BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8163

Length=917
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006355407.1|  PREDICTED: F-box protein At5g46170-like            204   1e-58   Solanum tuberosum [potatoes]
ref|XP_009625759.1|  PREDICTED: F-box protein At5g46170-like            202   5e-58   Nicotiana tomentosiformis
ref|XP_009758227.1|  PREDICTED: F-box protein At4g18380-like            201   2e-57   Nicotiana sylvestris
ref|XP_006352970.1|  PREDICTED: F-box protein At5g46170-like            200   2e-57   Solanum tuberosum [potatoes]
ref|XP_004233124.1|  PREDICTED: F-box protein At5g46170-like            198   1e-56   Solanum lycopersicum
ref|XP_004244968.1|  PREDICTED: F-box protein At5g46170-like            196   8e-56   Solanum lycopersicum
gb|EYU33385.1|  hypothetical protein MIMGU_mgv1a008110mg                196   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_011096601.1|  PREDICTED: F-box protein At4g18380-like            191   1e-53   Sesamum indicum [beniseed]
gb|EPS70457.1|  hypothetical protein M569_04296                         190   2e-53   Genlisea aurea
emb|CDP21114.1|  unnamed protein product                                189   1e-52   Coffea canephora [robusta coffee]
gb|EYU43254.1|  hypothetical protein MIMGU_mgv1a008300mg                188   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_011085237.1|  PREDICTED: F-box protein At4g18380-like            188   1e-52   Sesamum indicum [beniseed]
ref|XP_010052049.1|  PREDICTED: F-box protein At5g46170-like            186   6e-52   Eucalyptus grandis [rose gum]
ref|XP_010052048.1|  PREDICTED: F-box protein At5g46170                 186   2e-51   Eucalyptus grandis [rose gum]
emb|CBI30928.3|  unnamed protein product                                186   2e-51   Vitis vinifera
ref|XP_002278480.1|  PREDICTED: F-box protein At5g46170                 185   2e-51   Vitis vinifera
ref|XP_002305042.1|  hypothetical protein POPTR_0004s06450g             185   2e-51   
emb|CAN73778.1|  hypothetical protein VITISV_042179                     185   2e-51   Vitis vinifera
ref|XP_011035442.1|  PREDICTED: F-box protein At5g46170-like            185   2e-51   Populus euphratica
ref|XP_006468035.1|  PREDICTED: F-box protein At5g46170-like isof...    186   2e-51   Citrus sinensis [apfelsine]
ref|XP_006449020.1|  hypothetical protein CICLE_v10015378mg             186   3e-51   Citrus clementina [clementine]
ref|XP_010086997.1|  hypothetical protein L484_005892                   185   4e-51   Morus notabilis
ref|XP_012072137.1|  PREDICTED: F-box protein At5g46170-like            185   6e-51   Jatropha curcas
ref|XP_009607720.1|  PREDICTED: F-box protein At4g18380-like            184   7e-51   Nicotiana tomentosiformis
ref|XP_006283811.1|  hypothetical protein CARUB_v10004910mg             184   1e-50   
ref|XP_010518768.1|  PREDICTED: F-box protein At5g46170                 182   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_010517545.1|  PREDICTED: F-box protein At4g18380                 182   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009774076.1|  PREDICTED: F-box protein At4g18380-like            181   5e-50   Nicotiana sylvestris
ref|NP_193573.1|  F-box protein                                         181   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687117.1|  PREDICTED: F-box protein At4g18380                 181   9e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006414111.1|  hypothetical protein EUTSA_v10025383mg             180   2e-49   Eutrema salsugineum [saltwater cress]
emb|CDX87738.1|  BnaC02g32110D                                          179   2e-49   
ref|XP_007025034.1|  F-box family protein                               180   2e-49   
ref|XP_010439863.1|  PREDICTED: F-box protein At4g18380-like            180   2e-49   Camelina sativa [gold-of-pleasure]
gb|KJB68311.1|  hypothetical protein B456_010G238100                    179   3e-49   Gossypium raimondii
ref|XP_002519646.1|  conserved hypothetical protein                     180   3e-49   Ricinus communis
gb|KJB69848.1|  hypothetical protein B456_011G045900                    179   4e-49   Gossypium raimondii
gb|KJB57216.1|  hypothetical protein B456_009G154000                    179   5e-49   Gossypium raimondii
ref|XP_008225507.1|  PREDICTED: F-box protein At5g46170-like            179   5e-49   Prunus mume [ume]
ref|XP_010434544.1|  PREDICTED: F-box protein At4g18380-like            179   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_007212265.1|  hypothetical protein PRUPE_ppa006658mg             179   6e-49   Prunus persica
gb|KHG20859.1|  hypothetical protein F383_03969                         178   1e-48   Gossypium arboreum [tree cotton]
ref|XP_002870048.1|  F-box family protein                               177   1e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_006279647.1|  hypothetical protein CARUB_v10026571mg             177   2e-48   Capsella rubella
ref|XP_010441616.1|  PREDICTED: F-box protein At5g46170-like            177   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010494785.1|  PREDICTED: F-box protein At5g46170-like            177   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010481487.1|  PREDICTED: F-box protein At5g46170                 177   2e-48   Camelina sativa [gold-of-pleasure]
gb|KHG06780.1|  hypothetical protein F383_00742                         176   5e-48   Gossypium arboreum [tree cotton]
gb|KHG27594.1|  hypothetical protein F383_11279                         176   6e-48   Gossypium arboreum [tree cotton]
ref|XP_004134599.1|  PREDICTED: F-box protein At5g46170-like            176   6e-48   Cucumis sativus [cucumbers]
ref|XP_002863421.1|  F-box family protein                               176   6e-48   
ref|XP_011460217.1|  PREDICTED: F-box protein At5g46170                 176   6e-48   Fragaria vesca subsp. vesca
ref|XP_008439618.1|  PREDICTED: F-box protein At5g46170-like            176   8e-48   Cucumis melo [Oriental melon]
ref|XP_002890858.1|  F-box family protein                               175   8e-48   
ref|XP_010538543.1|  PREDICTED: F-box protein At5g46170-like            175   9e-48   Tarenaya hassleriana [spider flower]
ref|NP_199429.1|  F-box protein                                         175   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131656.1|  PREDICTED: F-box protein At4g18380                 175   1e-47   Brassica rapa
ref|XP_006307474.1|  hypothetical protein CARUB_v10009099mg             176   2e-47   
ref|XP_009360916.1|  PREDICTED: F-box protein At5g46170-like            175   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_011007418.1|  PREDICTED: F-box protein At5g46170-like            174   4e-47   Populus euphratica
ref|XP_002317281.1|  F-box family protein                               174   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010247412.1|  PREDICTED: F-box protein At5g46170                 174   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008371786.1|  PREDICTED: F-box protein At5g46170-like            173   7e-47   Malus domestica [apple tree]
ref|XP_009115183.1|  PREDICTED: F-box protein At1g30200                 172   9e-47   Brassica rapa
gb|AEX97082.1|  F-box family protein                                    173   9e-47   Malus domestica [apple tree]
ref|NP_564350.1|  F-box protein                                         172   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371620.1|  PREDICTED: F-box protein At5g46170-like            173   1e-46   
emb|CDX78848.1|  BnaA01g09150D                                          164   1e-46   
ref|XP_008444512.1|  PREDICTED: F-box protein At5g46170-like            173   1e-46   Cucumis melo [Oriental melon]
emb|CDX77641.1|  BnaC07g18950D                                          172   1e-46   
ref|XP_010478400.1|  PREDICTED: F-box protein At1g30200-like            172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010499543.1|  PREDICTED: F-box protein At1g30200-like isof...    172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007147928.1|  hypothetical protein PHAVU_006G166500g             171   3e-46   Phaseolus vulgaris [French bean]
emb|CDY43956.1|  BnaA02g24340D                                          171   3e-46   Brassica napus [oilseed rape]
emb|CDX99890.1|  BnaC05g23120D                                          171   3e-46   
ref|XP_006398302.1|  hypothetical protein EUTSA_v10000919mg             171   3e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010460807.1|  PREDICTED: F-box protein At1g30200                 171   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010549497.1|  PREDICTED: F-box protein At1g30200                 171   4e-46   Tarenaya hassleriana [spider flower]
ref|XP_004137366.1|  PREDICTED: F-box protein At5g46170-like            171   6e-46   Cucumis sativus [cucumbers]
ref|XP_009128847.1|  PREDICTED: F-box protein At5g46170-like            170   6e-46   Brassica rapa
ref|XP_006415502.1|  hypothetical protein EUTSA_v10007915mg             170   7e-46   Eutrema salsugineum [saltwater cress]
ref|XP_004486009.1|  PREDICTED: F-box protein At5g46170-like            171   7e-46   Cicer arietinum [garbanzo]
emb|CDY33458.1|  BnaA06g36150D                                          169   1e-45   Brassica napus [oilseed rape]
gb|KJB66946.1|  hypothetical protein B456_010G167400                    169   2e-45   Gossypium raimondii
ref|XP_009101540.1|  PREDICTED: F-box protein At5g46170                 169   2e-45   Brassica rapa
ref|XP_003593894.1|  F-box family protein                               169   3e-45   Medicago truncatula
ref|XP_003546077.1|  PREDICTED: F-box protein At5g46170-like            168   4e-45   Glycine max [soybeans]
ref|XP_003542943.1|  PREDICTED: F-box protein At5g46170-like isof...    166   4e-44   Glycine max [soybeans]
ref|XP_010538256.1|  PREDICTED: F-box protein At1g30200-like            164   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_010923814.1|  PREDICTED: F-box protein At5g46170-like            156   2e-40   Elaeis guineensis
gb|KHN06964.1|  F-box protein                                           148   1e-39   Glycine soja [wild soybean]
gb|KHG16115.1|  hypothetical protein F383_22310                         154   2e-39   Gossypium arboreum [tree cotton]
ref|XP_009388498.1|  PREDICTED: F-box protein At5g46170-like            152   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794503.1|  PREDICTED: F-box protein At5g46170                 147   4e-37   Phoenix dactylifera
ref|XP_006836365.1|  PREDICTED: F-box protein At5g46170                 146   1e-36   Amborella trichopoda
gb|EMS55455.1|  hypothetical protein TRIUR3_17612                       140   7e-36   Triticum urartu
ref|XP_009381298.1|  PREDICTED: F-box protein At5g46170-like            143   1e-35   
gb|EAY98656.1|  hypothetical protein OsI_20579                          143   1e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_001770045.1|  predicted protein                                  141   2e-35   
ref|XP_006646370.1|  PREDICTED: F-box protein At5g46170-like            139   3e-35   Oryza brachyantha
ref|XP_001761459.1|  predicted protein                                  140   7e-35   
gb|EMT19583.1|  hypothetical protein F775_23480                         133   1e-34   
gb|EMT17885.1|  hypothetical protein F775_06795                         134   3e-34   
ref|XP_008784858.1|  PREDICTED: F-box protein At5g46170-like            138   7e-34   Phoenix dactylifera
ref|XP_004961549.1|  PREDICTED: F-box protein At5g46170-like            138   1e-33   Setaria italica
ref|XP_009397406.1|  PREDICTED: F-box protein At5g46170-like            138   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001044377.1|  Os01g0770400                                       137   1e-33   
ref|XP_003568140.1|  PREDICTED: F-box protein At5g46170-like            137   1e-33   Brachypodium distachyon [annual false brome]
gb|EEC71551.1|  hypothetical protein OsI_03898                          137   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_009407719.1|  PREDICTED: F-box protein At5g46170-like            137   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398331.1|  PREDICTED: F-box protein At5g46170-like            137   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001056009.1|  Os05g0510400                                       136   3e-33   
ref|XP_010940976.1|  PREDICTED: F-box protein At5g46170-like            135   1e-32   Elaeis guineensis
gb|EEE55450.1|  hypothetical protein OsJ_03607                          137   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654629.1|  PREDICTED: F-box protein At5g46170-like            134   2e-32   
ref|XP_009408533.1|  PREDICTED: F-box protein At5g46170                 134   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK06381.1|  predicted protein                                      133   5e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001151107.1|  F-box domain containing protein                    133   5e-32   Zea mays [maize]
ref|XP_002442835.1|  hypothetical protein SORBIDRAFT_08g003610          131   7e-32   
ref|XP_003569912.1|  PREDICTED: F-box protein At4g18380-like            132   7e-32   Brachypodium distachyon [annual false brome]
ref|XP_009399020.1|  PREDICTED: F-box protein At5g46170-like            132   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458563.1|  hypothetical protein SORBIDRAFT_03g035810          131   3e-31   Sorghum bicolor [broomcorn]
ref|XP_002440052.1|  hypothetical protein SORBIDRAFT_09g025120          130   4e-31   
gb|ABK24885.1|  unknown                                                 129   8e-31   Picea sitchensis
ref|XP_004970106.1|  PREDICTED: F-box protein At5g46170-like            130   8e-31   Setaria italica
ref|XP_008649848.1|  PREDICTED: F-box protein At5g46170-like            128   3e-30   Zea mays [maize]
ref|XP_008672792.1|  PREDICTED: F-box domain containing protein i...    127   5e-30   
ref|XP_002455973.1|  hypothetical protein SORBIDRAFT_03g028320          127   6e-30   Sorghum bicolor [broomcorn]
ref|NP_001146920.1|  F-box domain containing protein                    127   6e-30   
gb|AFW82429.1|  F-box domain containing protein                         127   8e-30   
ref|NP_001151246.1|  F-box domain containing protein                    127   1e-29   Zea mays [maize]
gb|ADE76154.1|  unknown                                                 125   1e-29   Picea sitchensis
gb|KJB57218.1|  hypothetical protein B456_009G154000                    125   2e-29   Gossypium raimondii
ref|XP_002992968.1|  hypothetical protein SELMODRAFT_136272             124   4e-29   
ref|XP_006854457.1|  PREDICTED: F-box protein At5g46170                 122   2e-28   Amborella trichopoda
ref|XP_006836201.1|  PREDICTED: F-box protein At4g18380                 120   1e-27   Amborella trichopoda
ref|XP_002969001.1|  hypothetical protein SELMODRAFT_90428              120   2e-27   
