMALINMHSCSLEAKIKMNL  69

Query  575  EAQIIekpaepkkkptekekARST----EpkakkekkakdpnapKRPPTAFFVFMEEFRK  408
            E+Q+IEKPAE KKKP E++K  +T      K KK KK KDPNAPKRPPTAFF+FM++FRK
Sbjct  70   ESQVIEKPAEAKKKPAERKKPPATTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRK  129

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            ++KE NPD K V  VAKEGGEKWKS+++EEKK Y+D
Sbjct  130  SYKEANPDAKGVTGVAKEGGEKWKSMSEEEKKCYVD  165



>ref|XP_007224613.1| hypothetical protein PRUPE_ppa026912mg [Prunus persica]
 gb|EMJ25812.1| hypothetical protein PRUPE_ppa026912mg [Prunus persica]
Length=197

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 4/151 (3%)
 Frame = -1

Query  749  VRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
             RKRVE  + E S +  SL R KDGSAFARC+ECNK+VPVALIS H+CSLDAKIK++L +
Sbjct  2    ARKRVE--ATEESSV-PSLVRGKDGSAFARCEECNKNVPVALISMHSCSLDAKIKLHLSS  58

Query  569  QIIekpaepkkkptekekARST-EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            Q++E+  E  KK   + K  +T EPK+K+ KK KDPNAPKRP TAFF+FM++FRK+FKE 
Sbjct  59   QVVERQPEANKKSPTERKRSTTSEPKSKRAKKDKDPNAPKRPLTAFFLFMDDFRKSFKEA  118

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            NPD K V TVAKEGGEKWKS+TDEEKK Y+D
Sbjct  119  NPDSKLVKTVAKEGGEKWKSMTDEEKKPYVD  149



>ref|XP_010546256.1| PREDICTED: high mobility group B protein 7 [Tarenaya hassleriana]
Length=233

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 124/158 (78%), Gaps = 9/158 (6%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE +S  +S  +++L RAKDGSAFARC+EC +DVPVALIS H+CSLDAKIKMNL
Sbjct  11   PKPRKRVEAESANAS--SSTLLRAKDGSAFARCEECKRDVPVALISMHSCSLDAKIKMNL  68

Query  575  EAQIIekpaepkkkptekekARSTEpkakk------ekkakdpnapKRPPTAFFVFMEEF  414
            EAQ++E  AEPKKKP E++K  S EPK K+      EKK+   N PKRP TAFF+F+++F
Sbjct  69   EAQVVELQAEPKKKPAERKKPTSDEPKPKRLRKLKDEKKSSASNKPKRPLTAFFLFLDDF  128

Query  413  RKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RKTFKEENP   SV  VAK+GGEKWKS+TDEEKK Y D
Sbjct  129  RKTFKEENPG-SSVKDVAKQGGEKWKSMTDEEKKPYTD  165



>ref|XP_008221094.1| PREDICTED: high mobility group B protein 7-like [Prunus mume]
Length=206

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            + RKRVE  + E S +  SL R KDGSAFARC+ECNK+VPVALIS H+CSLDAKIK++L 
Sbjct  12   KARKRVE--ATEESSV-PSLVRGKDGSAFARCEECNKNVPVALISMHSCSLDAKIKLHLS  68

Query  572  AQIIekpaepkkkptekekARST-EpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKE  396
            +Q++E+P E  KK   + K  +T EPK+KK KK KDPNAPKRP TAFF+FM++FRK+FKE
Sbjct  69   SQVVERPPEANKKSPTERKRSTTSEPKSKKAKKDKDPNAPKRPLTAFFLFMDDFRKSFKE  128

Query  395  ENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
             NPD K V TVAKEGGEKWKS+TDEEKK Y+D
Sbjct  129  ANPDSKLVKTVAKEGGEKWKSMTDEEKKPYVD  160



>ref|XP_009351762.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Pyrus 
x bretschneideri]
Length=221

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 10/161 (6%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQIN------ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAK  591
            + RKRVE    E + ++       SL R KDGSAFARCDECNKDVPVALI+ H+CSLDAK
Sbjct  12   KARKRVEATETEENSLSMSTAPPPSLVRVKDGSAFARCDECNKDVPVALITMHSCSLDAK  71

Query  590  IKMNLEAQIIekpaepkkkptekekARSTEpkakkekkakdpn----apKRPPTAFFVFM  423
            IK+NL+AQ++E+P E KKKP    K  +T     K  K    +    APKRP TAFF+F+
Sbjct  72   IKLNLKAQVVERPPELKKKPPTDRKRSTTATSHPKMSKRAKKDKDPNAPKRPLTAFFLFL  131

Query  422  EEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            ++FRK++KE NPD K V TV +EGGEKWKS+TDEEKK Y+D
Sbjct  132  DDFRKSYKEANPDSKGVKTVTREGGEKWKSMTDEEKKPYVD  172



>ref|XP_009351760.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009351761.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Pyrus 
x bretschneideri]
Length=223

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 117/163 (72%), Gaps = 12/163 (7%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQIN------ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAK  591
            + RKRVE    E + ++       SL R KDGSAFARCDECNKDVPVALI+ H+CSLDAK
Sbjct  12   KARKRVEATETEENSLSMSTAPPPSLVRVKDGSAFARCDECNKDVPVALITMHSCSLDAK  71

Query  590  IKMNLEAQIIekpae-pkkkptekekARSTEpkakkekkakdpn-----apKRPPTAFFV  429
            IK+NL+AQ++E+P E  KK PTE E+ RST   +  +   +        APKRP TAFF+
Sbjct  72   IKLNLKAQVVERPPELKKKPPTETERKRSTTATSHPKMSKRAKKDKDPNAPKRPLTAFFL  131

Query  428  FMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            F+++FRK++KE NPD K V TV +EGGEKWKS+TDEEKK Y+D
Sbjct  132  FLDDFRKSYKEANPDSKGVKTVTREGGEKWKSMTDEEKKPYVD  174



>ref|XP_010940378.1| PREDICTED: high mobility group B protein 7-like [Elaeis guineensis]
Length=193

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 120/154 (78%), Gaps = 9/154 (6%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRVE ++N       +LKRA+DGSAF +C+ CNKDVPV LI  H+CSLD+KI+M+L
Sbjct  11   PRARKRVEAETN-------TLKRARDGSAFTKCEACNKDVPVVLIDMHSCSLDSKIRMSL  63

Query  575  EAQIIekpaepkkkptekekARS--TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTF  402
            E+Q++EK A+ KK    K  A +   E K KKE+K+KDP APKRPPTAFF+FM++FRK +
Sbjct  64   ESQVVEKVADVKKPVERKRAAPADRKERKGKKERKSKDPKAPKRPPTAFFLFMDDFRKEY  123

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD KSV+ VAKEGGEKWKS+TDEE+K Y+D
Sbjct  124  KETHPDSKSVSMVAKEGGEKWKSMTDEERKPYVD  157



>ref|XP_012068568.1| PREDICTED: high mobility group B protein 7-like [Jatropha curcas]
 gb|KDP40471.1| hypothetical protein JCGZ_24470 [Jatropha curcas]
Length=214

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = -1

Query  749  VRKRVEVDSNESSQIN--ASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
             +KRVE +SN  +      SL RA+DGSAF RC+EC K V VALIS H+CSLDAKIKMNL
Sbjct  2    AKKRVEAESNAGAAAGNTTSLIRARDGSAFTRCEECKKHVAVALISMHSCSLDAKIKMNL  61

Query  575  EAQIIekpaepkkkptekekARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKT  405
            E++++EKP E KKKP E++K+ STEPKAKK KK K  +    PKRPPTAFF+FM+EFRK 
Sbjct  62   ESKVVEKPTEVKKKPAERKKSTSTEPKAKKAKKEKKASDPNKPKRPPTAFFIFMDEFRKL  121

Query  404  FKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FKE NPD K V  VAKE GEKWKS+T+EEKK Y+D
Sbjct  122  FKEANPDSKDVKKVAKEAGEKWKSMTEEEKKPYVD  156



>ref|XP_004297711.1| PREDICTED: high mobility group B protein 7-like [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 115/158 (73%), Gaps = 8/158 (5%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE  + + S    SL R KDGSAFARC+ C KDVPVA ISFH+CSLDAKI+ NLE
Sbjct  12   RSRKRVEATAEDDSS-RPSLVRGKDGSAFARCEGCKKDVPVATISFHSCSLDAKIRNNLE  70

Query  572  AQIIekpaepkkkptekekARSTEp-------kakkekkakdpnapKRPPTAFFVFMEEF  414
            AQ++EKP++  KKP    K +ST         K  K KK+KDPNAPKRP TAFF+FM +F
Sbjct  71   AQVVEKPSQVTKKPPTAGKKKSTTSEPNAKRVKTDKVKKSKDPNAPKRPLTAFFLFMADF  130

Query  413  RKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RK++KE NPD K V  VAKEGGEKWK LTDEEKK YID
Sbjct  131  RKSYKEANPDSKDVKKVAKEGGEKWKLLTDEEKKPYID  168



>ref|XP_008802830.1| PREDICTED: high mobility group B protein 7-like [Phoenix dactylifera]
Length=193

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 9/154 (6%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRV  ++N       +LKRA+DGSAF RC+ CNKDVPV LI  H CSLD+KI+ +L
Sbjct  11   PRGRKRVGAETN-------TLKRARDGSAFTRCEACNKDVPVVLIDMHICSLDSKIRTSL  63

Query  575  EAQIIekpaepkkkptekekARS--TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTF  402
            EAQ++EK AE  K    K  A S   E K KK KK KDP APKRPPTAFF+FM++FRK++
Sbjct  64   EAQVVEKVAEANKPAERKRAASSDQKERKGKKGKKFKDPTAPKRPPTAFFLFMDDFRKSY  123

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE +PD KSV+ VAK+GGEKW+S++DEEKK Y+D
Sbjct  124  KEAHPDSKSVSMVAKDGGEKWRSMSDEEKKPYVD  157



>ref|XP_004497257.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Cicer 
arietinum]
Length=201

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 131/173 (76%), Gaps = 8/173 (5%)
 Frame = -1

Query  743  KRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQ  567
            KRV+ VDS  +S     L RAKDGSAFARC EC KDVPVALI  H+CSL+AKIKMNL+AQ
Sbjct  7    KRVDAVDSRAAS----VLVRAKDGSAFARCAECKKDVPVALIDMHSCSLEAKIKMNLDAQ  62

Query  566  IIekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKE  396
            ++E+ AE KK   +K K++   +   K  KEKK KDPN PKRPPTAFFVFM++FRKTFKE
Sbjct  63   VVEQAAEVKKPERKKPKSKEPSAKRAKVGKEKKIKDPNMPKRPPTAFFVFMDDFRKTFKE  122

Query  395  ENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATEN  237
             NPD K V  V KE GEKW+++TDEEKK Y+DR  E KAEYEKA+E+ NA EN
Sbjct  123  ANPDSKDVKRVGKEAGEKWRAMTDEEKKPYLDRVVELKAEYEKAMETYNAAEN  175



>ref|XP_004497256.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Cicer 
arietinum]
Length=202

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 131/173 (76%), Gaps = 8/173 (5%)
 Frame = -1

Query  743  KRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQ  567
            KRV+ VDS  +S     L RAKDGSAFARC EC KDVPVALI  H+CSL+AKIKMNL+AQ
Sbjct  7    KRVDAVDSRAAS----VLVRAKDGSAFARCAECKKDVPVALIDMHSCSLEAKIKMNLDAQ  62

Query  566  IIekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKE  396
            ++E+ AE KK   +K K++   +   K  KEKK KDPN PKRPPTAFFVFM++FRKTFKE
Sbjct  63   VVEQAAEVKKPERKKPKSKEPSAKRAKVGKEKKIKDPNMPKRPPTAFFVFMDDFRKTFKE  122