ref|XP_010518769.1|  PREDICTED: F-box protein At5g46170-like            114   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_010907825.1|  PREDICTED: F-box protein At4g18380-like            112   6e-25   Elaeis guineensis
ref|XP_008804990.1|  PREDICTED: F-box protein At4g18380-like isof...    112   7e-25   Phoenix dactylifera
ref|XP_009404692.1|  PREDICTED: F-box protein At4g18380-like            112   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246617.1|  PREDICTED: F-box protein At4g18380-like            111   1e-24   
ref|XP_008804989.1|  PREDICTED: F-box protein At4g18380-like isof...    111   2e-24   Phoenix dactylifera
ref|XP_002441291.1|  hypothetical protein SORBIDRAFT_09g023970          110   3e-24   Sorghum bicolor [broomcorn]
ref|XP_010907539.1|  PREDICTED: F-box protein At4g18380-like            110   3e-24   Elaeis guineensis
ref|NP_001130615.1|  uncharacterized LOC100191714                       110   3e-24   Zea mays [maize]
gb|ACG44263.1|  F-box domain containing protein                         110   3e-24   Zea mays [maize]
gb|ACR36872.1|  unknown                                                 110   4e-24   Zea mays [maize]
ref|XP_004961674.1|  PREDICTED: F-box protein At4g18380-like            109   5e-24   Setaria italica
gb|EMS61747.1|  hypothetical protein TRIUR3_13519                       108   9e-24   Triticum urartu
ref|XP_003568215.1|  PREDICTED: F-box protein At5g46170-like            108   1e-23   Brachypodium distachyon [annual false brome]
gb|ACG36557.1|  F-box domain containing protein                         108   1e-23   Zea mays [maize]
gb|ACG24953.1|  F-box domain containing protein                         108   2e-23   Zea mays [maize]
ref|XP_008654796.1|  PREDICTED: uncharacterized protein LOC100279...    108   2e-23   Zea mays [maize]
ref|XP_010270680.1|  PREDICTED: F-box protein At4g18380-like            108   2e-23   Nelumbo nucifera [Indian lotus]
ref|NP_001145883.1|  uncharacterized protein LOC100279399               108   2e-23   Zea mays [maize]
ref|XP_002974774.1|  hypothetical protein SELMODRAFT_102245             108   2e-23   
gb|EMT09581.1|  hypothetical protein F775_20146                         108   2e-23   
ref|NP_001044594.1|  Os01g0812200                                       107   5e-23   
gb|EAY76237.1|  hypothetical protein OsI_04173                          107   5e-23   Oryza sativa Indica Group [Indian rice]
emb|CAN62572.1|  hypothetical protein VITISV_021321                     102   5e-23   Vitis vinifera
ref|XP_010904742.1|  PREDICTED: F-box protein At4g18380-like            106   6e-23   Elaeis guineensis
gb|AAT69637.1|  unknown protein, contains f-box domain                  106   7e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654574.1|  PREDICTED: F-box protein At4g18380-like            106   7e-23   Oryza brachyantha
ref|XP_008792446.1|  PREDICTED: F-box protein At4g18380-like            106   8e-23   Phoenix dactylifera
ref|XP_010922958.1|  PREDICTED: F-box protein At4g18380-like            106   1e-22   Elaeis guineensis
ref|NP_001055899.2|  Os05g0490300                                       106   2e-22   
ref|XP_008777014.1|  PREDICTED: F-box protein At4g18380-like            105   3e-22   Phoenix dactylifera
ref|XP_009410458.1|  PREDICTED: F-box protein At5g46170-like            104   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85411.1|  predicted protein                                      104   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB90386.1|  P0432B10.4                                             103   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420961.1|  PREDICTED: F-box protein At4g18380-like            102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786757.1|  PREDICTED: F-box protein At4g18380-like            102   1e-21   Phoenix dactylifera
emb|CDM84680.1|  unnamed protein product                                102   2e-21   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ87191.1|  predicted protein                                      101   3e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95685.1|  predicted protein                                      100   7e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009381361.1|  PREDICTED: F-box protein At4g18380-like            100   7e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75147.1|  hypothetical protein OsI_11347                          100   1e-20   Oryza sativa Indica Group [Indian rice]
gb|EMT15455.1|  hypothetical protein F775_29721                       95.1    1e-20   
ref|XP_006651329.1|  PREDICTED: F-box protein At5g46170-like          99.0    2e-20   
ref|XP_009406821.1|  PREDICTED: F-box protein At5g46170-like          98.6    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004970320.1|  PREDICTED: F-box protein At1g30200-like          98.6    4e-20   Setaria italica
ref|XP_006644887.1|  PREDICTED: F-box protein At4g18380-like          98.6    4e-20   Oryza brachyantha
ref|XP_003564454.1|  PREDICTED: F-box protein At5g46170-like          98.2    5e-20   Brachypodium distachyon [annual false brome]
ref|XP_002467943.1|  hypothetical protein SORBIDRAFT_01g036900        98.2    6e-20   Sorghum bicolor [broomcorn]
ref|NP_001049959.1|  Os03g0321300                                     97.8    7e-20   
gb|EEE58967.1|  hypothetical protein OsJ_10655                        97.8    8e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393903.1|  PREDICTED: F-box protein At4g18380-like          97.8    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558028.1|  PREDICTED: F-box protein At5g46170-like          96.3    3e-19   Brachypodium distachyon [annual false brome]
ref|NP_001182880.1|  hypothetical protein                             94.7    6e-19   Zea mays [maize]
ref|XP_002456519.1|  hypothetical protein SORBIDRAFT_03g037710        94.7    7e-19   Sorghum bicolor [broomcorn]
ref|XP_004984553.1|  PREDICTED: F-box protein At5g46170-like          94.0    2e-18   Setaria italica
gb|AFW88518.1|  hypothetical protein ZEAMMB73_307153                  89.0    2e-16   
tpg|DAA41007.1|  TPA: hypothetical protein ZEAMMB73_337936            84.7    5e-16   
ref|XP_002446238.1|  hypothetical protein SORBIDRAFT_06g008350        81.6    7e-16   
ref|NP_001132514.1|  uncharacterized protein LOC100193974             85.1    2e-15   
gb|ACG40631.1|  F-box domain containing protein                       85.1    2e-15   Zea mays [maize]
gb|EYU46210.1|  hypothetical protein MIMGU_mgv1a008386mg              80.1    1e-13   Erythranthe guttata [common monkey flower]
emb|CDP08472.1|  unnamed protein product                              80.1    1e-13   Coffea canephora [robusta coffee]
ref|XP_009804959.1|  PREDICTED: F-box protein At1g30200-like          79.3    2e-13   Nicotiana sylvestris
ref|XP_010277597.1|  PREDICTED: F-box protein At4g18380-like          78.6    5e-13   Nelumbo nucifera [Indian lotus]
emb|CBI24218.3|  unnamed protein product                              73.9    2e-11   Vitis vinifera
ref|XP_011080388.1|  PREDICTED: F-box protein At4g18380-like          73.2    3e-11   Sesamum indicum [beniseed]
ref|XP_002313372.1|  hypothetical protein POPTR_0009s05230g           72.4    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009610193.1|  PREDICTED: F-box protein At4g18380-like          71.6    1e-10   Nicotiana tomentosiformis
gb|AEW08662.1|  hypothetical protein CL1090Contig1_04                 66.6    1e-10   Pinus radiata
gb|KJB35720.1|  hypothetical protein B456_006G125400                  71.2    1e-10   Gossypium raimondii
ref|XP_011032098.1|  PREDICTED: F-box protein At4g18380-like          70.9    2e-10   Populus euphratica
gb|AFG45756.1|  hypothetical protein CL1090Contig1_04                 66.2    2e-10   Pinus taeda
ref|XP_002531125.1|  conserved hypothetical protein                   68.9    7e-10   Ricinus communis
emb|CBI19143.3|  unnamed protein product                              66.2    8e-10   Vitis vinifera
ref|XP_011464592.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  68.6    1e-09   Fragaria vesca subsp. vesca
ref|XP_010269221.1|  PREDICTED: F-box protein At1g22220-like          67.4    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010651665.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  67.8    4e-09   
ref|XP_010105899.1|  F-box protein                                    67.0    4e-09   Morus notabilis
ref|XP_002513900.1|  conserved hypothetical protein                   66.2    5e-09   Ricinus communis
ref|XP_002890500.1|  hypothetical protein ARALYDRAFT_472458           66.2    5e-09   
ref|XP_006470730.1|  PREDICTED: F-box protein At4g18380-like          66.2    6e-09   Citrus sinensis [apfelsine]
ref|XP_009786216.1|  PREDICTED: F-box protein At1g78100               66.2    6e-09   Nicotiana sylvestris
ref|XP_004139055.1|  PREDICTED: F-box protein At4g18380-like          66.2    7e-09   Cucumis sativus [cucumbers]
ref|XP_009600740.1|  PREDICTED: F-box protein At1g78100               65.5    1e-08   Nicotiana tomentosiformis
ref|XP_002279458.1|  PREDICTED: F-box protein At5g46170-like          65.1    2e-08   Vitis vinifera
ref|XP_002284195.1|  PREDICTED: F-box protein At1g22220               64.3    2e-08   Vitis vinifera
ref|NP_173641.1|  F-box protein                                       64.3    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446248.1|  hypothetical protein CICLE_v10015553mg           63.2    8e-08   
ref|XP_010521192.1|  PREDICTED: F-box protein At1g78100-like          62.8    9e-08   Tarenaya hassleriana [spider flower]
ref|XP_010535602.1|  PREDICTED: F-box protein At1g78100-like          62.0    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_008450369.1|  PREDICTED: F-box protein At4g18380-like          62.0    2e-07   Cucumis melo [Oriental melon]
gb|KFK42192.1|  hypothetical protein AALP_AA2G223400                  61.6    2e-07   Arabis alpina [alpine rockcress]
ref|XP_010428925.1|  PREDICTED: F-box protein At1g78100               61.6    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006353995.1|  PREDICTED: F-box protein At1g78100-like isof...  61.6    3e-07   Solanum tuberosum [potatoes]
ref|XP_004237895.1|  PREDICTED: F-box protein At1g78100               61.6    3e-07   Solanum lycopersicum
ref|XP_009106459.1|  PREDICTED: F-box protein At1g78100-like          61.2    3e-07   Brassica rapa
emb|CDX87476.1|  BnaA07g33970D                                        61.2    3e-07   
ref|XP_010416779.1|  PREDICTED: F-box protein At1g78100-like          61.2    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_006390021.1|  hypothetical protein EUTSA_v10018841mg           61.2    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_007015207.1|  F-box family protein, putative                   61.2    3e-07   
ref|XP_006302534.1|  hypothetical protein CARUB_v10020634mg           60.8    4e-07   Capsella rubella
ref|XP_011016269.1|  PREDICTED: F-box protein At1g22220               60.8    4e-07   Populus euphratica
ref|NP_565169.1|  F-box protein                                       60.8    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010046705.1|  PREDICTED: F-box protein At4g18380-like          60.8    5e-07   Eucalyptus grandis [rose gum]
emb|CDX88418.1|  BnaC06g38620D                                        60.5    5e-07   
ref|XP_010472011.1|  PREDICTED: F-box protein At1g78100-like          60.5    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_012067843.1|  PREDICTED: F-box protein At1g22220               60.1    6e-07   Jatropha curcas
ref|XP_008219667.1|  PREDICTED: F-box protein At1g22220               60.1    8e-07   Prunus mume [ume]
ref|XP_007227716.1|  hypothetical protein PRUPE_ppa009011mg           59.7    8e-07   
gb|KCW87201.1|  hypothetical protein EUGRSUZ_B03721                   60.1    9e-07   Eucalyptus grandis [rose gum]
ref|XP_002887721.1|  F-box family protein                             59.7    1e-06   
ref|XP_006416219.1|  hypothetical protein EUTSA_v10010014mg           59.3    1e-06   Eutrema salsugineum [saltwater cress]
gb|KFK44323.1|  hypothetical protein AALP_AA1G243300                  59.3    1e-06   Arabis alpina [alpine rockcress]
ref|XP_002307387.1|  F-box family protein                             58.9    1e-06   
emb|CBI24219.3|  unnamed protein product                              58.9    2e-06   Vitis vinifera
ref|XP_006434013.1|  hypothetical protein CICLE_v10001889mg           58.5    2e-06   Citrus clementina [clementine]
emb|CDP01036.1|  unnamed protein product                              58.9    2e-06   Coffea canephora [robusta coffee]
emb|CDY14629.1|  BnaC02g24840D                                        58.2    2e-06   Brassica napus [oilseed rape]
ref|XP_006386402.1|  hypothetical protein POPTR_0002s09520g           58.5    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009145364.1|  PREDICTED: F-box protein At1g22220-like          58.2    3e-06   Brassica rapa
emb|CDY41488.1|  BnaA08g20900D                                        58.2    3e-06   Brassica napus [oilseed rape]
ref|XP_011043565.1|  PREDICTED: F-box protein At1g22220-like          58.2    3e-06   Populus euphratica
gb|EMT09874.1|  hypothetical protein F775_42778                       54.7    4e-06   
emb|CDY21348.1|  BnaA09g30790D                                        57.8    4e-06   Brassica napus [oilseed rape]
emb|CDX91668.1|  BnaC08g05870D                                        57.4    5e-06   
ref|XP_010113152.1|  F-box protein                                    56.6    1e-05   Morus notabilis
ref|XP_009128277.1|  PREDICTED: F-box protein At1g78100-like          56.6    1e-05   Brassica rapa
emb|CDY26850.1|  BnaA02g18750D                                        56.6    1e-05   Brassica napus [oilseed rape]
ref|XP_006305384.1|  hypothetical protein CARUB_v10009775mg           55.8    2e-05   Capsella rubella
ref|XP_008374968.1|  PREDICTED: F-box protein At1g22220-like          55.5    2e-05   
emb|CDY38235.1|  BnaC05g17520D                                        55.5    2e-05   Brassica napus [oilseed rape]
ref|XP_009103251.1|  PREDICTED: F-box protein At1g22220-like          55.1    4e-05   Brassica rapa
ref|XP_010673726.1|  PREDICTED: F-box protein At1g30200-like          55.1    4e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009403217.1|  PREDICTED: F-box protein At4g18380-like          52.4    4e-05   
gb|KDO80923.1|  hypothetical protein CISIN_1g041814mg                 53.9    7e-05   Citrus sinensis [apfelsine]
emb|CDY00435.1|  BnaC07g13910D                                        53.1    1e-04   
gb|EYU23215.1|  hypothetical protein MIMGU_mgv1a021597mg              53.1    1e-04   Erythranthe guttata [common monkey flower]
ref|XP_009369664.1|  PREDICTED: F-box protein At1g22220               52.0    3e-04   Pyrus x bretschneideri [bai li]
gb|EMS50113.1|  hypothetical protein TRIUR3_22704                     52.0    3e-04   Triticum urartu



>ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=389

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRT+VPALNMRLWYAPHLE
Sbjct  269  AEHKKLESLVLTDVDGQGVLCMNREQLEELRVKPLSASSASKRTMVPALNMRLWYAPHLE  328

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSEQ KK+VVG DGNWVA+AF+EPYG AARMLVKRRTYCLEMNS
Sbjct  329  LPDGTVLKGATLVAIRPSEQPKKEVVGPDGNWVAAAFEEPYGTAARMLVKRRTYCLEMNS  388

Query  560  F  558
            F
Sbjct  389  F  389



>ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nicotiana tomentosiformis]
Length=385

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMN+EQ EELRVKPLSASSASKRT+VPALNMRLWYAPHLELPDGTVLKGATLVAIR
Sbjct  281  QGVLCMNKEQLEELRVKPLSASSASKRTMVPALNMRLWYAPHLELPDGTVLKGATLVAIR  340

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ KK+VVG DGNWV SAF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  341  PSEQPKKEVVGPDGNWVGSAFEEPYGTAARMLVKRRTYCLEMNSF  385



>ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=396

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMN+EQ EELRVKPLSASSASKRT+VPALNMRLWYAPHLELPDGTVLKGATLVAIR
Sbjct  292  QGVLCMNKEQLEELRVKPLSASSASKRTMVPALNMRLWYAPHLELPDGTVLKGATLVAIR  351

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ KK+VVG DGNWV SAF+EPYG AAR+LVKRRTYCLEMNSF
Sbjct  352  PSEQPKKEVVGPDGNWVGSAFEEPYGTAARILVKRRTYCLEMNSF  396



>ref|XP_006352970.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=367

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMN+EQ EELRVKPLSASSASKRTLVPALNMRLWYA HLE
Sbjct  247  AEHKTLDSLVLTDADGQGVLCMNKEQLEELRVKPLSASSASKRTLVPALNMRLWYAAHLE  306

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSEQ KK+VVG DGNWVA+AF EPYG AARMLVKRRTYCLEMNS
Sbjct  307  LPDGTVLKGATLVAIRPSEQPKKEVVGGDGNWVAAAFKEPYGTAARMLVKRRTYCLEMNS  366

Query  560  F  558
            F
Sbjct  367  F  367



>ref|XP_004233124.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=369

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtd-GQGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMN++Q EELRVKPLSASSASKRTLVPALNMRLWYA HLE
Sbjct  249  AEHKTLDSLVLTDADEQGVLCMNKDQLEELRVKPLSASSASKRTLVPALNMRLWYAAHLE  308

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSEQ KK+VVG+DGNWV +AF EPYG AARMLVKRRTYCLEMNS
Sbjct  309  LPDGTVLKGATLVAIRPSEQPKKEVVGADGNWVGAAFKEPYGTAARMLVKRRTYCLEMNS  368

Query  560  F  558
            F
Sbjct  369  F  369



>ref|XP_004244968.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=384

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 105/121 (87%), Gaps = 2/121 (2%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRT+VPALNMRLWYAPHLE
Sbjct  265  AEHKKLASLVLTDVDGQGVLCMNREQLEELRVKPLSASSASKRTMVPALNMRLWYAPHLE  324

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSEQ K++ VG DGNWVA+AF+EPYG AARMLVKRRTYCLEMNS
Sbjct  325  LPDGTVLKGATLVAIRPSEQPKRE-VGPDGNWVAAAFEEPYGTAARMLVKRRTYCLEMNS  383

Query  560  F  558
            F
Sbjct  384  F  384



>gb|EYU33385.1| hypothetical protein MIMGU_mgv1a008110mg [Erythranthe guttata]
Length=384

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVL MN+EQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  264  AEHKTLESLVLTDSDGQGVLSMNKEQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  323

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LP+G VLKGATLVAIRPSEQ KK+VVGS+GNWVASAF+EP+G AARMLVKRRTYCLEMNS
Sbjct  324  LPNGLVLKGATLVAIRPSEQPKKEVVGSEGNWVASAFEEPFGTAARMLVKRRTYCLEMNS  383

Query  560  F  558
            F
Sbjct  384  F  384



>ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=392

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVL MN+EQ EELRVKPLS SSA+KRTLVPALNMRLWYAPHLE
Sbjct  272  AEHKTLENLVLTDSDGQGVLSMNKEQLEELRVKPLSPSSAAKRTLVPALNMRLWYAPHLE  331

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LP+G VLKGATLVAI+PSEQ KKD+VGS+GNW+ASAF+EP+G AARMLVKRRTYCLEMNS
Sbjct  332  LPNGLVLKGATLVAIKPSEQPKKDMVGSEGNWIASAFEEPFGTAARMLVKRRTYCLEMNS  391