Query  395  ENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATEN  237
             NPD K V  V KE GEKW+++TDEEKK Y+DR  E KAEYEKA+E+ NA EN
Sbjct  123  ANPDSKDVKRVGKEAGEKWRAMTDEEKKPYLDRVVELKAEYEKAMETYNAAEN  175



>ref|XP_006288568.1| hypothetical protein CARUB_v10001858mg [Capsella rubella]
 gb|EOA21466.1| hypothetical protein CARUB_v10001858mg [Capsella rubella]
Length=236

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 118/159 (74%), Gaps = 8/159 (5%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE +++ ++    +L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NL
Sbjct  11   PKPRKRVEAETSSNASTTTTLRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNL  70

Query  575  EAQIIekpaepkkkptekekARSTE-------pkakkekkakdpnapKRPPTAFFVFMEE  417
            EAQ++E  AE KKKP E++K+ S E            +K +   N PKRP TAFF+FM +
Sbjct  71   EAQVVETQAEAKKKPAERKKSASDEPKPKRVRKAKDDKKSSSTSNKPKRPLTAFFIFMND  130

Query  416  FRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FRKT+K+ENP   +V  VAK GGEKWKSLT+EEKK+Y+D
Sbjct  131  FRKTYKDENPS-SNVKDVAKHGGEKWKSLTEEEKKVYLD  168



>ref|XP_002513135.1| DNA-binding protein MNB1B, putative [Ricinus communis]
 gb|EEF49638.1| DNA-binding protein MNB1B, putative [Ricinus communis]
Length=196

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 121/153 (79%), Gaps = 5/153 (3%)
 Frame = -1

Query  749  VRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
             RKRVE +  +++    S+ R KDGSAFARCDEC KDVPVALIS H+CSL+A+IKMNLEA
Sbjct  2    ARKRVEAE--DTATAANSMVRGKDGSAFARCDECKKDVPVALISMHSCSLEARIKMNLEA  59

Query  569  QIIekpaepkkkptekekARSTE---pkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            QI+EKPAE  KKP E++K  STE    KAKK+KK  +PN PKRPPTAFF+F++EFRKTFK
Sbjct  60   QIVEKPAETTKKPAERKKPTSTEPKAKKAKKDKKPNNPNKPKRPPTAFFIFLDEFRKTFK  119

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NPD K V  VAKE GEKWK++TDEEKK Y D
Sbjct  120  EANPDSKDVKRVAKEAGEKWKAMTDEEKKPYAD  152



>gb|EPS72473.1| hypothetical protein M569_02286, partial [Genlisea aurea]
Length=174

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINAS--LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMN  579
            R+RKRVEV+S  S+  ++   LKRA+DGSAF +C+ECN+ V VALI FH+C+LDAKIK +
Sbjct  6    RLRKRVEVESASSTSSSSLPSLKRARDGSAFVKCEECNESVHVALIKFHDCTLDAKIKAS  65

Query  578  LEAQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            LEAQ++E  AEPKKK T ++K  +      KEKKA D N  KRPPTAFF+FM+EFRK+FK
Sbjct  66   LEAQVVEMQAEPKKKSTSEKKKTAK-KAEPKEKKAGDTNKRKRPPTAFFLFMDEFRKSFK  124

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NP  K VA VAKEGGEKWKSLT+EEKK+Y D
Sbjct  125  EANPQCKKVAIVAKEGGEKWKSLTEEEKKVYQD  157



>emb|CDY64875.1| BnaCnng45460D [Brassica napus]
Length=240

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (73%), Gaps = 13/161 (8%)
 Frame = -1

Query  746  RKRVEVDS-NESSQINAS--LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            RKRVE ++ +ES+  N S  L RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NL
Sbjct  18   RKRVEAETKDESTAKNNSNTLLRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNL  77

Query  575  EAQIIekpaepkkkptekekARSTE---------pkakkekkakdpnapKRPPTAFFVFM  423
            EAQ++E  AE KKKP E++K+ S E            K +K +   N  KRP TAFF+FM
Sbjct  78   EAQVVEMQAEAKKKPVERKKSTSDEPKAKRVRKAKDEKNKKSSSTSNKLKRPLTAFFIFM  137

Query  422  EEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
             +FRKTFKEENP   +V  VAK+GGEKWKSLT+EEKK+Y+D
Sbjct  138  NDFRKTFKEENPS-SNVKDVAKQGGEKWKSLTEEEKKVYLD  177



>ref|XP_009385984.1| PREDICTED: high mobility group B protein 7-like [Musa acuminata 
subsp. malaccensis]
Length=199

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 8/154 (5%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRVE ++       ++LKRA+DGSAF RC+ C KDV V LI  H+CSLD+KI+M L
Sbjct  11   PRPRKRVEAETA------STLKRARDGSAFTRCEACKKDVAVVLIDMHSCSLDSKIRMTL  64

Query  575  EAQIIekpaepkkkptekekARS--TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTF  402
            E+Q++EK  E KK   +K    S   E KAKK KK+KD +APKRP TAFF+FME+FRKTF
Sbjct  65   ESQVVEKAVEAKKPVEKKRAVSSEGKERKAKKGKKSKDSSAPKRPATAFFLFMEDFRKTF  124

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE NPD KSVA V+KEGGEKWK+++DEEKK YI+
Sbjct  125  KEANPDNKSVAVVSKEGGEKWKTMSDEEKKPYIE  158



>ref|NP_001236719.1| uncharacterized protein LOC100306558 [Glycine max]
 gb|ACU14782.1| unknown [Glycine max]
Length=209

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 8/153 (5%)
 Frame = -1

Query  746  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
            RKRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+A
Sbjct  7    RKRVDAVDSRAAS----VLVRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDA  62

Query  569  QIIekpaepkkkptekekARS---TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            Q++E+ AE KK   +K K++     + K  K KK KDPN PKRPPTAFFVF+++FRK+FK
Sbjct  63   QVVEQAAEAKKPERKKPKSKEPMAKKAKVGKGKKVKDPNMPKRPPTAFFVFLDDFRKSFK  122

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NPD K V  V KE GEKW+S+TDEEKK Y+D
Sbjct  123  EANPDSKDVKRVGKEAGEKWRSMTDEEKKPYLD  155



>gb|KJB49542.1| hypothetical protein B456_008G147700 [Gossypium raimondii]
Length=164

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV+  S  +    +SL RAKDGSAFA+CDECNK VPVALI+ H+CSL+AKIKMNL
Sbjct  10   PKPRKRVDAASAPAPAPASSLVRAKDGSAFAKCDECNKTVPVALINMHSCSLEAKIKMNL  69

Query  575  EAQIIekpaepkkkptekekARST----EpkakkekkakdpnapKRPPTAFFVFMEEFRK  408
            E+Q+IEKPAE KKKP E++K  +T      K KK KK KDPNAPKRPPTAFF+FM++FRK
Sbjct  70   ESQVIEKPAEAKKKPAERKKPPTTTESNPKKPKKLKKGKDPNAPKRPPTAFFLFMDDFRK  129

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDE  321
            ++KE NPD K V  VAKEGGEKWKS+++E
Sbjct  130  SYKEANPDAKGVTGVAKEGGEKWKSMSEE  158



>ref|XP_007142737.1| hypothetical protein PHAVU_007G012700g [Phaseolus vulgaris]
 gb|ESW14731.1| hypothetical protein PHAVU_007G012700g [Phaseolus vulgaris]
Length=199

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 111/154 (72%), Gaps = 6/154 (4%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            + RKRV+   + S+ +   L RAKDGSAFARCD+C K+VPV LI  HNCSL+AKIKMNL+
Sbjct  4    QTRKRVDAVDSRSASV---LVRAKDGSAFARCDDCKKNVPVVLIDMHNCSLEAKIKMNLD  60

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTF  402
            AQ++++ AE KK   +K K++  + K  K +K K       PKRP TAFFVF+++FRKTF
Sbjct  61   AQVVDQAAEAKKIERKKPKSKEPKAKKAKTEKGKKVKDPNKPKRPATAFFVFLDDFRKTF  120

Query  401  KEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            KE NPD K V  V KE GEKWKS+TDEEKK Y+D
Sbjct  121  KEANPDSKDVKRVGKEAGEKWKSMTDEEKKPYLD  154



>gb|KEH44448.1| high mobility group (HMG)-box protein [Medicago truncatula]
Length=210

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = -1

Query  743  KRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQI  564
            KRV+   + S+ +   L RAKDGSAFA+CDEC KDVPVALI  HNCSL+AKIKMNLE+  
Sbjct  7    KRVDAVDSRSASV---LVRAKDGSAFAKCDECKKDVPVALIDMHNCSLEAKIKMNLESHA  63

Query  563  IekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            +E+ AE KK   +K  ++   +   K  K KK KDPNAPKRPPTAFFVFM+EFRK FKE 
Sbjct  64   VEQAAEVKKPERKKPNSKEPNAKRAKVGKGKKVKDPNAPKRPPTAFFVFMDEFRKIFKEA  123

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            NPD K V  V KE GEKW+SLT+EEKK Y+D
Sbjct  124  NPDSKDVKRVGKEAGEKWRSLTEEEKKPYLD  154



>gb|KHN23128.1| High mobility group B protein 7 [Glycine soja]
Length=209

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 115/153 (75%), Gaps = 8/153 (5%)
 Frame = -1

Query  746  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
            RKRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+A
Sbjct  7    RKRVDAVDSRAAS----VLVRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDA  62

Query  569  QIIekpaepkkkptekekARS---TEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            Q++E+ AE KK   +K K+      + K  K KK KDPN PKRPPTAFFVF+++FRK+FK
Sbjct  63   QVVEQAAEAKKPERKKPKSEEPMAKKAKVGKGKKVKDPNMPKRPPTAFFVFLDDFRKSFK  122

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NPD K V  V KE GEKW+S+TDEEKK Y+D
Sbjct  123  EANPDSKDVKRVGKEAGEKWRSMTDEEKKPYLD  155



>gb|KHN37346.1| High mobility group B protein 7 [Glycine soja]
Length=200

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 116/153 (76%), Gaps = 8/153 (5%)
 Frame = -1

Query  746  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
            +KRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+A
Sbjct  7    KKRVDAVDSRAAS----VLLRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDA  62

Query  569  QIIekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            Q++E+ +E KK   +K K++   +   K +K KK KDPN PKRPPTAFF F+++FRK+FK
Sbjct  63   QVVEQASEAKKPERKKPKSKEPMAKRAKVEKGKKVKDPNMPKRPPTAFFAFLDDFRKSFK  122

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NPD K V  V KE GEKW+S+TDEEKK Y+D
Sbjct  123  EANPDSKDVKRVGKEAGEKWRSMTDEEKKPYLD  155



>gb|AFK37944.1| unknown [Lotus japonicus]
Length=197

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = -1

Query  746  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
            RKR++ VDS  +S     L R++DGSAFARC+ECNK VPVALIS H+CSL+AKIKMNL+A
Sbjct  6    RKRIDAVDSRAAS----VLVRSRDGSAFARCEECNKSVPVALISMHSCSLEAKIKMNLDA  61

Query  569  QIIekpaepkkkptekekARSTEpkakkekkakdpn---apKRPPTAFFVFMEEFRKTFK  399
            Q+IE+  E KK   +K  ++  + K  K +KAK       PKRPPTAFFVF+++FRK FK
Sbjct  62   QVIEQANEAKKTERKKPSSKEPKAKRAKTEKAKKVEDPNQPKRPPTAFFVFLDDFRKEFK  121

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NP  K V  V KEGGEKW+++TDEEKK Y++
Sbjct  122  EANPGSKDVKRVGKEGGEKWRAMTDEEKKPYLE  154



>ref|XP_006394608.1| hypothetical protein EUTSA_v10004817mg [Eutrema salsugineum]
 gb|ESQ31894.1| hypothetical protein EUTSA_v10004817mg [Eutrema salsugineum]
Length=251

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE ++   +    +L RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++NL
Sbjct  12   PKQRKRVEAETKPETSNTNTLLRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVNL  71

Query  575  EAQIIekpaepkkkptekekARSTEp-------kakkekkakdpnapKRPPTAFFVFMEE  417
            EAQ++E   E KKKP  + K  +++        KAK  KK    N PKRP TAFF+FM +
Sbjct  72   EAQVVETQTEAKKKPIVERKKPTSDAPKPKRLRKAKDNKKTSTSNKPKRPLTAFFIFMND  131

Query  416  FRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FRKTF EENP   +V  VAK GGEKWKSLT+EEKK+Y+D
Sbjct  132  FRKTFGEENP-YSNVKDVAKLGGEKWKSLTEEEKKVYVD  169



>gb|ACG31059.1| HMG1/2-like protein [Zea mays]
 gb|ACG39894.1| HMG1/2-like protein [Zea mays]
 gb|ACN31909.1| unknown [Zea mays]
 gb|AFW65041.1| HMG type nucleosome/chromatin assembly factor DNucleasome/chromatin 
assembly factor D protein NFD106 [Zea mays]
 gb|AIB05281.1| HMG transcription factor, partial [Zea mays]
Length=212

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 97/151 (64%), Gaps = 18/151 (12%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD KI+M LE
Sbjct  12   RSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDEKIRMTLE  62

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++EK  E      +K  A+                  KR PTAFF+FM++FRK FK  
Sbjct  63   AQVVEKTVEVASADRKKSSAKG---------GGNKDAKRKRSPTAFFLFMDDFRKEFKAT  113

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +PD KSVATVAKEGGE+WKS+TDEEKK YI+
Sbjct  114  HPDNKSVATVAKEGGERWKSMTDEEKKPYIE  144



>ref|XP_006848664.1| PREDICTED: high mobility group B protein 7 [Amborella trichopoda]
 gb|ERN10245.1| hypothetical protein AMTR_s00171p00070550 [Amborella trichopoda]
Length=199

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 111/162 (69%), Gaps = 17/162 (10%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRV+ D+        SLKRA+DGSAF +C+ C KDV VAL+  H+CSLDAKIKM  
Sbjct  10   PKTRKRVDADT-------GSLKRARDGSAFMKCEACKKDVAVALVDMHSCSLDAKIKMTF  62

Query  575  EAQIIekpaepkkkptekekAR-------STEpkakkekkakdpn--apKRPPTAFFVFM  423
            E+QI E+  E KK   + + +        +TE      K  K+ +   PKRPPTAFFVFM
Sbjct  63   ESQIEERVTEIKKPVEKSKSSGSKKTSKVTTERAKTGTKGKKERDPNMPKRPPTAFFVFM  122

Query  422  EEFRKTFKEENP-DIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +EFRKTFKEENP + KSV+ VAKEGGEKWKSL+DEEKK Y++
Sbjct  123  DEFRKTFKEENPEEAKSVSKVAKEGGEKWKSLSDEEKKPYLE  164



>ref|XP_003536758.1| PREDICTED: high mobility group B protein 7-like [Glycine max]
Length=200

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 117/153 (76%), Gaps = 8/153 (5%)
 Frame = -1

Query  746  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
            +KRV+ VDS  +S     L RAKDGSAFARCD+C K+VPVALI  H+CSL+AKIKMNL+A
Sbjct  7    KKRVDAVDSRAAS----VLLRAKDGSAFARCDDCKKNVPVALIDMHSCSLEAKIKMNLDA  62

Query  569  QIIekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            Q++E+ AE KK   +K K++   + + K +K KK KDPN PKRPPTAFF F+++FRK+FK
Sbjct  63   QVVEQAAEAKKPERKKPKSKEPMAKKAKVEKVKKVKDPNMPKRPPTAFFAFLDDFRKSFK  122

Query  398  EENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            E NPD K V  V KE GEKW+S+TDEEKK Y+D
Sbjct  123  EANPDSKDVKRVGKEAGEKWRSMTDEEKKPYLD  155



>gb|KFK27649.1| hypothetical protein AALP_AA8G410700 [Arabis alpina]
Length=243

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 115/163 (71%), Gaps = 12/163 (7%)
 Frame = -1

Query  755  PRVRKRVEVDSNE----SSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKI  588
            P+ RKRVE ++ +    ++    +L RAKDGSAF RCDEC+K+V VALIS HNCSLDAKI
Sbjct  11   PKPRKRVEAETKDETSNNTTTTTTLLRAKDGSAFVRCDECSKNVAVALISMHNCSLDAKI  70

Query  587  KMNLEAQIIekpaepkkkptekekARSTEp-------kakkekkakdpnapKRPPTAFFV  429
            K NLEAQ++E   E  KK   + K  +++        K K EKKA + N  KRP TAFF+
Sbjct  71   KENLEAQVVETQIEAAKKKPVERKKSTSDEPKAKRVRKTKDEKKASNSNKAKRPLTAFFI  130

Query  428  FMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FM +FRKTFKEENP   +V  VAK+GGEKWKSL++EEKK+Y+D
Sbjct  131  FMGDFRKTFKEENPG-SNVKDVAKQGGEKWKSLSEEEKKVYLD  172



>emb|CDY46957.1| BnaA02g32890D [Brassica napus]
Length=243

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 120/164 (73%), Gaps = 13/164 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +S     ++    +L RAKDGSAFA+C+ CNK+V VALIS HNCSLDAKI+
Sbjct  13   PKPRKRVEAESKPETTNNNNINTLLRAKDGSAFAKCEGCNKNVAVALISMHNCSLDAKIR  72

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkak---------kekkakdpnapKRPPTAFF  432
            +NLEAQ++E   E KKKP E++K+ S EPKAK         K+K +   N PKRP TAFF
Sbjct  73   VNLEAQVVETQTEAKKKPVERKKSTSDEPKAKRLRKAKDDSKKKSSSSSNKPKRPLTAFF  132

Query  431  VFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +FM +FRKTFKEENPD   V  VAK+GGEKWKSL +EEKK+Y+D
Sbjct  133  IFMADFRKTFKEENPDA-GVKDVAKQGGEKWKSLDEEEKKVYLD  175



>ref|XP_002444850.1| hypothetical protein SORBIDRAFT_07g000230 [Sorghum bicolor]
 gb|EES14345.1| hypothetical protein SORBIDRAFT_07g000230 [Sorghum bicolor]
Length=221

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 97/151 (64%), Gaps = 13/151 (9%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD  I+M LE
Sbjct  12   RSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDKHIRMMLE  62

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++EK  E   KP E    R+                 KR PTAFF+FM++FRK FK  
Sbjct  63   AQVVEKTVEVAAKPAE----RNKSSAKGHGGGGNKDAKRKRSPTAFFLFMDDFRKEFKAA  118

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +PD KSVATVAKEGGEKWKS+TDEEKK Y++
Sbjct  119  HPDNKSVATVAKEGGEKWKSMTDEEKKPYVE  149



>ref|XP_009130114.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Brassica 
rapa]
Length=243

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 120/164 (73%), Gaps = 13/164 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +S     ++    +L RAKDGSAFA+C+ CNK+V VALIS H+CSLDAKI+
Sbjct  13   PKARKRVEAESKPETTNNNNINTLLRAKDGSAFAKCEGCNKNVAVALISMHDCSLDAKIR  72

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkak---------kekkakdpnapKRPPTAFF  432
            +NLEAQ++E   E KKKP E++K+ S EPKAK         K+K +   N PKRP TAFF
Sbjct  73   VNLEAQVVETQTEAKKKPVERKKSTSDEPKAKRLRKAKDDSKKKSSSSSNKPKRPLTAFF  132

Query  431  VFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +FM +FRKTFKEENPD   V  VAK+GGEKWKSL +EEKK+Y+D
Sbjct  133  IFMADFRKTFKEENPDA-GVKDVAKQGGEKWKSLDEEEKKVYLD  175



>ref|XP_010421142.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Camelina 
sativa]
Length=238

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINAS---LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +++ ++    +   L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI+
Sbjct  11   PKPRKRVEAETSSNASSTTTTTTLRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIR  70

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkak---kekkakdpnapKRPPTAFFVFMEEF  414
            +NLEAQ++E   E KKKP EK+K+ S EPKAK   K K +   N PKRP TAFF+FM +F
Sbjct  71   VNLEAQVVETQTEAKKKPAEKKKSTSDEPKAKRVRKAKSSSTSNKPKRPLTAFFIFMNDF  130

Query  413  RKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RKT+ EENP   +V  VAK GGEKWKSL++EEKK+Y D
Sbjct  131  RKTYSEENPS-NNVKDVAKRGGEKWKSLSEEEKKVYTD  167



>emb|CDY40795.1| BnaC02g41640D [Brassica napus]
Length=249

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 120/163 (74%), Gaps = 12/163 (7%)
 Frame = -1

Query  755  PRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +S     ++    +L RAKDGSAFA+C+ CNK+V VALIS HNCSLDAKI+
Sbjct  13   PKPRKRVEAESKPETTTNNNINTLLRAKDGSAFAKCEGCNKNVAVALISMHNCSLDAKIR  72

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkak--------kekkakdpnapKRPPTAFFV  429
            +NLEAQ++E   E KKKP E++K+ S EPKAK         +KK+   N PKRP TAFF+
Sbjct  73   VNLEAQVVETQTEAKKKPAERKKSTSDEPKAKRLRKSKDENKKKSSSSNKPKRPLTAFFI  132

Query  428  FMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FM +FRKTFKEENPD   V  VAK+GGEKWKSL +EEKK+Y++
Sbjct  133  FMADFRKTFKEENPDA-GVKDVAKQGGEKWKSLDEEEKKVYLE  174



>ref|XP_010454621.1| PREDICTED: high mobility group B protein 7-like [Camelina sativa]
Length=238

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINAS---LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +++ ++    +   L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI+
Sbjct  11   PKPRKRVEAETSSNASSTTTTTTLRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIR  70

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkak---kekkakdpnapKRPPTAFFVFMEEF  414
            +NLEAQ++E   E KKK  EK+K+ S EPKAK   K K +   N PKRP TAFF+FM +F
Sbjct  71   VNLEAQVVETHTEAKKKTAEKKKSTSDEPKAKRVRKAKSSSTSNKPKRPLTAFFIFMNDF  130

Query  413  RKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RKT+ EENP I +V  VAK GGEKWKSL++EEKK+Y D
Sbjct  131  RKTYSEENPFI-NVKDVAKRGGEKWKSLSEEEKKVYTD  167



>ref|XP_004972392.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Setaria 
italica]
Length=219

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 99/151 (66%), Gaps = 17/151 (11%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE            LKR++DGSAF RC+ CNKDVPV LI  H+CSLDAKI+  LE
Sbjct  13   RSRKRVEA---------TILKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDAKIRETLE  63

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++E+  E  K    K+ A++          A      KR PTAFF+FM++FRK FK  
Sbjct  64   AQVVERTVEVTKPADRKKPAKA--------GAANKDGKRKRTPTAFFLFMDDFRKEFKAA  115

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            NPD K+VATVAKEGGE+WKS+TDEEKK Y D
Sbjct  116  NPDNKNVATVAKEGGERWKSMTDEEKKPYHD  146



>emb|CDY16851.1| BnaA09g05310D [Brassica napus]
Length=240

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 119/164 (73%), Gaps = 14/164 (9%)
 Frame = -1