Query  560  F  558
            F
Sbjct  392  F  392



>gb|EPS70457.1| hypothetical protein M569_04296 [Genlisea aurea]
Length=381

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSAS ASKRTLVPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  277  QGVLSMNREQLEELRVKPLSASLASKRTLVPALNMRLWYAPHLELPNGIVLKGATLVAIR  336

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ KK++VGS+ NWVASAF+EP+G AARMLVKRRTYCLEMNSF
Sbjct  337  PSEQPKKELVGSEMNWVASAFEEPFGTAARMLVKRRTYCLEMNSF  381



>emb|CDP21114.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 104/126 (83%), Gaps = 6/126 (5%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMN+EQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  295  AEHKTLDSLVLTDADGQGVLCMNKEQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  354

Query  740  LPDGTVLKGATLVAIRPSEQH----KKDV-VGSDGNWVASAFDEPYGAAARMLVKRRTYC  576
            LPDGTVLKGATLVAIRPSEQ     KKDV   +DG+WV +AF+EPYG AARMLVKRRTYC
Sbjct  355  LPDGTVLKGATLVAIRPSEQQQLAPKKDVAAAADGSWVGAAFEEPYGTAARMLVKRRTYC  414

Query  575  LEMNSF  558
            LEMNSF
Sbjct  415  LEMNSF  420



>gb|EYU43254.1| hypothetical protein MIMGU_mgv1a008300mg [Erythranthe guttata]
Length=378

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN+EQ EELRVKPLSAS ASKRTLVPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  274  QGVLSMNKEQLEELRVKPLSASLASKRTLVPALNMRLWYAPHLELPNGMVLKGATLVAIR  333

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ KK+  GSDGNWVASAF+EP+  A+RMLVKRRTYCLEMNSF
Sbjct  334  PSEQSKKEATGSDGNWVASAFEEPFRTASRMLVKRRTYCLEMNSF  378



>ref|XP_011085237.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=388

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVL M++EQ EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  268  AEHKTLENLVLTDADGQGVLSMDKEQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLE  327

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LP+G VLKGATLVAIRPSEQ KK+VVGS+GNW+A+AFDEP+  AARMLVKRRTYCLEMNS
Sbjct  328  LPNGMVLKGATLVAIRPSEQPKKEVVGSEGNWIATAFDEPFRTAARMLVKRRTYCLEMNS  387

Query  560  F  558
            F
Sbjct  388  F  388



>ref|XP_010052049.1| PREDICTED: F-box protein At5g46170-like [Eucalyptus grandis]
 gb|KCW75905.1| hypothetical protein EUGRSUZ_D00286 [Eucalyptus grandis]
Length=384

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  265  AEHKTLDSLVLTDADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  324

Query  740  LPDGTVLKGATLVAIRPSEQHK-KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMN  564
            LPDG VLKGATLVAIRPSEQ   KD+  +DG+W+++AF+EPYG AARMLVKRRTYCLEMN
Sbjct  325  LPDGVVLKGATLVAIRPSEQSGLKDM--ADGSWISTAFEEPYGTAARMLVKRRTYCLEMN  382

Query  563  SF  558
            SF
Sbjct  383  SF  384



>ref|XP_010052048.1| PREDICTED: F-box protein At5g46170 [Eucalyptus grandis]
 gb|KCW75903.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
 gb|KCW75904.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
Length=407

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgl-tdtdGQGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     + TD DGQGVLCMNREQ EELRVKPLSASSASKRT+VPALNMRLWYAPHLE
Sbjct  287  AEHKTLDSLVLTDADGQGVLCMNREQLEELRVKPLSASSASKRTMVPALNMRLWYAPHLE  346

Query  740  LPDGTVLKGATLVAIRPSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            +PDG VLKGATLVAIRPSEQ   KKD   +DG+W+++AF+EPYG AARMLVKRRTYCLEM
Sbjct  347  MPDGVVLKGATLVAIRPSEQSGLKKDT--ADGSWISTAFEEPYGTAARMLVKRRTYCLEM  404

Query  566  NSF  558
            NSF
Sbjct  405  NSF  407



>emb|CBI30928.3| unnamed protein product [Vitis vinifera]
Length=398

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  278  AEHKTLDSLVLTDADGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  337

Query  740  LPDGTVLKGATLVAIRPSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SDG+WV++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  338  LPDGIVLKGATLVAIRPSEQSVTKKEV--SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEM  395

Query  566  NSF  558
            NSF
Sbjct  396  NSF  398



>ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 [Vitis vinifera]
Length=399

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  279  AEHKTLDSLVLTDADGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  338

Query  740  LPDGTVLKGATLVAIRPSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SDG+WV++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  339  LPDGIVLKGATLVAIRPSEQSVTKKEV--SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEM  396

Query  566  NSF  558
            NSF
Sbjct  397  NSF  399



>ref|XP_002305042.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 ref|XP_006384083.1| F-box family protein [Populus trichocarpa]
 gb|EEE85553.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 gb|ERP61880.1| F-box family protein [Populus trichocarpa]
Length=398

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  278  AEHKTLDSLVLADADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  337

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KKDV  SD +WV++ F+EPYG AA+MLVKRRTYCLEM
Sbjct  338  LPDGVVLKGATLVAIRPSEQAATKKDV--SDVSWVSTTFEEPYGTAAKMLVKRRTYCLEM  395

Query  566  NSF  558
            NSF
Sbjct  396  NSF  398



>emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera]
Length=399

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  279  AEHKTLDSLVLTDADGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  338

Query  740  LPDGTVLKGATLVAIRPSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SDG+WV++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  339  LPDGIVLKGATLVAIRPSEQSVTKKEV--SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEM  396

Query  566  NSF  558
            NSF
Sbjct  397  NSF  399



>ref|XP_011035442.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
 ref|XP_011035443.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=394

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  274  AEHKTLDSLVLADADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  333

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KKDV  SD +WV++ F+EPYG AA+MLVKRRTYCLEM
Sbjct  334  LPDGVVLKGATLVAIRPSEQAATKKDV--SDVSWVSTTFEEPYGTAAKMLVKRRTYCLEM  391

Query  566  NSF  558
            NSF
Sbjct  392  NSF  394



>ref|XP_006468035.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Citrus sinensis]
 ref|XP_006468036.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Citrus sinensis]
 gb|KDO75441.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75442.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75443.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
Length=417

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 103/123 (84%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAP+LE
Sbjct  297  AEHKTLDSLVLTDADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPYLE  356

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SDG+WV SAF+EPYG AA+MLVKRRTYCLEM
Sbjct  357  LPDGVVLKGATLVAIRPSEQSASKKEV--SDGSWVGSAFEEPYGTAAKMLVKRRTYCLEM  414

Query  566  NSF  558
            NSF
Sbjct  415  NSF  417



>ref|XP_006449020.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 ref|XP_006449021.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62260.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62261.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
Length=418

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 103/123 (84%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAP+LE
Sbjct  298  AEHKTLDSLVLTDADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPYLE  357

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SDG+WV SAF+EPYG AA+MLVKRRTYCLEM
Sbjct  358  LPDGVVLKGATLVAIRPSEQSASKKEV--SDGSWVGSAFEEPYGTAAKMLVKRRTYCLEM  415

Query  566  NSF  558
            NSF
Sbjct  416  NSF  418



>ref|XP_010086997.1| hypothetical protein L484_005892 [Morus notabilis]
 gb|EXB25437.1| hypothetical protein L484_005892 [Morus notabilis]
Length=410

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG VLKGATLVAIR
Sbjct  306  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVVLKGATLVAIR  365

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KK+V  SDG+WV++AF+EP+G AA+MLVKRRTYCLEMNSF
Sbjct  366  PSEQSAAKKEV--SDGSWVSTAFEEPFGTAAKMLVKRRTYCLEMNSF  410



>ref|XP_012072137.1| PREDICTED: F-box protein At5g46170-like [Jatropha curcas]
 gb|KDP37998.1| hypothetical protein JCGZ_04641 [Jatropha curcas]
Length=429

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 103/123 (84%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  309  AEHKTLDSLVLTDADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  368

Query  740  LPDGTVLKGATLVAIRPSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SD +WV++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  369  LPDGIVLKGATLVAIRPSEQSTTKKEV--SDSSWVSTAFEEPYGTAAKMLVKRRTYCLEM  426

Query  566  NSF  558
            NSF
Sbjct  427  NSF  429



>ref|XP_009607720.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=392

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNREQ EELRVKPLSAS ASKRTLVPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  291  QGVLCMNREQLEELRVKPLSASLASKRTLVPALNMRLWYAPHLELPNGAVLKGATLVAIR  350

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ  K     DGNW+A+AF+EPYG AARML+KRRTYCLEMNSF
Sbjct  351  PSEQSPKK---EDGNWIAAAFEEPYGTAARMLLKRRTYCLEMNSF  392



>ref|XP_006283811.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
 gb|EOA16709.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
Length=418

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 102/121 (84%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  301  AEHKTLDTLVLTDVDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  360

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+SAFDEPYG AA+MLVKRRTYCLEMNS
Sbjct  361  LPDGTVLKGATLVAIRPSES-KKEV--SDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNS  417

Query  560  F  558
            F
Sbjct  418  F  418



>ref|XP_010518768.1| PREDICTED: F-box protein At5g46170 [Tarenaya hassleriana]
Length=385

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 102/121 (84%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  268  AEHKTLDSLVLTDADGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  327

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V   D +WV+SAF+EPYG AA+MLVKRRTYCLEMNS
Sbjct  328  LPDGTVLKGATLVAIRPSES-KKEVC--DVSWVSSAFEEPYGTAAKMLVKRRTYCLEMNS  384

Query  560  F  558
            F
Sbjct  385  F  385



>ref|XP_010517545.1| PREDICTED: F-box protein At4g18380 [Camelina sativa]
Length=391

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 99/121 (82%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  274  AEHKTLDSLVLTDVDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  333

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  K+     D +WV+SAFDEPYG AA+MLVKRRTYCLEMNS
Sbjct  334  LPDGTVLKGATLVAIRPSESKKE---ACDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNS  390

Query  560  F  558
            F
Sbjct  391  F  391



>ref|XP_009774076.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=392

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNREQ EELRVKPLSAS ASKRTLVPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  291  QGVLCMNREQLEELRVKPLSASLASKRTLVPALNMRLWYAPHLELPNGAVLKGATLVAIR  350

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P EQ  K     DGNWVA+AF+EPYG AARML+KRRTYCLEMNSF
Sbjct  351  PCEQPPKK---EDGNWVAAAFEEPYGTAARMLLKRRTYCLEMNSF  392



>ref|NP_193573.1| F-box protein [Arabidopsis thaliana]
 ref|NP_001190761.1| F-box protein [Arabidopsis thaliana]
 sp|O49508.1|FB237_ARATH RecName: Full=F-box protein At4g18380 [Arabidopsis thaliana]
 emb|CAA16718.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78840.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL66803.1| At4g18380 [Arabidopsis thaliana]
 gb|AEE84037.1| F-box protein [Arabidopsis thaliana]
 gb|AEE84038.1| F-box protein [Arabidopsis thaliana]
Length=380