Query  752  RVRKRVEVDS-NESSQINAS--LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKM  582
            + RKRVE ++ +ES+  N S  L RAKDGSAFARC+ C+K+V VALIS H+CSLDAKI++
Sbjct  16   KQRKRVEAETKDESTAKNNSNTLLRAKDGSAFARCEGCSKNVAVALISMHSCSLDAKIRV  75

Query  581  NLEAQIIekpaepkkkptekekARSTE----------pkakkekkakdpnapKRPPTAFF  432
            NLEAQ++E  AE KKKP E++K+ S E              K+  +   N PKRP TAFF
Sbjct  76   NLEAQVVEMQAEAKKKPVERKKSTSDEPKAKRVRKAKDDKNKKGSSTTSNKPKRPLTAFF  135

Query  431  VFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +FM +FRKTFKEENP   +V  VAK+GGEKWKSLT+EEKK+Y+D
Sbjct  136  IFMNDFRKTFKEENPS-SNVKDVAKQGGEKWKSLTEEEKKVYLD  178



>ref|XP_009141528.1| PREDICTED: high mobility group B protein 7-like [Brassica rapa]
Length=246

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 119/164 (73%), Gaps = 14/164 (9%)
 Frame = -1

Query  752  RVRKRVEVDS-NESSQINAS--LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKM  582
            + RKRVE ++ +ES+  N S  L RAKDGSAFARC+ C+K+V VALIS H+CSLDAKI++
Sbjct  16   KQRKRVEAETKDESTAKNNSNTLLRAKDGSAFARCEGCSKNVAVALISMHSCSLDAKIRV  75

Query  581  NLEAQIIekpaepkkkptekekARSTE----------pkakkekkakdpnapKRPPTAFF  432
            NLEAQ++E  AE KKKP E++K+ S E              K+  +   N PKRP TAFF
Sbjct  76   NLEAQVVEMQAEAKKKPVERKKSTSDEPKAKRVRKAKDDKNKKGSSTTSNKPKRPLTAFF  135

Query  431  VFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +FM +FRKTFKEENP   +V  VAK+GGEKWKSLT+EEKK+Y+D
Sbjct  136  IFMNDFRKTFKEENPS-SNVKDVAKQGGEKWKSLTEEEKKVYLD  178



>ref|XP_008677776.1| PREDICTED: nucleosome/chromatin assembly factor D isoform X1 
[Zea mays]
Length=281

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 97/151 (64%), Gaps = 18/151 (12%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD KI+M LE
Sbjct  81   RSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDEKIRMTLE  131

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++EK  E      +K  A+                  KR PTAFF+FM++FRK FK  
Sbjct  132  AQVVEKTVEVASADRKKSSAKGG---------GNKDAKRKRSPTAFFLFMDDFRKEFKAT  182

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +PD KSVATVAKEGGE+WKS+TDEEKK YI+
Sbjct  183  HPDNKSVATVAKEGGERWKSMTDEEKKPYIE  213



>ref|XP_010493464.1| PREDICTED: high mobility group B protein 7-like [Camelina sativa]
Length=238

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 129/179 (72%), Gaps = 8/179 (4%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINAS-LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMN  579
            P+ RKRVE +++ ++    + L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI++N
Sbjct  11   PKPRKRVEAETSSNASTTTTTLRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIRVN  70

Query  578  LEAQIIekpaepkkkptekekARSTEpk------akkekkakdpnapKRPPTAFFVFMEE  417
            LEAQ++E   E  KK   ++K  +T  +       K +  +   N PKRP TAFF+FM +
Sbjct  71   LEAQVVETQTEAAKKKPAEKKKSTTSDEPKPKRVRKAKSSSSTSNKPKRPLTAFFIFMND  130

Query  416  FRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATE  240
            FRKT+ EEN  I +V  VAK GGEKWKSL++EEKK+Y D+AAE KAEY K+LE+N+A E
Sbjct  131  FRKTYSEENTSI-NVKDVAKRGGEKWKSLSEEEKKVYTDKAAELKAEYNKSLENNDADE  188



>ref|XP_010688617.1| PREDICTED: high mobility group B protein 7 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = -1

Query  755  PRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE D+     SS    SLKRAKDGSAFARC+EC   VPVALI  H+CSL+AKIK
Sbjct  11   PKQRKRVEADTPTEASSSAAMLSLKRAKDGSAFARCEECKSSVPVALIDMHSCSLEAKIK  70

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkakkekkakdpna----pKRPPTAFFVFMEE  417
            M+L+A ++EKPAE KKK   K+ A S+E  ++ +K+          PKRP TA+FVFMEE
Sbjct  71   MSLDATVVEKPAEVKKKAERKKPASSSEAGSESKKRKLSKVKDPNMPKRPMTAYFVFMEE  130

Query  416  FRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            FRK +KEE+P+ K V   AKE G KWK+LTDEEKK Y
Sbjct  131  FRKVYKEEHPESKGVKEFAKEAGAKWKALTDEEKKPY  167



>gb|EAZ05273.1| hypothetical protein OsI_27476 [Oryza sativa Indica Group]
 gb|EAZ05282.1| hypothetical protein OsI_27485 [Oryza sativa Indica Group]
Length=204

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 14/151 (9%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE   +      A LKRA+DGSAF RC+ C K V V LI  HNCSLD KI+++LE
Sbjct  8    RTRKRVEATDS------AVLKRARDGSAFTRCEACGKSVSVVLIDMHNCSLDDKIRISLE  61

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++E+  E      +  K  +           +     KRPPTAFF+FM +FRK +K E
Sbjct  62   AQVVEQAVEVAASKKKSGKNNNN--------NGEGAKKGKRPPTAFFLFMSDFRKEYKAE  113

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +PD KSV+ VAKEGGE+WKS++DE+KK Y+D
Sbjct  114  HPDNKSVSAVAKEGGERWKSMSDEDKKPYLD  144



>ref|NP_001060758.1| Os08g0101100 [Oryza sativa Japonica Group]
 dbj|BAD03552.1| putative HMG type nucleosome/chromatin assembly factor D [Oryza 
sativa Japonica Group]
 dbj|BAF22672.1| Os08g0101100 [Oryza sativa Japonica Group]
 gb|EAZ41214.1| hypothetical protein OsJ_25719 [Oryza sativa Japonica Group]
 gb|ACJ54921.1| HMG type nucleosome/chromatin assembly factor [Oryza sativa Japonica 
Group]
 dbj|BAG91665.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 14/151 (9%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE   +      A LKRA+DGSAF RC+ C K V V LI  HNCSLD KI+++LE
Sbjct  8    RTRKRVEATDS------AVLKRARDGSAFTRCEACGKSVSVVLIDMHNCSLDDKIRISLE  61

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++E+  E      +  K  +           +     KRPPTAFF+FM +FRK +K E
Sbjct  62   AQVVEQAVEVAASKKKSGKNNNN--------NGEGAKKGKRPPTAFFLFMSDFRKEYKAE  113

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +PD KSV+ VAKEGGE+WKS++DE+KK Y+D
Sbjct  114  HPDNKSVSAVAKEGGERWKSMSDEDKKPYLD  144



>ref|XP_002874129.1| hypothetical protein ARALYDRAFT_910356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50388.1| hypothetical protein ARALYDRAFT_910356 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 130/180 (72%), Gaps = 12/180 (7%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE ++  S+  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI++NL
Sbjct  11   PKQRKRVEAET--STNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIRVNL  68

Query  575  EAQIIekpaepkkkptekekARS-------TEpkakkekkakdpnapKRPPTAFFVFMEE  417
            EAQ++E  AE KKKP EK+K  S        +    ++K +   N PKRP TAFF+FM +
Sbjct  69   EAQVVETQAEAKKKPAEKKKTTSDGPKPKRLKKTNDEKKSSSTSNKPKRPLTAFFIFMND  128

Query  416  FRKTFK-EENPDIKSVATVAKEGGEKWKSLTDEEKKLYIDraaerkaeyekalESNNATE  240
            FRKTFK E N  +   A  AK GGEKWKSLT+EEKK+Y+D+AAE KAEY K+LESN+A E
Sbjct  129  FRKTFKTEHNGSLAKDA--AKIGGEKWKSLTEEEKKVYLDKAAELKAEYNKSLESNDADE  186



>ref|XP_006659014.1| PREDICTED: high mobility group B protein 7-like [Oryza brachyantha]
Length=191

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 93/151 (62%), Gaps = 17/151 (11%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE          A LKRA+DGSAF RC+ C K V VALI  HNCSLD KI+M LE
Sbjct  8    RTRKRVEATEA------AVLKRARDGSAFTRCEACGKSVSVALIDMHNCSLDDKIRMTLE  61

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++E+  E            +   K  K          KRPPTAFF+F+ +FRK +K E
Sbjct  62   AQVVEQAVEV-----------TANTKKGKGDDDNKKKKGKRPPTAFFLFLADFRKEYKAE  110

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            +P  KSV+  AKEGGE+WK+++DEEKK Y+D
Sbjct  111  HPGNKSVSAAAKEGGERWKAMSDEEKKPYLD  141



>ref|NP_568431.1| high-mobility group B6 protein [Arabidopsis thaliana]
 sp|Q8LDF9.1|HMGB7_ARATH RecName: Full=High mobility group B protein 7; AltName: Full=Nucleosome/chromatin 
assembly factor group D 07; Short=Nucleosome/chromatin 
assembly factor group D 7; AltName: Full=Protein 
NUCLEAR FUSION DEFECTIVE 7 [Arabidopsis thaliana]
 gb|AAM63233.1| unknown [Arabidopsis thaliana]
 dbj|BAC43282.1| unknown protein [Arabidopsis thaliana]
 gb|AED93164.1| high-mobility group B6 protein [Arabidopsis thaliana]
Length=241

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 114/160 (71%), Gaps = 12/160 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE ++  SS  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI++NL
Sbjct  11   PKQRKRVEAET--SSNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIRVNL  68

Query  575  EAQIIekpaepkkkptekekARS-------TEpkakkekkakdpnapKRPPTAFFVFMEE  417
            EAQ++E  AE KKKP EK+K  S        +    ++K +   N PKRP TAFF+FM +
Sbjct  69   EAQVVETQAEAKKKPAEKKKTTSDGPKPKRLKKTNDEKKSSSTSNKPKRPLTAFFIFMSD  128

Query  416  FRKTFKEENPDIKSVAT-VAKEGGEKWKSLTDEEKKLYID  300
            FRKTFK E+    S+A   AK GGEKWKSLT+EEKK+Y+D
Sbjct  129  FRKTFKSEHNG--SLAKDAAKIGGEKWKSLTEEEKKVYLD  166



>ref|XP_009130115.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Brassica 
rapa]
Length=214

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 13/154 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSN---ESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +S     ++    +L RAKDGSAFA+C+ CNK+V VALIS H+CSLDAKI+
Sbjct  13   PKARKRVEAESKPETTNNNNINTLLRAKDGSAFAKCEGCNKNVAVALISMHDCSLDAKIR  72

Query  584  MNLEAQIIekpaepkkkptekekARSTEpkak---------kekkakdpnapKRPPTAFF  432
            +NLEAQ++E   E KKKP E++K+ S EPKAK         K+K +   N PKRP TAFF
Sbjct  73   VNLEAQVVETQTEAKKKPVERKKSTSDEPKAKRLRKAKDDSKKKSSSSSNKPKRPLTAFF  132

Query  431  VFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSL  330
            +FM +FRKTFKEENPD   V  VAK+GGEKWKSL
Sbjct  133  IFMADFRKTFKEENPDA-GVKDVAKQGGEKWKSL  165