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  263  AEHKTLDSLVLTDVDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPSLE  322

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V   D +WV+SAFDEPYG AA+MLVKRRTYCLEMNS
Sbjct  323  LPDGTVLKGATLVAIRPSES-KKEV--CDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNS  379

Query  560  F  558
            F
Sbjct  380  F  380



>ref|XP_010687117.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687118.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   181 bits (460),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG +LKGATLVAIR
Sbjct  302  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVILKGATLVAIR  361

Query  692  PSEQH----KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ     KK++  SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  362  PSEQSGVSVKKEI--SDLSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  408



>ref|XP_006414111.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
 gb|ESQ55564.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
Length=397

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDGTVLKGATLVAIR
Sbjct  296  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLELPDGTVLKGATLVAIR  355

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  356  PSES-KKEVC--DVSWVSSAFDEPYGIAAKMLVKRRTYCLEMNSF  397



>emb|CDX87738.1| BnaC02g32110D [Brassica napus]
Length=373

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMN++Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDGTVLKGATLVAIR
Sbjct  272  QGVLCMNKDQLEELRVKPLSASSASKRTLVPALNMRLWYAPSLELPDGTVLKGATLVAIR  331

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KKDV  SD NWV+S F+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  332  PSES-KKDV--SDANWVSSVFEEPYETAAKMLVKRRTYCLEMNSF  373



>ref|XP_007025034.1| F-box family protein [Theobroma cacao]
 gb|EOY27656.1| F-box family protein [Theobroma cacao]
Length=397

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 98/107 (92%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP+LELPDG VLKGATLVAIR
Sbjct  293  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPYLELPDGVVLKGATLVAIR  352

Query  692  PSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KK+V  SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  353  PSEQSASKKEV--SDASWLSTAFEEPYGTAAKMLVKRRTYCLEMNSF  397



>ref|XP_010439863.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=419

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDG+VLKGATLVAIR
Sbjct  318  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLELPDGSVLKGATLVAIR  377

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KKD    D +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  378  PSES-KKD--ACDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNSF  419



>gb|KJB68311.1| hypothetical protein B456_010G238100 [Gossypium raimondii]
Length=378

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP+LELPDG VLKGATLVAIR
Sbjct  274  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPYLELPDGVVLKGATLVAIR  333

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ       SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  334  PSEQSASKNEVSDSSWLSNAFEEPYGTAAKMLVKRRTYCLEMNSF  378



>ref|XP_002519646.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42619.1| conserved hypothetical protein [Ricinus communis]
Length=414

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  294  AEHKTLDSLVLTDADGQGVLCMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLE  353

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDG VLKGATLVAIRPSEQ        D +WV++AF+EPYG AA+MLVKRRTYCLEMNS
Sbjct  354  LPDGIVLKGATLVAIRPSEQSTSRKEVCDASWVSTAFEEPYGTAAKMLVKRRTYCLEMNS  413

Query  560  F  558
            F
Sbjct  414  F  414



>gb|KJB69848.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
 gb|KJB69849.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
Length=399

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  279  AEHKTLDSLVLTDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLE  338

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SD +W+++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  339  LPDGIVLKGATLVAIRPSEQSASKKEV--SDASWLSTAFEEPYGTAAKMLVKRRTYCLEM  396

Query  566  NSF  558
            NSF
Sbjct  397  NSF  399



>gb|KJB57216.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
 gb|KJB57217.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=391

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMN EQ EELRVKPLSAS+ASKRTLVPALNMRLWYAPHLE
Sbjct  271  AEHKTLDSLVLTDADGQGVLCMNGEQLEELRVKPLSASAASKRTLVPALNMRLWYAPHLE  330

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VL+GATLVAIRPSEQ   KK+V  SD +W++SAF+EPYG AA+MLVKRRTYCLEM
Sbjct  331  LPDGVVLQGATLVAIRPSEQSASKKEV--SDASWLSSAFEEPYGTAAKMLVKRRTYCLEM  388

Query  566  NSF  558
            NSF
Sbjct  389  NSF  391



>ref|XP_008225507.1| PREDICTED: F-box protein At5g46170-like [Prunus mume]
Length=402

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG VLKGATLVAIR
Sbjct  296  QGVLYMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVVLKGATLVAIR  355

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ    K  V SD +WV++AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  356  PSEQSATSKKEVSSDLSWVSTAFEEPYGTAAKMLIKRRTYCLEMNSF  402



>ref|XP_010434544.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=393

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  276  AEHKTLDTLVLTDVDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  335

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  K+     D +WV+SAFDEPY  AA+MLVKRRTYCLEMNS
Sbjct  336  LPDGTVLKGATLVAIRPSESKKE---ACDVSWVSSAFDEPYVVAAKMLVKRRTYCLEMNS  392

Query  560  F  558
            F
Sbjct  393  F  393



>ref|XP_007212265.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
 gb|EMJ13464.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
Length=401

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG VLKGATLVAIR
Sbjct  295  QGVLYMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVVLKGATLVAIR  354

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ    K  V SD +WV++AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  355  PSEQSATSKKEVSSDLSWVSTAFEEPYGTAAKMLIKRRTYCLEMNSF  401



>gb|KHG20859.1| hypothetical protein F383_03969 [Gossypium arboreum]
Length=391

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMN EQ +ELRVKPLSASSASKRTLVPALNMRLWYAPHL+
Sbjct  271  AEHKTLDSLVLTDADGQGVLCMNGEQLQELRVKPLSASSASKRTLVPALNMRLWYAPHLD  330

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VL+GATLVAIRPSEQ   KK+V  SD +W++SAF+EPYG AA+MLVKRRTYCLEM
Sbjct  331  LPDGVVLQGATLVAIRPSEQSASKKEV--SDASWLSSAFEEPYGTAAKMLVKRRTYCLEM  388

Query  566  NSF  558
            NSF
Sbjct  389  NSF  391



>ref|XP_002870048.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46307.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 100/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  269  AEHKTLDSLVLTDVDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  328

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V   D +WV++AFDE YG AA+MLVKRRTYCLEMNS
Sbjct  329  LPDGTVLKGATLVAIRPSES-KKEV--CDVSWVSAAFDESYGVAAKMLVKRRTYCLEMNS  385

Query  560  F  558
            F
Sbjct  386  F  386



>ref|XP_006279647.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
 gb|EOA12545.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
Length=388

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  271  AEHKTLDSLVLTDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  330

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNS
Sbjct  331  LPDGTVLKGATLVAIRPSES-KKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNS  387

Query  560  F  558
            F
Sbjct  388  F  388



>ref|XP_010441616.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  272  AEHKTLDSLVLTDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  331

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNS
Sbjct  332  LPDGTVLKGATLVAIRPSES-KKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNS  388

Query  560  F  558
            F
Sbjct  389  F  389



>ref|XP_010494785.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  272  AEHKTLDSLVLTDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  331

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNS
Sbjct  332  LPDGTVLKGATLVAIRPSES-KKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNS  388

Query  560  F  558
            F
Sbjct  389  F  389



>ref|XP_010481487.1| PREDICTED: F-box protein At5g46170 [Camelina sativa]
Length=388

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 100/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  271  AEHKTLDSLFLTDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  330

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNS
Sbjct  331  LPDGTVLKGATLVAIRPSES-KKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNS  387

Query  560  F  558
            F
Sbjct  388  F  388



>gb|KHG06780.1| hypothetical protein F383_00742 [Gossypium arboreum]
Length=378

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP+LELPDG VLKGATLVAIR
Sbjct  274  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPYLELPDGFVLKGATLVAIR  333

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ       SD +W+++AF+ PYG AA+MLVKRRTYCLEMNSF
Sbjct  334  PSEQSASKNEVSDASWLSNAFEGPYGTAAKMLVKRRTYCLEMNSF  378



>gb|KHG27594.1| hypothetical protein F383_11279 [Gossypium arboreum]
Length=411

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 101/122 (83%), Gaps = 5/122 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  279  AEHKTLDSLVLTDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLE  338

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPSEQ   KK+V  SD +W+++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  339  LPDGVVLKGATLVAIRPSEQSASKKEV--SDASWLSTAFEEPYGTAAKMLVKRRTYCLEM  396

Query  566  NS  561
            NS
Sbjct  397  NS  398



>ref|XP_004134599.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN49409.1| hypothetical protein Csa_6G523990 [Cucumis sativus]
Length=407

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 98/107 (92%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCMN++Q EELRVKPLSAS+ASKRTLVPALNMRLWYAPHLELP G VLKGATLVAIR
Sbjct  303  QGMLCMNKDQLEELRVKPLSASTASKRTLVPALNMRLWYAPHLELPGGIVLKGATLVAIR  362

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KK+V  SDG+W+++AF+EPYG AA++LVKRRTYCLEMNSF
Sbjct  363  PSEQSMTKKEV--SDGSWLSNAFEEPYGTAAKILVKRRTYCLEMNSF  407



>ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39680.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNREQ EELRVKPL+ASSASKRTLVPALNMRLWYAP LE
Sbjct  275  AEHKTLDSLVLTDSDGQGVLCMNREQLEELRVKPLAASSASKRTLVPALNMRLWYAPTLE  334

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  K++V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNS
Sbjct  335  LPDGTVLKGATLVAIRPSES-KREV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNS  391

Query  560  F  558
            F
Sbjct  392  F  392



>ref|XP_011460217.1| PREDICTED: F-box protein At5g46170 [Fragaria vesca subsp. vesca]
Length=402

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 96/107 (90%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDG VLKGATLVAIR
Sbjct  298  QGVLYMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLELPDGVVLKGATLVAIR  357

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KK+V  SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  358  PSEQSNPKKEV--SDLSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  402



>ref|XP_008439618.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=407

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCMN++Q EELRVKPLSAS+ASKRTLVPALNMRLWYAPHLELP G +LKGATLVAIR
Sbjct  303  QGMLCMNKDQLEELRVKPLSASTASKRTLVPALNMRLWYAPHLELPGGIILKGATLVAIR  362

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KK+V  SDG+W+++AF+EPYG AA++LVKRRTYCLEMNSF
Sbjct  363  PSEQSMTKKEV--SDGSWLSNAFEEPYGTAAKILVKRRTYCLEMNSF  407



>ref|XP_002890858.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67117.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNREQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDGTVLKGATLVAIR
Sbjct  280  QGVLCMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGTVLKGATLVAIR  339

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  340  PSES-KKEVC--DASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  381



>ref|XP_010538543.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=378

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMN++Q EELR+KPLSASSASKRTLVPALNMRLWYAPHLELPDGTVL GATLVAIR
Sbjct  277  QGVLCMNKDQLEELRIKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLNGATLVAIR  336

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  K+     D +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  337  PSESKKE---ACDVSWVSSAFEEPYRTAAKMLVKRRTYCLEMNSF  378



>ref|NP_199429.1| F-box protein [Arabidopsis thaliana]
 sp|Q9FNK5.1|FB285_ARATH RecName: Full=F-box protein At5g46170 [Arabidopsis thaliana]
 dbj|BAB08262.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL49842.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13195.1| unknown protein [Arabidopsis thaliana]
 gb|AED95349.1| F-box protein [Arabidopsis thaliana]
Length=395