>gb|EMS56844.1| High mobility group B protein 7 [Triticum urartu]
Length=216

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 97/155 (63%), Gaps = 12/155 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRVE            LKRA+DGSAF RC+ CNKDV + LI  H+CSLD+KI+++L
Sbjct  8    PRSRKRVEA---------TVLKRARDGSAFTRCEACNKDVAIVLIDLHSCSLDSKIRLSL  58

Query  575  EAQIIekp---aepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKT  405
            E+Q++EK     E K+K          + K+K +         KRPPTAFF+FM++FR  
Sbjct  59   ESQVVEKAVEIQEKKRKAPSAAAGGKGKKKSKADGDGAKKPKAKRPPTAFFLFMKDFRVE  118

Query  404  FKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FK  +PD K VA V K  GEKWKS+T+EEKK Y D
Sbjct  119  FKASHPDEKGVAAVGKAAGEKWKSMTEEEKKPYND  153



>dbj|BAK07893.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=215

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 98/155 (63%), Gaps = 12/155 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRVE            LKRA+DGSAF RC+ CNKDV + LI  H+CSLD+KI+++L
Sbjct  8    PRSRKRVEA---------TVLKRARDGSAFTRCEACNKDVAIVLIDLHSCSLDSKIRLSL  58

Query  575  EAQIIekpaepkkkptekekARSTEpkakkekka---kdpnapKRPPTAFFVFMEEFRKT  405
            E+Q++EK  E ++K  +   A +     KK K           KRPPTAFF+FM++FR  
Sbjct  59   ESQVVEKAVEVQEKKRKAPPAAAGGKGKKKSKADGDGAKKAKAKRPPTAFFLFMKDFRVE  118

Query  404  FKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FK  +PD K VA V K  GEKW+S+T+EEKK Y D
Sbjct  119  FKTSHPDEKGVAAVGKAAGEKWRSMTEEEKKPYND  153



>ref|XP_004972391.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Setaria 
italica]
Length=278

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 94/144 (65%), Gaps = 17/144 (12%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE            LKR++DGSAF RC+ CNKDVPV LI  H+CSLDAKI+  LE
Sbjct  13   RSRKRVEA---------TILKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDAKIRETLE  63

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            AQ++E+  E  K    K+ A++          A      KR PTAFF+FM++FRK FK  
Sbjct  64   AQVVERTVEVTKPADRKKPAKA--------GAANKDGKRKRTPTAFFLFMDDFRKEFKAA  115

Query  392  NPDIKSVATVAKEGGEKWKSLTDE  321
            NPD K+VATVAKEGGE+WKS+TDE
Sbjct  116  NPDNKNVATVAKEGGERWKSMTDE  139



>gb|ABK23898.1| unknown [Picea sitchensis]
Length=220

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 105/155 (68%), Gaps = 11/155 (7%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            PR RKRV+VD        A+LKRA+DGS F +CD CNK +PVAL   H+C L+ KI+ N 
Sbjct  12   PRQRKRVDVDP-------ANLKRARDGSGFTKCDVCNKHIPVALSDMHDCQLEDKIRSNF  64

Query  575  EA----QIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRK  408
            +A    +  +    P+ K  +K+ A     K  +EKKA+DPN PK+P TAFFVFM++FRK
Sbjct  65   DASKETKHADAQKPPEAKKAKKKSADEKPKKRTREKKARDPNQPKKPATAFFVFMDDFRK  124

Query  407  TFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            T+KE NPD+K  A V KEGG KWK+++DE+KK Y+
Sbjct  125  TYKETNPDVKGAAQVGKEGGLKWKAMSDEDKKPYL  159



>ref|XP_008465567.1| PREDICTED: high mobility group B protein 7 [Cucumis melo]
Length=153

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            + RKRVE    + +    SL RAKDGSAFARCDEC K VPVALIS H+CSLDAKI+MNLE
Sbjct  8    KSRKRVEATPADVAATGPSLVRAKDGSAFARCDECGKSVPVALISMHSCSLDAKIRMNLE  67

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpn-----apKRPPTAFFVFMEEFRK  408
            AQ +EK  + KK   +K+ A S     K     K        APKRPPTAFF+FM++FRK
Sbjct  68   AQTVEKQTQSKKPAEKKKSASSEPKAKKSRTDKKGKKDKDPNAPKRPPTAFFIFMDDFRK  127

Query  407  TFKEENPDIKSVATVA  360
            +FKE NPD K V  V+
Sbjct  128  SFKEANPDSKGVKEVS  143



>ref|XP_003573245.1| PREDICTED: high mobility group B protein 7-like [Brachypodium 
distachyon]
Length=218

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 96/152 (63%), Gaps = 12/152 (8%)
 Frame = -1

Query  746  RKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQ  567
            RKRVE          A LKRA+DGSAF RC+ CNK+VPV LI  H+CSLD+KI+ +LEAQ
Sbjct  11   RKRVEA---------AVLKRARDGSAFTRCEGCNKNVPVVLIDLHSCSLDSKIRTSLEAQ  61

Query  566  IIekpaepkkkptekekARSTEpkakkekkakdpna---pKRPPTAFFVFMEEFRKTFKE  396
            ++EK  E  K   +++   S       +K      A    KRPPTAFF+FM++FR  FK 
Sbjct  62   VVEKTVEISKPEKKRKAPSSAAAGKGSKKGKSGAGAKNGKKRPPTAFFIFMKDFRLEFKA  121

Query  395  ENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
             +PD K V+ V K  G KWK++TDEEKK Y+D
Sbjct  122  SHPDEKGVSAVGKAAGVKWKAMTDEEKKPYLD  153



>emb|CCW03275.1| similar to high mobility group B protein 7 [Lupinus angustifolius]
Length=304

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 10/151 (7%)
 Frame = -1

Query  743  KRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEAQ  567
            KRV+ VDS  +S    +L R KDGSAF R +EC KDVPVALIS H+CSL+AKIKMNL +Q
Sbjct  11   KRVDAVDSRSAS----ALVRGKDGSAFTR-EECKKDVPVALISMHSCSLEAKIKMNL-SQ  64

Query  566  IIekpa--epkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFKEE  393
            ++E  A  +  +K  + ++  +   KA+K KK KDPN PKRP TAFF+F ++FRK+FKEE
Sbjct  65   VVEAGAEVKKPEKKPKSKEPNAKRAKAEKVKKVKDPNMPKRPATAFFLF-DDFRKSFKEE  123

Query  392  NPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            NPD K V  V KEGGEKW+S+TDEEKK Y+D
Sbjct  124  NPDSKDVKRVGKEGGEKWRSMTDEEKKPYLD  154



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TELGTN IMVAEARMCES SSKFKGPC+RDSNCATVCHTEGF+GGDCKG RRRCFCTKPC
Sbjct  21    TELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRRCFCTKPC  80



>ref|XP_002873936.1| hypothetical protein ARALYDRAFT_488801 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50195.1| hypothetical protein ARALYDRAFT_488801 [Arabidopsis lyrata subsp. 
lyrata]
Length=224

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 109/159 (69%), Gaps = 13/159 (8%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE +++ S+  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI+   
Sbjct  11   PKQRKRVEAETS-SNNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIR---  66

Query  575  EAQIIekpaepkkkptekekA-------RSTEpkakkekkakdpnapKRPPTAFFVFMEE  417
             AQ++E  AE KKKP EK+KA       +  +    ++K +   N PKRP TAFF+FM +
Sbjct  67   -AQVVETQAEAKKKPAEKKKATADGPKPKRLKKTNDEKKSSSTSNKPKRPLTAFFIFMND  125

Query  416  FRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            FRKTFK E+ +       AK GGEKW SLT++EKK+Y+D
Sbjct  126  FRKTFKTEH-NGSFAKDAAKIGGEKWMSLTEDEKKVYLD  163



>ref|XP_008340418.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Malus 
domestica]
Length=234

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 12/142 (8%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINAS------LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAK  591
            + RKRVE    E + ++ S      L R KDGSAFARCDECNKDVPVALI+ H+CSLDAK
Sbjct  12   KARKRVEATETEENSLSMSTAPPLSLVRGKDGSAFARCDECNKDVPVALITMHSCSLDAK  71

Query  590  IKMNLEAQIIekpaepkkkptekekAR------STEpkakkekkakdpnapKRPPTAFFV  429
            IK+NL+AQ++E+P E KKKP  + + +      S    +K+ KK KDPNAPKRP TAFF+
Sbjct  72   IKLNLKAQVVERPPEVKKKPPTETQRKKFTTATSQPKMSKRAKKDKDPNAPKRPLTAFFL  131

Query  428  FMEEFRKTFKEENPDIKSVATV  363
            F+++FRK++KE NPD K V  V
Sbjct  132  FLDDFRKSYKEANPDSKGVKMV  153



>ref|XP_008340417.1| PREDICTED: high mobility group B protein 7-like isoform X1 [Malus 
domestica]
Length=238

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 100/146 (68%), Gaps = 16/146 (11%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINAS------LKRAKDGSAFARC----DECNKDVPVALISFHNCS  603
            + RKRVE    E + ++ S      L R KDGSAFAR     DECNKDVPVALI+ H+CS
Sbjct  12   KARKRVEATETEENSLSMSTAPPLSLVRGKDGSAFARWVWESDECNKDVPVALITMHSCS  71

Query  602  LDAKIKMNLEAQIIekpaepkkkptekekAR------STEpkakkekkakdpnapKRPPT  441
            LDAKIK+NL+AQ++E+P E KKKP  + + +      S    +K+ KK KDPNAPKRP T
Sbjct  72   LDAKIKLNLKAQVVERPPEVKKKPPTETQRKKFTTATSQPKMSKRAKKDKDPNAPKRPLT  131

Query  440  AFFVFMEEFRKTFKEENPDIKSVATV  363
            AFF+F+++FRK++KE NPD K V  V
Sbjct  132  AFFLFLDDFRKSYKEANPDSKGVKMV  157



>ref|XP_006574164.1| PREDICTED: high mobility group B protein 7-like [Glycine max]
Length=172

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = -1

Query  746  RKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLEA  570
            RKRV+ VD   +S +      AKDGSAFA C +C K+VPVALI  H+CSL+AKIKMNL+A
Sbjct  7    RKRVDAVDCRAASVLVC----AKDGSAFAHCYDCKKNVPVALIDMHSCSLEAKIKMNLDA  62

Query  569  QIIekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKTFK  399
            Q++E+ AE KK   +K K++   + + K  K KK KDPN PKRPPT FFVF+++FRK+FK
Sbjct  63   QVVEQAAEAKKPERKKPKSKEPMAKKAKVGKGKKVKDPNMPKRPPTTFFVFLDDFRKSFK  122

Query  398  EENPDIKSVATVAKEG  351
            E NPD K    V KE 
Sbjct  123  EANPDSKDAKRVGKEA  138



>gb|KHM99982.1| High mobility group B protein 7 [Glycine soja]
Length=138

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 8/136 (6%)
 Frame = -1

Query  752  RVRKRVE-VDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            ++RKRV+ VD   +S +      AKDGSAFA C +C K+VPVALI  H+CSL+AKIKMNL
Sbjct  5    QLRKRVDAVDCRAASVLVC----AKDGSAFAHCYDCKKNVPVALIDMHSCSLEAKIKMNL  60

Query  575  EAQIIekpaepkkkptekekAR---STEpkakkekkakdpnapKRPPTAFFVFMEEFRKT  405
            +AQ++E+ AE KK   +K K++   + + K  K KK KDPN PKRPPT FFVF+++FRK+
Sbjct  61   DAQVVEQAAEAKKPERKKPKSKEPMAKKAKVGKGKKVKDPNMPKRPPTTFFVFLDDFRKS  120

Query  404  FKEENPDIKSVATVAK  357
            FKE NPD K    V+K
Sbjct  121  FKEANPDSKDAKRVSK  136



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G  TI  AEAR CES S +FKGPC+RDSNCATVC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21    TEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G  TI  AEAR CES S +FKGPC+RDSNCATVC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21    TEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
 gb|AFM82499.1| defensin [Nicotiana tabacum]
Length=78

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G  TI  AEAR CES S +FKGPC+RDSNCATVC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21    TEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G  TI  AEAR CES S +F+GPC R+ NCA VC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  21    TEMGPMTI--AEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G  TI  AEAR CES   +FKGPC+RD NCATVC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  21    TEMGPMTI--AEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTRPC  78



>ref|NP_001190371.1| high-mobility group B6 protein [Arabidopsis thaliana]
 gb|AED93165.1| high-mobility group B6 protein [Arabidopsis thaliana]
Length=157

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 53/65 (82%), Gaps = 2/65 (3%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNL  576
            P+ RKRVE ++  SS  + +L+RAKDGSAFA C+ CNK V VALIS HNCSLDAKI++NL
Sbjct  11   PKQRKRVEAET--SSNTSTTLRRAKDGSAFALCEGCNKSVAVALISMHNCSLDAKIRVNL  68

Query  575  EAQII  561
            EAQ++
Sbjct  69   EAQVV  73



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+GT   MVAEAR CES S +FKGPC R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  21    TEMGT---MVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+GT   MVAEAR CES S +FKGPC R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  21    TEMGT---MVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G  TI  AEAR CES S +F+G C R+ NCA VC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  21    TEMGPMTI--AEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_004297786.1| PREDICTED: defensin Ec-AMP-D2-like [Fragaria vesca subsp. vesca]
Length=79

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             T +G N  MVAEAR CE+ S KFKG C R+SNCA+VC TEGF+GGDC+GLRRRCFCTK C
Sbjct  21    TGMGPNA-MVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGLRRRCFCTKHC  79



>ref|XP_004297787.1| PREDICTED: defensin Ec-AMP-D2-like [Fragaria vesca subsp. vesca]
Length=79

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             T +G NT MVAEAR CES S KFKG C  ++NCA+VC TEGFSGGDC+GLRRRCFCTK C
Sbjct  21    TGMGPNT-MVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGLRRRCFCTKHC  79



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  1131  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + EAR+CESPS +FKGPC  D NCA+VC TEGF+GGDC+GLRRRCFCTK C
Sbjct  28    IIEARICESPSQRFKGPCLTDRNCASVCETEGFTGGDCRGLRRRCFCTKEC  78



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             IMVAEAR CES S  FKG C RD NCA VC TEGF+GG CKG RRRCFC KPC
Sbjct  26    IMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQCKGFRRRCFCNKPC  78



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   IMVAEAR CE+PS+ FKG C  D+NCA+VC TEGF GG C+G R+RCFCTKPC
Sbjct  21    TEMGP--IMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQRCFCTKPC  78



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  21    TEMGP--MRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + T    + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+GLRRRCFCT+PC
Sbjct  19    MATGPTRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGLRRRCFCTRPC  76



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  21    TEMGP--MRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  21    TEMGP--MRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + T  + + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  19    MATGPMKIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + T  + + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  19    MATGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + T  + + EAR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  15    MATGPMRIVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  72



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+GT   MVA+AR CES S +FKGPC R SNCA VC TEGF  G C+G+RRRCFCTK C
Sbjct  21    TEMGT---MVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRGIRRRCFCTKHC  77



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             T+LG   + +A AR CESPS +F+GPC+RD+NCATVC TEGF+GG CKGLR RCFCTK C
Sbjct  22    TQLGP--VTMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCTKDC  79



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + +AEAR CES S +FKGPC RDSNCA+VC TE FSGG+C G RRRCFCTKPC
Sbjct  22    MRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  74



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +FKGPC R SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27    MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 5/63 (8%)
 Frame = -3

Query  1152  LGTNT-----IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCT  988
             +G NT     I +A AR CESPS KF+GPC+RD+NCA+VC TEGF+GG+CKGLR RCFCT
Sbjct  16    IGYNTETQGPITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCT  75

Query  987   KPC  979
             + C
Sbjct  76    RDC  78



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   I+  EAR CES S +FKG CA ++NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  21    TEMGPMRIV--EARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +E+GT  +  AEAR CES S++FKG C RDSNCATVC TEGF GG+C+G RRRCFCT+ C
Sbjct  21    SEMGT--MSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC  78



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKG C R SNCA VC TEGF GG+C+G RRRCFCTK C
Sbjct  21    TEMGP---MVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRCFCTKHC  77



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21    TEMGP--MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKGPC  D+NCA+VCH E FSGG C+G RRRCFCTK C
Sbjct  21    TEMGPT--MVAEARDCESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGFRRRCFCTKHC  78



>ref|XP_010421143.1| PREDICTED: high mobility group B protein 7-like isoform X2 [Camelina 
sativa]
Length=170

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 55/68 (81%), Gaps = 3/68 (4%)
 Frame = -1

Query  755  PRVRKRVEVDSNESSQINAS---LKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIK  585
            P+ RKRVE +++ ++    +   L+RAKDGSAFARC+ CNK+V VALIS HNCSLDAKI+
Sbjct  11   PKPRKRVEAETSSNASSTTTTTTLRRAKDGSAFARCEGCNKNVAVALISMHNCSLDAKIR  70

Query  584  MNLEAQII  561
            +NLEAQ++
Sbjct  71   VNLEAQVV  78



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21    TEMGP--MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKGPC  D+NCA+VC TE FSGG C+G RRRCFCTK C
Sbjct  21    TEMGPR--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCFCTKHC  78



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +MVAEAR CES S +F G C R SNCA+VC TEGF+GG C+G RRRCFCTKPC
Sbjct  28    VMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21    TEMGP--MRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + T   MVAEAR CES S KFKGPCA D NCA+VC TE FSGG C+G RRRCFCT  C
Sbjct  19    VATGPSMVAEARTCESQSHKFKGPCASDHNCASVCQTERFSGGHCRGFRRRCFCTTHC  76



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  6     TEMGP--MRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  63



>ref|NP_001105076.1| nucleosome/chromatin assembly factor D [Zea mays]
 gb|AAL33652.1|AF440223_1 HMG type nucleosome/chromatin assembly factor D [Zea mays]
 gb|AAM93218.1|AF527617_1 nucleasome/chromatin assembly factor D protein NFD106 [Zea mays]
Length=154

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            R PTAFF+FM++FRK FK  +PD KSVATVAKEGGE+WKS+TDEEKK YI+
Sbjct  36   RSPTAFFLFMDDFRKEFKATHPDNKSVATVAKEGGERWKSMTDEEKKPYIE  86



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   I VAEAR+C+S S+ FKGPC  D +CA VC TEGF+GG C+GLRR CFCTKPC
Sbjct  21    TEMGP--IKVAEARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRRICFCTKPC  78



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   I  AEAR CES S+ FKG C RDSNCATVC TEGF GG+C+G RRRCFCT+ C
Sbjct  22    TEMGP--ISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC  79



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   I+  EAR CES S +FKGPC  D NCA+VC TE FSGG+C+G RRRCFCTKPC
Sbjct  21    TEMGPTRIV--EARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +  AE R CES S KFKGPC+RDSNCA+VC  EGF+GGDC+G RRRCFCT+ C
Sbjct  22    VKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -3

Query  1155  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             E+G   +MVAEAR CES S +FKGPCAR +NCA+VC+TEGF  G C G+RRRC CTKPC
Sbjct  23    EMG-GPVMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPC  80



>gb|EYU41881.1| hypothetical protein MIMGU_mgv1a015087mg [Erythranthe guttata]
Length=168

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKSLTD EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSLTDAEKAPY  104



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             M+ EAR CES S KFKGPC R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  26    MMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCRGFRRRCFCTKHC  77



>ref|XP_012078251.1| PREDICTED: defensin Ec-AMP-D2-like [Jatropha curcas]
 gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +FKG C R+SNCA +C TEGF GG C+GLRRRCFCTK C
Sbjct  26    MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKHC  77



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKGPC  D+NC +VC TEGFSGG C+G  RRCFCTK C
Sbjct  21    TEMGPT--MVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFCTKEC  78



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  1143  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + + VAEAR CES S +FKG C R SNCA VC TEGF GG C GLRRRCFC+KPC
Sbjct  24    DPVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGLRRRCFCSKPC  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L  +T M+AEAR CES S +FKG C   SNC +VCHTEGFSGG C+G RRRCFCT+ C
Sbjct  17    LVFSTGMIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGFRRRCFCTRHC  74



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  1152  LGTNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L +  ++V  EAR+C+S S  FKGPCARD NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  17    LASQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  75



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKGPC  D+NCA+VC TE FSGG C+G RRRC CTK C
Sbjct  21    TEMGPT--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCLCTKHC  78



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +FKG C   SNCA+VCHTEGF+GG C+G RRRCFCT+ C
Sbjct  26    MVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCRGFRRRCFCTRHC  77



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKG C   SNCA+VCHTEGF GG C+G RRRCFCT+ C
Sbjct  21    TEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFCTRHC  77



>gb|AFM82500.1| defensin [Nicotiana tabacum]
Length=77

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G    MVAEAR CES S +FKG C   SNCA+VCHTEGF GG C+G RRRCFCT+ C
Sbjct  21    TEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRCFCTRHC  77



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   + + EAR CES S +FKGPCA D NCA+VC TE FSGG+C+G RR CFCTKPC
Sbjct  21    TEMGP--MRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRLCFCTKPC  78



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + VAEAR CESPS  F+GPC R  NCA VC TEGF GG+C+GLRRRCFCT  C
Sbjct  50    VAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHC  102



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  1143  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
               ++  EAR+C+S S  FKGPCARD NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  22    EVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  76



>emb|CAJ38371.1| HMG-protein [Plantago major]
Length=212

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFR+TFK+ENP+IK+V+ V K GGEKWKSLTD EK  Y
Sbjct  101  RPPSAFFVFLEEFRQTFKKENPNIKAVSAVGKAGGEKWKSLTDAEKAPY  149



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + A  R CE+PS +FKGPC ++SNCA VC TEGF GG C+GLRRRCFCT+PC
Sbjct  50    VAAIERTCETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>ref|XP_004151187.1| PREDICTED: defensin Ec-AMP-D2-like [Cucumis sativus]
Length=74

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR+CESPS  FKG C  D+NC  +C TEGFSGG C+G RRRCFCTK C
Sbjct  22    MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC  73



>gb|AFW65042.1| hypothetical protein ZEAMMB73_846021 [Zea mays]
Length=123

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 61/110 (55%), Gaps = 18/110 (16%)
 Frame = -1

Query  752  RVRKRVEVDSNESSQINASLKRAKDGSAFARCDECNKDVPVALISFHNCSLDAKIKMNLE  573
            R RKRVE            LKR++DGSAF RC+ CNKDVPV LI  H+CSLD KI+M LE
Sbjct  12   RSRKRVEA---------TVLKRSRDGSAFTRCEACNKDVPVVLIDMHSCSLDEKIRMTLE  62

Query  572  AQIIekpaepkkkptekekARSTEpkakkekkakdpnapKRPPTAFFVFM  423
            AQ++EK  E      +K  A+                  KR PTAFF+FM
Sbjct  63   AQVVEKTVEVASADRKKSSAKG---------GGNKDAKRKRSPTAFFLFM  103



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G     VAEAR CES S +FKG C  D+NCA+VC TEGF  GDCKG RRRCFC KPC
Sbjct  21    TEMGPK---VAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC  77