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 101/121 (83%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPL+ASSASKRTLVPALNMRLWYAP LE
Sbjct  278  AEHKTLDSLVLTDSDGQGVLCMNRDQLEELRVKPLAASSASKRTLVPALNMRLWYAPTLE  337

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNS
Sbjct  338  LPDGTVLKGATLVAIRPSES-KKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNS  394

Query  560  F  558
            F
Sbjct  395  F  395



>ref|XP_009131656.1| PREDICTED: F-box protein At4g18380 [Brassica rapa]
Length=377

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 99/121 (82%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  260  AEHKTLDSLVLTDTDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPSLE  319

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V   D +WV+SAFD  YG AA+MLVKRRTYCLEMNS
Sbjct  320  LPDGTVLKGATLVAIRPSES-KKEVC--DVSWVSSAFDGAYGVAAKMLVKRRTYCLEMNS  376

Query  560  F  558
            F
Sbjct  377  F  377



>ref|XP_006307474.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
 gb|EOA40372.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
Length=453

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNREQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDGTVLKGATLVAIR
Sbjct  352  QGVLCMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGTVLKGATLVAIR  411

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  412  PSES-KKEVC--DASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  453



>ref|XP_009360916.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
 ref|XP_009360917.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
Length=436

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 94/107 (88%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDG VLKGATLVAIR
Sbjct  330  QGVLHMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLELPDGVVLKGATLVAIR  389

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ    K  V SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  390  PSEQSLTAKKEVSSDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF  436



>ref|XP_011007418.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=405

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  285  AEHKTLDSLVLTDADGQGVLRMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  344

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPS+Q   KKDV  SD + +++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  345  LPDGVVLKGATLVAIRPSDQAATKKDV--SDISCLSTAFEEPYGTAAKMLVKRRTYCLEM  402

Query  566  NSF  558
            NSF
Sbjct  403  NSF  405



>ref|XP_002317281.1| F-box family protein [Populus trichocarpa]
 gb|EEE97893.1| F-box family protein [Populus trichocarpa]
Length=405

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLE
Sbjct  285  AEHKTLDSLVLTDADGQGVLRMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  344

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
            LPDG VLKGATLVAIRPS+Q   KKDV  SD + +++AF+EPYG AA+MLVKRRTYCLEM
Sbjct  345  LPDGVVLKGATLVAIRPSDQAATKKDV--SDISCLSTAFEEPYGTAAKMLVKRRTYCLEM  402

Query  566  NSF  558
            NSF
Sbjct  403  NSF  405



>ref|XP_010247412.1| PREDICTED: F-box protein At5g46170 [Nelumbo nucifera]
Length=398

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNREQ EELRVKPLSAS+AS+RTLVPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  292  QGVLCMNREQLEELRVKPLSASTASRRTLVPALNMRLWYAPHLELPNGMVLKGATLVAIR  351

Query  692  PSEQH--KKDVVGSDGNWVASAF--DEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KK++  SD +WV++AF  +EPYG AA++LVKRRTYCLEMNSF
Sbjct  352  PSEQTAAKKEI--SDSSWVSTAFEEEEPYGTAAKLLVKRRTYCLEMNSF  398



>ref|XP_008371786.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=402

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR+Q EELRVKPLSAS ASKRTLVPALNMRLWYAP LELPDG VLKGATLVAIR
Sbjct  296  QGVLHMNRDQLEELRVKPLSASLASKRTLVPALNMRLWYAPQLELPDGVVLKGATLVAIR  355

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ    K  V SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  356  PSEQSLTAKKEVSSDMSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  402



>ref|XP_009115183.1| PREDICTED: F-box protein At1g30200 [Brassica rapa]
 emb|CDY26286.1| BnaA09g26370D [Brassica napus]
Length=374

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDGTVLKGATLVAIR
Sbjct  273  QGVLSMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGTVLKGATLVAIR  332

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W+A AF+EP+G AARML+KRRTYCLEMNSF
Sbjct  333  PSES-KKEVC--DASWLADAFEEPFGTAARMLIKRRTYCLEMNSF  374



>gb|AEX97082.1| F-box family protein [Malus domestica]
Length=403

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN +Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDG VLKGATLVAIR
Sbjct  297  QGVLHMNTDQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLELPDGVVLKGATLVAIR  356

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ    K  V SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  357  PSEQSLTAKKEVSSDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF  403



>ref|NP_564350.1| F-box protein [Arabidopsis thaliana]
 ref|NP_973940.1| F-box protein [Arabidopsis thaliana]
 sp|Q9C534.1|FB19_ARATH RecName: Full=F-box protein At1g30200 [Arabidopsis thaliana]
 gb|AAG50568.1|AC073506_10 hypothetical protein [Arabidopsis thaliana]
 gb|AAG50853.1|AC074176_2 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59838.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAL24254.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAN18072.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AEE31190.1| F-box protein [Arabidopsis thaliana]
 gb|AEE31191.1| F-box protein [Arabidopsis thaliana]
Length=379

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNREQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDGTVLKGATLVAIR
Sbjct  278  QGVLCMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPELDLPDGTVLKGATLVAIR  337

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EP+G  A+ML+KRRTYCLEMNSF
Sbjct  338  PSES-KKEVC--DASWLSDAFEEPFGTVAKMLIKRRTYCLEMNSF  379



>ref|XP_008371620.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=403

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN +Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDG VLKGATLVAIR
Sbjct  297  QGVLHMNXDQLEELRVKPLSASSASKRTLVPALNMRLWYAPQLELPDGVVLKGATLVAIR  356

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ    K  V SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  357  PSEQSLTAKKEVSSDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF  403



>emb|CDX78848.1| BnaA01g09150D [Brassica napus]
Length=97

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 3/100 (3%)
 Frame = -1

Query  857  MNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH  678
            MNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDGTVLKGATLVAIRPSE  
Sbjct  1    MNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPSLELPDGTVLKGATLVAIRPSES-  59

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V   D +WV+SAFD  YG AA+MLVKRRTYCLEMNSF
Sbjct  60   KKEVC--DVSWVSSAFDGAYGVAAKMLVKRRTYCLEMNSF  97



>ref|XP_008444512.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
 ref|XP_008444520.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=406

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMN++Q EELRVKPLSASSASKRTLVPALNMRLWYA HLELP+G +LKGATLVAIR
Sbjct  302  QGVLCMNKDQLEELRVKPLSASSASKRTLVPALNMRLWYATHLELPNGLILKGATLVAIR  361

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KKDV  SD +W ++AF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  362  PSEQSAVKKDV--SDCSWASTAFEEPYRTAAKMLVKRRTYCLEMNSF  406



>emb|CDX77641.1| BnaC07g18950D [Brassica napus]
Length=362

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 4/106 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LELPDGTVLKGATLVAIR
Sbjct  260  QGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLELPDGTVLKGATLVAIR  319

Query  692  PSEQHKKDVVGSDGNWVAS-AFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  K+    SD +WV+S AF+EPY AA +MLVKR+TYCLEMNSF
Sbjct  320  PSESKKE---ASDVSWVSSAAFEEPYEAAVKMLVKRKTYCLEMNSF  362



>ref|XP_010478400.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
 ref|XP_010478401.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
Length=383

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCM+REQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDG+VLKGATLVAIR
Sbjct  282  QGVLCMDREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGSVLKGATLVAIR  341

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  342  PSES-KKEV--CDASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  383



>ref|XP_010499543.1| PREDICTED: F-box protein At1g30200-like isoform X1 [Camelina 
sativa]
 ref|XP_010499544.1| PREDICTED: F-box protein At1g30200-like isoform X2 [Camelina 
sativa]
Length=383

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCM+REQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDG+VLKGATLVAIR
Sbjct  282  QGVLCMDREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGSVLKGATLVAIR  341

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  342  PSES-KKEVC--DASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  383



>ref|XP_007147928.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
 gb|ESW19922.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
Length=379

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 94/109 (86%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG VLKGATLVAIR
Sbjct  273  QGVLYMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVVLKGATLVAIR  332

Query  692  PSEQH----KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ     KK+   SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  333  PSEQSPNTAKKE--ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  379



>emb|CDY43956.1| BnaA02g24340D [Brassica napus]
Length=373

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN++Q EELRVKPL ASSASKRTLVPALNMRLWYAP L LPDGTVLKGATLVAIR
Sbjct  272  QGVLSMNKDQLEELRVKPLLASSASKRTLVPALNMRLWYAPSLVLPDGTVLKGATLVAIR  331

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE + KDV  SD NWV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  332  PSESN-KDV--SDANWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  373



>emb|CDX99890.1| BnaC05g23120D [Brassica napus]
Length=367

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDGTVL GATLVAIR
Sbjct  266  QGVLSMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGTVLTGATLVAIR  325

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W+A AF+EP+G AARML+KRRTYCLEMNSF
Sbjct  326  PSES-KKEVC--DASWLADAFEEPFGTAARMLIKRRTYCLEMNSF  367



>ref|XP_006398302.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
 gb|ESQ39755.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
Length=387

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 99/121 (82%), Gaps = 4/121 (3%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPL ASSASKRTLVPALNMRLWYAP LE
Sbjct  270  AEHKTLNSLVLTDSDGQGVLCMNRDQLEELRVKPLLASSASKRTLVPALNMRLWYAPTLE  329

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            LPDGTVLKGATLVAIRPSE  KK+V  SD +WV+ AF+EPY  AA++LVKRRTYCLEMNS
Sbjct  330  LPDGTVLKGATLVAIRPSES-KKEV--SDISWVSLAFEEPYETAAKLLVKRRTYCLEMNS  386

Query  560  F  558
            F
Sbjct  387  F  387



>ref|XP_010460807.1| PREDICTED: F-box protein At1g30200 [Camelina sativa]
Length=384

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCM+REQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDG+VLKGATLVAIR
Sbjct  283  QGVLCMDREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPDGSVLKGATLVAIR  342

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EPYG AA+ML++RRTYCLEMNSF
Sbjct  343  PSES-KKEV--CDASWLSDAFEEPYGTAAKMLIRRRTYCLEMNSF  384



>ref|XP_010549497.1| PREDICTED: F-box protein At1g30200 [Tarenaya hassleriana]
Length=398

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWY+P L+LPDGTV KGATLVAIR
Sbjct  294  QGVLSMNREQLEELRVKPLSASSASKRTLVPALNMRLWYSPQLDLPDGTVFKGATLVAIR  353

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  ++     D +W++ +F+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  354  PSESKEEACDDDDASWLSDSFEEPYGTAAKMLIKRRTYCLEMNSF  398



>ref|XP_004137366.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 ref|XP_011649352.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN63909.1| hypothetical protein Csa_1G025900 [Cucumis sativus]
Length=406

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 4/107 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVLCMN++Q EELRVKPLSASSASKRTLVPALNMRLWYA HLELP+G +LKGATLVAIR
Sbjct  302  QGVLCMNKDQLEELRVKPLSASSASKRTLVPALNMRLWYATHLELPNGLILKGATLVAIR  361

Query  692  PSEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ   KKDV  SD  W ++AF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  362  PSEQSAAKKDV--SDCFWASTAFEEPYRTAAKMLVKRRTYCLEMNSF  406



>ref|XP_009128847.1| PREDICTED: F-box protein At5g46170-like [Brassica rapa]
Length=371

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN++Q EELRVKPL ASSASKRTLVPALNMRLWYAP L LPDGTVLKGATLVAIR
Sbjct  270  QGVLSMNKDQLEELRVKPLLASSASKRTLVPALNMRLWYAPSLVLPDGTVLKGATLVAIR  329

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE + KDV  SD NWV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  330  PSESN-KDV--SDANWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  371



>ref|XP_006415502.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
 gb|ESQ33855.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
Length=382

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRV PLSASSASKRTLVPALNMRLWYAP L+LPDGTVLKGATLVAIR
Sbjct  281  QGVLSMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPELDLPDGTVLKGATLVAIR  340

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +W++ AF+EP+G+AA+ML+KRRTYCLEMNSF
Sbjct  341  PSES-KKEVC--DASWLSDAFEEPFGSAAKMLIKRRTYCLEMNSF  382



>ref|XP_004486009.1| PREDICTED: F-box protein At5g46170-like [Cicer arietinum]
Length=402

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG VLKGATLVAIR
Sbjct  295  QGVLYMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVVLKGATLVAIR  354

Query  692  PSEQHKKDVV---GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE      V   GSD +WV++AF+EPY +AA MLVKRRTYCLEMNSF
Sbjct  355  PSELSPTSSVKKEGSDLSWVSTAFEEPYRSAAAMLVKRRTYCLEMNSF  402



>emb|CDY33458.1| BnaA06g36150D [Brassica napus]
Length=360

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 99/122 (81%), Gaps = 5/122 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  242  AEHKTLRSLVLSDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  301

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVAS-AFDEPYGAAARMLVKRRTYCLEMN  564
            LPDGTVLKGATLVAIRPSE  KK+V  SD  WV+S AF EPY AA +MLVKR+TYCLEMN
Sbjct  302  LPDGTVLKGATLVAIRPSES-KKEV--SDVLWVSSAAFGEPYKAAVKMLVKRKTYCLEMN  358

Query  563  SF  558
            SF
Sbjct  359  SF  360



>gb|KJB66946.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
 gb|KJB66947.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
Length=392

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L MNR+Q EELRVKPLSASSASKRT VPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  288  QGALRMNRDQLEELRVKPLSASSASKRTQVPALNMRLWYAPHLELPNGVVLKGATLVAIR  347

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ       SD +W+++AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  348  PSEQSASRKEVSDASWLSTAFEEPYGTAAKMLIKRRTYCLEMNSF  392



>ref|XP_009101540.1| PREDICTED: F-box protein At5g46170 [Brassica rapa]
Length=374

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 99/122 (81%), Gaps = 5/122 (4%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAP LE
Sbjct  256  AEHKTLRSLVLSDSDGQGVLCMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPTLE  315

Query  740  LPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVAS-AFDEPYGAAARMLVKRRTYCLEMN  564
            LPDGTVLKGATLVAIRPSE  KK+V  SD  WV+S AF EPY AA +MLVKR+TYCLEMN
Sbjct  316  LPDGTVLKGATLVAIRPSES-KKEV--SDVLWVSSAAFGEPYKAAVKMLVKRKTYCLEMN  372

Query  563  SF  558
            SF
Sbjct  373  SF  374



>ref|XP_003593894.1| F-box family protein [Medicago truncatula]
 gb|AES64145.1| F-box plant-like protein [Medicago truncatula]
Length=389

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR+Q EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG VLKGATLVAIR
Sbjct  283  QGVLYMNRDQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGVVLKGATLVAIR  342

Query  692  PSE----QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE      KK+  GSD +WV++AF+EPY +AA ML+KRRTYCLEMNSF
Sbjct  343  PSELSPTAGKKE--GSDLSWVSTAFEEPYRSAAAMLIKRRTYCLEMNSF  389



>ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Glycine max]
Length=385

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 93/109 (85%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLELP G VLKGATLVAIR
Sbjct  279  QGVLYMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPTGVVLKGATLVAIR  338

Query  692  PSEQH----KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ     KK+   SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  339  PSEQSPNTAKKE--ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  385



>ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Glycine max]
 ref|XP_006594509.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Glycine max]
Length=387

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 92/109 (84%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSASSASKRTLVPALNMRLWYAPHLELP G VLKGATLVAIR
Sbjct  281  QGVLYMNREQLEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPTGVVLKGATLVAIR  340

Query  692  PSE----QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE      KK+   SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  341  PSELSPNTAKKE--ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  387



>ref|XP_010538256.1| PREDICTED: F-box protein At1g30200-like [Tarenaya hassleriana]
Length=384

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR Q EELRVKPLS SSASKRTLVPALNMRLWYAP LELPDG VLKGATLV IR
Sbjct  283  QGVLSMNRGQLEELRVKPLSISSASKRTLVPALNMRLWYAPQLELPDGMVLKGATLVVIR  342

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE  KK+V   D +WV+ AF+EP+G AA+ML+KR+TYCLEMNSF
Sbjct  343  PSES-KKEVC--DTSWVSGAFEEPFGTAAKMLIKRKTYCLEMNSF  384



>ref|XP_010923814.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=401

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 5/110 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNR Q +EL+VKP+SAS  S+RTL+PAL+MRLWYAPHLELPDG VLKGATLVAIR
Sbjct  292  QGVLAMNRGQLQELQVKPVSASGNSQRTLLPALSMRLWYAPHLELPDGVVLKGATLVAIR  351

Query  692  PSEQHKKDV-----VGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++        SDG WV++AF+EPY  AA+ML+KRRTYCLEMNSF
Sbjct  352  PSEDRLREAPSGGRGSSDGCWVSNAFEEPYRTAAKMLLKRRTYCLEMNSF  401



>gb|KHN06964.1| F-box protein [Glycine soja]
Length=166

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 6/109 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            + V+  + +  + LRVKPLS SSASKRTLVPALNMRLWYAPHLELP G VLKGATLVAIR
Sbjct  60   ENVVVADGQGVKPLRVKPLSTSSASKRTLVPALNMRLWYAPHLELPTGVVLKGATLVAIR  119

Query  692  PSEQH----KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ     KK+   SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  120  PSEQSPNTAKKE--ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  166



>gb|KHG16115.1| hypothetical protein F383_22310 [Gossypium arboreum]
Length=432

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MNREQ EELRVKPLSASSASKRT VPALNMRLWYAPHLELP+G VLKGATLVAIR
Sbjct  288  QGVLRMNREQLEELRVKPLSASSASKRTQVPALNMRLWYAPHLELPNGVVLKGATLVAIR  347

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRT  582
            PSEQ       SD +W+++AF+EPYG AA+ML+KRRT
Sbjct  348  PSEQSASRKEVSDASWLSTAFEEPYGTAAKMLIKRRT  384



>ref|XP_009388498.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 10/115 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN EQ  E RVKP+SAS +S+RTLVPAL++RLWYAPHLELP G VLKGATLVA+R
Sbjct  290  QGVLTMNHEQLHEFRVKPVSASGSSQRTLVPALSIRLWYAPHLELPGGVVLKGATLVAVR  349

Query  692  PSEQHKKD--VVG--------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+  +D  +VG        SD  W+++AF+EPY +AARMLVKRRTY LEMNSF
Sbjct  350  PSEEKDRDAAIVGDCGGPVGSSDRCWISNAFEEPYRSAARMLVKRRTYSLEMNSF  404



>ref|XP_008794503.1| PREDICTED: F-box protein At5g46170 [Phoenix dactylifera]
Length=396

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 86/110 (78%), Gaps = 5/110 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN+ Q ++LRVKP+SAS  S+RTL+PAL MRL YAPHLELP G +LKGATLVAIR
Sbjct  287  QGVLAMNKGQLQDLRVKPVSASGTSQRTLLPALTMRLCYAPHLELPGGVLLKGATLVAIR  346

Query  692  PSEQHKKDVVG-----SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++  G     SDG WV+ AF+EPY  A++ML+KR TYCLEMNSF
Sbjct  347  PSEDQSREAPGGSIGSSDGCWVSHAFEEPYRTASKMLLKRTTYCLEMNSF  396



>ref|XP_006836365.1| PREDICTED: F-box protein At5g46170 [Amborella trichopoda]
 gb|ERM99218.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
Length=393

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN+EQ  ELRVKPLS  ++S RT VPALNM+LWYAP++ELP G VLKGATLVAIR
Sbjct  292  QGVLSMNKEQLHELRVKPLSPCASSSRTQVPALNMKLWYAPYMELPGGMVLKGATLVAIR  351

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ  + V   DG WV+ AF+EP+  AA +LVKRRTYCLEMNSF
Sbjct  352  PSEQPIRKV--PDG-WVSLAFEEPFRTAASLLVKRRTYCLEMNSF  393



>gb|EMS55455.1| hypothetical protein TRIUR3_17612 [Triticum urartu]
Length=229

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP GTVL GATLVAI+
Sbjct  119  QGVLTMDKWQLQELRVRPVSASGDSHRTLMPALSMRLWYAPHIELPGGTVLNGATLVAIK  178

Query  692  PSEQHKKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   D VG      + G+WV+ AF+EPY  A  +L+KRR Y LEMNSF
Sbjct  179  PSEEAMMDAVGNATAGSAGGSWVSDAFEEPYRTAVGVLLKRRMYSLEMNSF  229



>ref|XP_009381298.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381299.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381300.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 10/115 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M+R Q +E RVKP+SAS +S+RTLVPAL+MRLWYAP+LELP G VLKGAT+VA+R
Sbjct  292  QGVLTMDRRQLQEFRVKPVSASGSSQRTLVPALSMRLWYAPYLELPGGAVLKGATMVAVR  351

Query  692  PSEQHKKDVVGS----------DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS++  ++V  S          D  W++ AF+EPY +AA MLVK RTYCLEMNSF
Sbjct  352  PSQERWREVASSGEWGGSLGPLDRCWISGAFEEPYRSAAGMLVKGRTYCLEMNSF  406



>gb|EAY98656.1| hypothetical protein OsI_20579 [Oryza sativa Indica Group]
Length=412

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRVKP+SAS  S RTL+PAL+MRLWYAPH+ELP G VL GATLVAI+
Sbjct  302  QGVLTMDKWQLQELRVKPVSASGGSHRTLMPALSMRLWYAPHIELPGGLVLNGATLVAIK  361

Query  692  PSEQHKKDVVGS------DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+E+  +D VG+       G WV+ AF+EPY  A  ML+KRRTY LEMNSF
Sbjct  362  PTEEATRDTVGTGIAGSAGGCWVSDAFEEPYRTAVGMLLKRRTYSLEMNSF  412



>ref|XP_001770045.1| predicted protein [Physcomitrella patens]
 gb|EDQ65221.1| predicted protein [Physcomitrella patens]
Length=348

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCMN+EQ  E R KPL+AS++S RT VPALNM+LWYAP+LELP+GT LKGATLVAIR
Sbjct  247  QGMLCMNKEQLREFRDKPLAASASSNRTQVPALNMKLWYAPYLELPEGTGLKGATLVAIR  306

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ  +       N+V+ AF+EP+  A  +LVKRRTY LEMNSF
Sbjct  307  PSEQSARK---EAENFVSGAFEEPFKTATNLLVKRRTYLLEMNSF  348



>ref|XP_006646370.1| PREDICTED: F-box protein At5g46170-like, partial [Oryza brachyantha]
Length=275