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  1140  TIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             T MVAEAR CES S +FKG C   SNC +VCHTEGF+GG C+G RRRCFCT+ C
Sbjct  21    TGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  74



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + VA AR C+S S KFKGPC+RD NCATVC TEGF+ G C+GLRRRCFCT+ C
Sbjct  26    VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
              EAR CES S +FKGPC  D+NCA VCH EGF GG C+GLRRRCFCT+ C
Sbjct  28    VEARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGKCRGLRRRCFCTRHC  77



>gb|KGN62247.1| hypothetical protein Csa_2G340400 [Cucumis sativus]
Length=107

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             AEARMC+S S  F GPC RD NCA VC TEGFSGG+C G RRRCFCT  C
Sbjct  58    AEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  107



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +FKG C R+SNCA +C TEGF GG C+GLRRRCFCT  C
Sbjct  26    MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTMYC  77



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  1131  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             VAEAR CES S +FKG C R SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  27    VAEARTCESQSHRFKGICVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  1152  LGTNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L +  ++V  EAR+C S S  FKGPCARD NCA VC  EGFSGG CKG RRRCFCTK C
Sbjct  17    LASQEVVVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  75



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             AEAR CES S  FKGPC  D+NCA+VC TEGF GGDC+GLRR+CFCT+ C
Sbjct  30    AEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGLRRQCFCTRNC  79



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MV EAR CES S +FKG C   +NCA+VCHTEGF GG+C+G RRRCFCTK C
Sbjct  23    MVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGFRRRCFCTKHC  74



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  1155  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGFS G C+G RRRCFCT  C
Sbjct  23    ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR+CESPS  FKG C  D+NC  +C TEGFSGG C+G RRRCFCTK C
Sbjct  25    MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>ref|XP_012078250.1| PREDICTED: defensin-like protein [Jatropha curcas]
 gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G+    +AEAR CES S KFKG C  ++NCA VC TEGF+GGDC+GLRRRCFCT+ C
Sbjct  21    TEIGSK---MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +E+G   +  AEAR+CES S +FKGPC   SNCA VC TEGF GG C+G RRRCFCTK C
Sbjct  20    SEMG---LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC  76



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G +  MVA AR CE+PS+ FKG C  D+NCA+VC TEGF GG CKG R+RCFCTKPC
Sbjct  21    TEMGPS--MVA-ARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGFRQRCFCTKPC  77



>ref|XP_010262835.1| PREDICTED: high mobility group B protein 1-like [Nelumbo nucifera]
Length=166

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKT+K+ENP++K+V+ V K GGEKWKS++D EK  Y
Sbjct  59   RPPSAFFVFLEEFRKTYKQENPNVKAVSAVGKAGGEKWKSMSDAEKAPY  107



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +E+GT    VAEAR CES S KF+G C R+SNCA VC TEGF GG C+G+RRRCFCT+ C
Sbjct  21    SEMGTK---VAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTRLC  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAE R CES S++FKG C   SNCA VC TEGF GG+C+GLRRRCFCTK C
Sbjct  24    MVAEGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCTKHC  75



>ref|XP_004232565.1| PREDICTED: HMG1/2-like protein [Solanum lycopersicum]
Length=140

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWK L+DEEK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAVVGKAGGDKWKQLSDEEKAPY  86



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTK  985
             TE+G    MVAEAR CES S +FKGPC  D+NC +VC TEGFSGG C+G  RRCFCTK
Sbjct  21    TEMGPT--MVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFCTK  76



>ref|XP_006340837.1| PREDICTED: HMG1/2-like protein-like [Solanum tuberosum]
Length=141

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWK L+DEEK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAVVGKAGGDKWKQLSDEEKAPY  86



>emb|CAA05365.1| high mobility group protein [Solanum tuberosum]
Length=141

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWK L+DEEK  Y
Sbjct  38   RPPSAFFVFMEEFRKTYKEKHPNNKSVAVVGKAGGDKWKQLSDEEKAPY  86



>gb|EPS72658.1| hypothetical protein M569_02099 [Genlisea aurea]
Length=175

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENPD+K+V+ V K GGEKWKS+++ EK  Y
Sbjct  58   RPPSAFFVFLEEFRKTFKKENPDVKAVSAVGKAGGEKWKSMSENEKAPY  106



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   +  AEAR CES S +F G C RDSNCA++C TEGF GG+C+G RRRCFCT+ C
Sbjct  18    TEMGQ--MSSAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRGFRRRCFCTRNC  75



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +FKGPC  D+NC +VC TE F+GG C+G RRRCFCTK C
Sbjct  28    MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S++FKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  28    MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  79



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  1143  NTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
               I+  EAR+CES S  FKGPC RD NCA VC  E FSGG CKG+RRRCFCTK C
Sbjct  20    EAIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCFCTKLC  74



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +FKGPC  D+NC +VC TE F+GG C+G RRRCFCTK C
Sbjct  28    MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S++FKG C   SNCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  27    MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G+  IMV EAR C S S  FKG C  D NCATVC TEGF+ G C+G R+RCFC+KPC
Sbjct  21    TEMGS--IMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFRQRCFCSKPC  78



>ref|XP_007046509.1| High mobility group B4, putative [Theobroma cacao]
 gb|EOX90666.1| High mobility group B4, putative [Theobroma cacao]
Length=145

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KEE+PD KSV+ V K GG KWKS+T++EK  Y+
Sbjct  40   RPPSAFFVFMEEFRKQYKEEHPDNKSVSAVGKAGGAKWKSMTEDEKAPYV  89



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G+    +AEAR CES + KFKG C  ++NCA VC TEGF+GGDC+GLRRRCFCT+ C
Sbjct  21    TEIGSK---MAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   IMVAEAR CES S +FKG C  + NCA+VC+TEGF  G CKGLRRRCFC + C
Sbjct  22    TEMGP--IMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  79



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1122  ARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             AR CES S +FKGPC  + NCA+VC TEGFSGGDC+G RRRCFCT+PC
Sbjct  1     ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  48



>emb|CDP21129.1| unnamed protein product [Coffea canephora]
Length=140

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK FKEENP+ K VA V K  G+KWKS TDEEK  Y+
Sbjct  38   RPPSAFFVFMEEFRKQFKEENPNNKLVAVVGKAAGDKWKSFTDEEKAPYV  87



>ref|XP_010692886.1| PREDICTED: HMG1/2-like protein isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFR T+K+++P  KSVA V K GGEKWKSLTD EK  YI
Sbjct  39   RPPSAFFVFMEEFRVTYKQKHPQNKSVAAVGKAGGEKWKSLTDAEKAPYI  88



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
              EAR CES S +FKGPC  ++NCA VCH EGF GG C+GLRRRCFCT+ C
Sbjct  28    VEARTCESQSHRFKGPCVSENNCANVCHNEGFGGGKCRGLRRRCFCTRHC  77



>ref|XP_008243826.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Prunus 
mume]
Length=169

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK FK+ENP++K VA V K GG+KWKSL+D EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEFKKENPNVKGVAAVGKAGGDKWKSLSDAEKAPY  105



>ref|XP_009420828.1| PREDICTED: DNA-binding protein MNB1B-like [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKSL++ EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSLSEAEKAPYV  94



>ref|XP_009387918.1| PREDICTED: DNA-binding protein MNB1B-like isoform X5 [Musa acuminata 
subsp. malaccensis]
Length=141

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  1152  LGTNTIMVAEA-RMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L  +T MVAEA R CE+ S +FKG CAR +NCA VC TEGF GG C+G RRRCFCTK C
Sbjct  17    LVFSTGMVAEATRTCEAKSHRFKGICARKANCAAVCQTEGFHGGHCRGFRRRCFCTKHC  75



>ref|XP_006833354.1| PREDICTED: high mobility group B protein 1 [Amborella trichopoda]
 gb|ERM98632.1| hypothetical protein AMTR_s00109p00094550 [Amborella trichopoda]
Length=116

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AF +FM+ FR TFK+ENPD K +A V K GGEKWKS+TD+EK  YI
Sbjct  42   RPPSAFLLFMDAFRVTFKKENPDTKGIAVVGKAGGEKWKSMTDQEKASYI  91



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAEAR CES S +F+G C   SNC +VCHTEGF+GG C+G RRRCFCT+ C
Sbjct  1     MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = -3

Query  1146  TNTIMV-AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +  +MV AEAR+C S S  FKGPC R  NCA+VC TEGF GG+CKG RRRCFC KPC
Sbjct  18    SQEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_011094996.1| PREDICTED: high mobility group B protein 1 [Sesamum indicum]
 ref|XP_011094997.1| PREDICTED: high mobility group B protein 1 [Sesamum indicum]
Length=173

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEE  318
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKSLTD E
Sbjct  56   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLTDAE  100



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             ++  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  24    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_009387916.1| PREDICTED: HMG1/2-like protein isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=150

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_009387914.1| PREDICTED: HMG1/2-like protein isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=156

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MV EAR CES S +FKG C   +NCA+VC TEGF GG C+G RRRCFCTK C
Sbjct  26    MVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_010692885.1| PREDICTED: high mobility group B protein 3-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=145

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFR T+K+++P  KSVA V K GGEKWKSLTD EK  YI
Sbjct  39   RPPSAFFVFMEEFRVTYKQKHPQNKSVAAVGKAGGEKWKSLTDAEKAPYI  88



>ref|XP_008243819.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Prunus 
mume]
Length=180

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRK FK+ENP++K VA V K GG+KWKSL+D EK  Y
Sbjct  57   RPPSAFFVFLEEFRKEFKKENPNVKGVAAVGKAGGDKWKSLSDAEKAPY  105



>ref|XP_009383540.1| PREDICTED: HMG1/2-like protein [Musa acuminata subsp. malaccensis]
Length=154

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKSL++ EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSLSEAEKAPYV  94



>ref|XP_009387915.1| PREDICTED: HMG1/2-like protein isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=154

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             ++  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  24    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|NP_001238631.1| uncharacterized protein LOC100499704 [Glycine max]
 gb|ACU13314.1| unknown [Glycine max]
Length=166

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPNVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>ref|XP_006576167.1| PREDICTED: uncharacterized protein LOC100499704 isoform X1 [Glycine 
max]
 ref|XP_006576168.1| PREDICTED: uncharacterized protein LOC100499704 isoform X2 [Glycine 
max]
 ref|XP_006576169.1| PREDICTED: uncharacterized protein LOC100499704 isoform X3 [Glycine 
max]
Length=166

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPNVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>ref|XP_006576170.1| PREDICTED: uncharacterized protein LOC100499704 isoform X4 [Glycine 
max]
Length=160

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKAENPNVKAVSVVGKAGGEKWKSLSSAEKAPY  103



>gb|KJB10395.1| hypothetical protein B456_001G198900 [Gossypium raimondii]
Length=136

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE NPD +SV+ V K GGEKWKS+TD EK  Y+
Sbjct  40   RPASAFFVFMEEFRKQYKEANPDNRSVSAVGKAGGEKWKSMTDAEKAPYV  89



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             MVAE R C+S S +FKG C   SNCATVC TEGF GG C+G RRRCFCTK C
Sbjct  26    MVAEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGGHCRGFRRRCFCTKHC  77



>gb|ADD74180.2| high mobility group box 3 protein [Gossypium hirsutum]
Length=139

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRK +KE NPD +SV+ V K GGEKWKS+TD EK  Y+
Sbjct  40   RPASAFFVFMEEFRKQYKEANPDNRSVSAVGKAGGEKWKSMTDAEKAPYV  89



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 2/60 (3%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             TE+G   +MVAEAR CES S +FKG C  + NCA+VC+TEGF  G CKGLRRRCFC + C
Sbjct  18    TEMGP--VMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  75



>ref|XP_004246321.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
 ref|XP_010325790.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
 ref|XP_010325791.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
 ref|XP_010325792.1| PREDICTED: high mobility group B protein 1 [Solanum lycopersicum]
Length=176

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSAAEKSPY  103



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
              EARMCES S  F GPC   +NCA +CH EGF+ GDC+G RRRC CT+PC
Sbjct  30    VEARMCESSSQLFNGPCLSTTNCANICHNEGFTDGDCQGFRRRCICTRPC  79



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             M+AE R CE+ S KFKG C   SNCATVC TEGF GG C G+RRRCFCTK C
Sbjct  27    MLAEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGIRRRCFCTKHC  78



>ref|XP_009387913.1| PREDICTED: HMG1/2-like protein isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=157

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK+FKE+NP+ KSV+ V K GG+KWKS++++EK  Y+
Sbjct  45   RPPSAFFVFMEEFRKSFKEKNPNNKSVSVVGKAGGDKWKSMSEDEKVPYV  94



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             IMVAEAR CES S +FKG C  + NCA+VC+TEGF  G CKGLRRRCFC + C
Sbjct  28    IMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  80



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L   T MVAEAR CES S KFKG C  D NCA+VC TE F GG C+G RRRCFCT  C
Sbjct  17    LLVATEMVAEARTCESKSQKFKGACVSDRNCASVCQTERFPGGHCRGFRRRCFCTTHC  74



>gb|KCW88103.1| hypothetical protein EUGRSUZ_A00506 [Eucalyptus grandis]
Length=171

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKS++  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSMSQAEKAPY  103



>ref|XP_010028985.1| PREDICTED: high mobility group B protein 1 [Eucalyptus grandis]
 gb|KCW88104.1| hypothetical protein EUGRSUZ_A00506 [Eucalyptus grandis]
Length=172

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP+IK+V+ V K GGEKWKS++  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNIKAVSAVGKAGGEKWKSMSQAEKAPY  103



>ref|XP_006425283.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 ref|XP_006425284.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 ref|XP_006425285.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 ref|XP_006467079.1| PREDICTED: HMG1/2-like protein-like [Citrus sinensis]
 gb|ESR38523.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 gb|ESR38524.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
 gb|ESR38525.1| hypothetical protein CICLE_v10026715mg [Citrus clementina]
Length=147

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RPP+AFFVFMEEFRK FKE +P+ KSVATV K  GEKWKS++D+EK  +++
Sbjct  42   RPPSAFFVFMEEFRKQFKEAHPNNKSVATVGKAAGEKWKSMSDDEKAPFVE  92



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  1155  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGF  G C+G RRRCFCT  C
Sbjct  23    ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>ref|XP_010100630.1| High mobility group B protein 1 [Morus notabilis]
 gb|EXB83378.1| High mobility group B protein 1 [Morus notabilis]
Length=145

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYID  300
            RP +AFFVFMEEFRK++KE  PD+KSVA V K GGEKWKS++D +K  Y++
Sbjct  44   RPASAFFVFMEEFRKSYKENYPDVKSVAVVGKAGGEKWKSMSDADKAPYVE  94



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  1155  ELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             ELG   +MVAEAR CES S +F+GPC R SNCA VC TEGF  G C+G RRRCFCT  C
Sbjct  46    ELG-GPVMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>ref|XP_009103331.1| PREDICTED: high mobility group B protein 3-like [Brassica rapa]
Length=141

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+PD KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPASAFFVFMEDFRQTYKKEHPDNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_007133904.1| hypothetical protein PHAVU_010G001800g [Phaseolus vulgaris]
 gb|ESW05898.1| hypothetical protein PHAVU_010G001800g [Phaseolus vulgaris]
Length=172

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKAENPNVKAVSAVGKAGGEKWKSLSSAEKAPY  104



>emb|CDY01357.1| BnaA07g11300D [Brassica napus]
Length=141

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFME+FR+T+K+E+PD KSVA V K GGEKWKSL+D EK  Y+
Sbjct  37   RPASAFFVFMEDFRQTYKKEHPDNKSVAAVGKAGGEKWKSLSDSEKAPYV  86



>ref|XP_006366341.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366342.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Solanum 
tuberosum]
Length=175

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  55   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSLSAAEKAPY  103



>gb|KDO69008.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=129

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  103



>ref|XP_004492431.1| PREDICTED: high mobility group B protein 1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004492432.1| PREDICTED: high mobility group B protein 1-like isoform X2 [Cicer 
arietinum]
Length=173

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP +K+V+ V K GGEKWKSLT  EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKAENPTVKAVSAVGKAGGEKWKSLTKAEKAPY  104



>gb|AGV54591.1| high mobility group B protein 1 [Phaseolus vulgaris]
Length=167

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK ENP++K+V+ V K GGEKWKSL+  EK  Y
Sbjct  56   RPPSAFFVFLEEFRKTFKAENPNVKAVSAVGKAGGEKWKSLSSAEKAPY  104



>tpg|DAA62631.1| TPA: hypothetical protein ZEAMMB73_230922 [Zea mays]
Length=119

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  1131  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + EAR CES S KFKG C  ++NCA+VC TEGF+GGDC+GLRRRCFCT+ C
Sbjct  23    MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>gb|KDO69009.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=130

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  103



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  1131  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + EAR CES S ++KGPC R +NCA VC TEGFSGG C+G RRRCFC K C
Sbjct  23    LTEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCRGFRRRCFCAKHC  73



>ref|XP_010653029.1| PREDICTED: defensin-like protein 1 isoform X2 [Vitis vinifera]
Length=74

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  1149  GTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
              +  ++ +EAR+CES S KF+G C  D NCA VC  EGFSGG CKGLRRRCFCTK C
Sbjct  18    ASQMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  74



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +++G  ++   EAR CES S KFKG C R SNCA VC TEGF GG C+GLRRRCFCTK C
Sbjct  21    SDMGMTSV---EARKCESASHKFKGLCFRASNCANVCKTEGFHGGHCRGLRRRCFCTKHC  77



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             AEAR CES S +F G C R SNCA+VC TEGF GG+C+GLRRRCFCT+ C
Sbjct  26    AEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRGLRRRCFCTRNC  75



>gb|EPS64999.1| hypothetical protein M569_09780, partial [Genlisea aurea]
Length=152

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RP +AFFVFMEEFRKT+KE++P+ KSVA V K GG+KWKSL+D EK  YI
Sbjct  47   RPASAFFVFMEEFRKTYKEKHPNNKSVAAVGKAGGDKWKSLSDAEKAPYI  96



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             ++  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  3     LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L T      EAR CES S  FKG C  D+NC +VCHTEGF+GG+C+GLR+RCFCT+ C
Sbjct  19    LATGPTTRVEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGLRQRCFCTRNC  76



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +V EAR CES S KFKG C  D+NCA VCH+E FSGG C+G RRRCFCT  C
Sbjct  27    LVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRCFCTTHC  78



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  1131  VAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             VA+AR C+S S +FKG C R+SNCA +C TEGF GG+C+G RRRCFCTK C
Sbjct  26    VADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTKHC  76



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -3

Query  1137  IMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             + +  AR CES S +FKGPC+RD+NCA VC TEGF+GG CKGLR RCFCT+ C
Sbjct  26    VTMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>ref|XP_003623293.1| HMG1/2-like protein [Medicago truncatula]
 gb|AES79511.1| high mobility group (HMG)-box protein [Medicago truncatula]
 gb|AFK43669.1| unknown [Medicago truncatula]
Length=170

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+E+FRKTFK ENP++K+V+ V K GGEKWKSLT  EK  Y
Sbjct  53   RPPSAFFVFLEDFRKTFKAENPNVKAVSAVGKAGGEKWKSLTKAEKAPY  101



>tpg|DAA62629.1| TPA: hypothetical protein ZEAMMB73_230922 [Zea mays]
Length=123

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  1134  MVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +  EAR CE+ S+ F GPC   SNCA VCH EGFS GDC+G RRRC CT+PC
Sbjct  25    VTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>gb|AAM93217.1|AF527616_1 nucleasome/chromatin assembly factor D protein NFD101 [Zea mays]
 emb|CAA70045.1| HMGd1 [Zea mays]
 gb|ACF83373.1| unknown [Zea mays]
 tpg|DAA62630.1| TPA: HMG-like nucleosome/chromatin assembly factor D [Zea mays]
 gb|AIB04960.1| HMG transcription factor, partial [Zea mays]
Length=126

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>tpg|DAA62628.1| TPA: hypothetical protein ZEAMMB73_230922 [Zea mays]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFMEEFRK +KE++P++K V+ + K GG+KWKSL+D EK  Y+
Sbjct  30   RPPSAFFVFMEEFRKDYKEKHPNVKQVSVIGKAGGDKWKSLSDAEKAPYV  79



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  1158  TELGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             +E+GT    V EAR CES S +FKG C R SNCA VC TEGF GG C+GLR RCFCTK C
Sbjct  21    SEMGTK---VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  77



>ref|XP_009588564.1| PREDICTED: high mobility group B protein 1 [Nicotiana tomentosiformis]
 ref|XP_009588565.1| PREDICTED: high mobility group B protein 1 [Nicotiana tomentosiformis]
Length=172

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLY  306
            RPP+AFFVF+EEFRKTFK+ENP++K+V+ V K GGEKWKS++  EK  Y
Sbjct  54   RPPSAFFVFLEEFRKTFKKENPNVKAVSAVGKAGGEKWKSMSAAEKAPY  102



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  1152  LGTNTIMVAEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             L +  ++  E R CES S +FKG C  D NCA+VCH EGF+GG+C+G RRRCFCT+ C
Sbjct  88    LASQMMVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRGFRRRCFCTRHC  145



>gb|AHA50468.1| defensin-like protein 2 [Citrullus lanatus]
Length=78

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  1128  AEARMCESPSSKFKGPCARDSNCATVCHTEGFSGGDCKGLRRRCFCTKPC  979
             AE R+C+S S  F GPC RD NCA VC TEGFSGGDC G RRRCFCT+ C
Sbjct  29    AEGRVCKSQSHSFHGPCMRDHNCAVVCRTEGFSGGDCVGFRRRCFCTRLC  78



>gb|AAC50019.1| high mobility group protein 2 HMG2 [Ipomoea nil]
Length=146

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRKT+KE++P+ KSVA V K GG+KWK LTD EK  +I
Sbjct  38   RPPSAFFVFMEDFRKTYKEKHPNNKSVAAVGKAGGDKWKQLTDAEKAPFI  87



>ref|NP_001275787.1| group B HMG-box protein [Citrus sinensis]
 ref|XP_006435721.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 ref|XP_006435722.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 ref|XP_006486328.1| PREDICTED: high mobility group B protein 1 [Citrus sinensis]
 gb|AEV43366.1| group B HMG-box protein [Citrus sinensis]
 gb|ESR48961.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 gb|ESR48962.1| hypothetical protein CICLE_v10032930mg [Citrus clementina]
 gb|KDO69007.1| hypothetical protein CISIN_1g029982mg [Citrus sinensis]
Length=165

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEK  315
            RPP+AFFVF+EEFRK +K+E+P++K+V+ V K GGEKWKSLTD EK
Sbjct  58   RPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEK  103



>ref|XP_011074084.1| PREDICTED: HMG1/2-like protein [Sesamum indicum]
Length=140

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  452  RPPTAFFVFMEEFRKTFKEENPDIKSVATVAKEGGEKWKSLTDEEKKLYI  303
            RPP+AFFVFME+FRK +KE++P+ KSVA V K GG+KWKSL+DEEK  ++
Sbjct  38   RPPSAFFVFMEDFRKQYKEKHPNNKSVAAVGKAGGDKWKSLSDEEKAPFV  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3672979912772