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN+ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP G +LKGATLVAIR
Sbjct  165  QGVLTMNKRQLQELRVRPVSASGNSHRTLMPALSMRLWYAPHIELPGGQLLKGATLVAIR  224

Query  692  PSEQHKKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++  G      +  +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  225  PSEDVLREGGGVEAAGPTGASWIVDAFEEPYRTAAQVLLKRRTYSLEMNSF  275



>ref|XP_001761459.1| predicted protein [Physcomitrella patens]
 gb|EDQ73848.1| predicted protein [Physcomitrella patens]
Length=346

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 83/107 (78%), Gaps = 7/107 (7%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCMN+EQ  E R KPL+AS++S RT VPALNM+LWYAP+LELP GT LKGATLVAIR
Sbjct  245  QGMLCMNKEQLREFRDKPLAASASSNRTQVPALNMKLWYAPYLELPGGTGLKGATLVAIR  304

Query  692  PSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSEQ  HK+       N+V  AF+EP+  A  +LVKRRTY LEMNSF
Sbjct  305  PSEQPAHKE-----TENFVLGAFEEPFKTATNLLVKRRTYLLEMNSF  346



>gb|EMT19583.1| hypothetical protein F775_23480 [Aegilops tauschii]
Length=106

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 81/106 (76%), Gaps = 6/106 (6%)
 Frame = -1

Query  857  MNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH  678
            M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP GTVL GATLVAI+PSE+ 
Sbjct  1    MDKWQLQELRVRPVSASGDSHRTLMPALSMRLWYAPHIELPGGTVLNGATLVAIKPSEEA  60

Query  677  KKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
              D VG      + G+WV+ AF+EPY  A  +L+KRR Y LEMNSF
Sbjct  61   MMDAVGNATAGSAGGSWVSDAFEEPYRTAVGVLLKRRMYSLEMNSF  106



>gb|EMT17885.1| hypothetical protein F775_06795 [Aegilops tauschii]
Length=188

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M+++Q +ELRV+P+S S  S RTL+PAL MRLWYAPH+ELP G +LKGATLVAIR
Sbjct  78   QGVLTMDKKQLQELRVRPVSVSGNSHRTLMPALIMRLWYAPHIELPGGVLLKGATLVAIR  137

Query  692  PSEQHKKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS+   ++  G      +  +W++ AF+EPY  AA++L KRRTY LEMNSF
Sbjct  138  PSDDVLREGGGVEAAGPAGASWISDAFEEPYRTAAKVLFKRRTYSLEMNSF  188



>ref|XP_008784858.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
 ref|XP_008784859.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
Length=410

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL +++ Q +ELRVKP+SAS  S+RTLVPAL+MRLWYAPHLELP G VL+GATLVAIR
Sbjct  303  QGVLTLSKGQLQELRVKPVSASGMSQRTLVPALSMRLWYAPHLELPGGVVLEGATLVAIR  362

Query  692  PSEQ---HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE        +  SDG WV +AF+EPY  AA++LVKRR+YCLEMNSF
Sbjct  363  PSETPGGGGGGIGSSDGCWVLNAFEEPYRTAAKLLVKRRSYCLEMNSF  410



>ref|XP_004961549.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=410

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S+AS RTL+P L+M LWYAP +ELP G VL GATLVAI+
Sbjct  303  QGVLTMDKCQLQELRVRPVSTSAASHRTLMPELSMWLWYAPCIELPGGLVLNGATLVAIK  362

Query  692  PSEQHKKDVVG---SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+  KD+VG   S   WV  AF+EPY  AARML+KRRTY LEMNSF
Sbjct  363  PSEEATKDMVGNGASVATWVLDAFEEPYRTAARMLLKRRTYTLEMNSF  410



>ref|XP_009397406.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=408

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 8/113 (7%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M+R Q +ELR KP++AS +S+RTL+PAL+MRLWYA  LELP G VLKGATL+AIR
Sbjct  296  QGVLTMDRRQLQELRTKPVTASGSSQRTLLPALSMRLWYAHQLELPGGMVLKGATLLAIR  355

Query  692  PSEQHKKD--------VVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+  ++           SDG WV+ AF+EPY  AA ML+KRRTY LEMNSF
Sbjct  356  PSEERTREAVGGAGGSFGFSDGCWVSDAFEEPYRTAATMLMKRRTYSLEMNSF  408



>ref|NP_001044377.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAB56069.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06291.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAG88022.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP G +LKGATLVAIR
Sbjct  286  QGVLTMDKRQLQELRVRPVSASGNSHRTLMPALSMRLWYAPHIELPGGQLLKGATLVAIR  345

Query  692  PSEQHKK-----DVVGSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   +     +V G  G +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  346  PSEDVLREGGGIEVAGPTGASWILDAFEEPYRTAAQVLLKRRTYSLEMNSF  396



>ref|XP_003568140.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=420

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP GTVL GATLVAI+
Sbjct  310  QGVLTMDKWQLQELRVRPVSASDGSHRTLMPALSMRLWYAPHIELPGGTVLNGATLVAIK  369

Query  692  PSEQHKKDVV------GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   +D V       + G+WV+ AF+EPY  A RML+KRR Y LEMNSF
Sbjct  370  PSEDAMRDSVGSGAAGSAGGSWVSDAFEEPYRTAVRMLLKRRMYSLEMNSF  420



>gb|EEC71551.1| hypothetical protein OsI_03898 [Oryza sativa Indica Group]
Length=396

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP G +LKGATLVAIR
Sbjct  286  QGVLTMDKRQLQELRVRPVSASGNSHRTLMPALSMRLWYAPHIELPGGQLLKGATLVAIR  345

Query  692  PSEQHKK-----DVVGSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   +     +V G  G +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  346  PSEDVLREGGGIEVAGLTGASWILDAFEEPYRTAAQVLLKRRTYSLEMNSF  396



>ref|XP_009407719.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 10/115 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M+R Q +E R KPLSAS +S+RTLVPAL+M LWYAP+LELP G VLKGATLVA+R
Sbjct  292  QGVLTMDRWQLQEFRAKPLSASGSSQRTLVPALSMWLWYAPYLELPGGMVLKGATLVAVR  351

Query  692  PSEQHKKDVVG----------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS++   +V            SD   ++SAF+EPY +AA ML+KRRTYCLEMNSF
Sbjct  352  PSQEQGMEVASSGEFGGVVEFSDRCSISSAFEEPYRSAAGMLMKRRTYCLEMNSF  406



>ref|XP_009398331.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398332.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 5/110 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M+R Q +ELR KP+ AS  S+RTL+PAL+MRLWYA  LELPDG +LKGATL+AI+
Sbjct  290  QGVLTMDRLQLQELRGKPVMASGCSQRTLLPALSMRLWYAQQLELPDGMLLKGATLLAIK  349

Query  692  PSEQHKKDVVG-----SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+     VG     SDG  V+ AF+EPY  AA+ML+ RRTYCLEMNSF
Sbjct  350  PSEEWTTGAVGGSVGLSDGCRVSDAFEEPYRTAAKMLMNRRTYCLEMNSF  399



>ref|NP_001056009.1| Os05g0510400 [Oryza sativa Japonica Group]
 gb|AAT44135.1| putative F-box protein family [Oryza sativa Japonica Group]
 dbj|BAF17923.1| Os05g0510400 [Oryza sativa Japonica Group]
 dbj|BAG91029.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64319.1| hypothetical protein OsJ_19156 [Oryza sativa Japonica Group]
Length=412

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRVKP+SAS  S RTL+PAL+MRLWYAPH+ELP G VL GATLVAI+
Sbjct  302  QGVLTMDKWQLQELRVKPVSASGGSHRTLMPALSMRLWYAPHIELPGGLVLNGATLVAIK  361

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+E+  +D VGS         WV+ AF+EPY  A  ML+KRRTY LEMNSF
Sbjct  362  PTEEATRDTVGSGIAGSAGGCWVSDAFEEPYRTAVGMLLKRRTYSLEMNSF  412



>ref|XP_010940976.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=412

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 84/112 (75%), Gaps = 7/112 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN+ Q  +LRVKP+S S   +RTLVPAL+MRLWYAPHLELP G VL+GATLVAIR
Sbjct  301  QGVLTMNKGQLRDLRVKPVSPSGTLQRTLVPALSMRLWYAPHLELPGGVVLEGATLVAIR  360

Query  692  PSEQ-------HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE            +  SDG WV++AF+EPY  AA++LVKRR YCLEMNSF
Sbjct  361  PSETPGDGGGGGGGGIGSSDGCWVSNAFEEPYRTAAKLLVKRRNYCLEMNSF  412



>gb|EEE55450.1| hypothetical protein OsJ_03607 [Oryza sativa Japonica Group]
Length=851

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP G +LKGATLVAIR
Sbjct  741  QGVLTMDKRQLQELRVRPVSASGNSHRTLMPALSMRLWYAPHIELPGGQLLKGATLVAIR  800

Query  692  PSEQHKK-----DVVGSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   +     +V G  G +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  801  PSEDVLREGGGIEVAGPTGASWILDAFEEPYRTAAQVLLKRRTYSLEMNSF  851


 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATL  705
            QGVL M++ Q +ELRV+P+SAS  S RTL+PAL+MRLWYAPH+ELP G +LKGATL
Sbjct  556  QGVLTMDKRQLQELRVRPVSASGNSHRTLMPALSMRLWYAPHIELPGGQLLKGATL  611



>ref|XP_006654629.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=420

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 85/116 (73%), Gaps = 11/116 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELR-----VKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGAT  708
            QGVL M++ Q +ELR     VKP+SAS  S RTL+PAL+MRLWYAPH+ELP G VL GAT
Sbjct  305  QGVLTMDKWQLQELRGKPLRVKPVSASGGSHRTLMPALSMRLWYAPHIELPGGLVLNGAT  364

Query  707  LVAIRPSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            LVAI+PSE+  +D VG          WV+ AF+EPY +A RML+KRRTY LEMNSF
Sbjct  365  LVAIKPSEEASRDTVGGGIAGSAGGCWVSDAFEEPYRSAVRMLLKRRTYSLEMNSF  420



>ref|XP_009408533.1| PREDICTED: F-box protein At5g46170 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+L M+R Q +EL++KP  AS +S+RTL+PAL+MRLWYA  LELP+G VL+GATL+AIR
Sbjct  292  QGLLTMDRRQLQELKMKPWMASRSSQRTLLPALSMRLWYADQLELPNGMVLRGATLLAIR  351

Query  692  PSEQHKKD------VVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   +      +  SD  WV+ AF+EPY +A   L+KRRTYCLEMNSF
Sbjct  352  PSEEQMSEAGFSGSIGSSDNCWVSDAFEEPYKSATSTLMKRRTYCLEMNSF  402



>dbj|BAK06381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99725.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S  S RTL+PAL MRLWYAPH+ELP G +LKGATLVAIR
Sbjct  287  QGVLTMDKRQLQELRVRPVSVSGNSHRTLMPALIMRLWYAPHIELPGGVLLKGATLVAIR  346

Query  692  PSEQHKKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS+   ++  G      +  +W++ AF+EPY  AA++L KRRTY LEMNSF
Sbjct  347  PSDDVLREGGGVEAAGPAGASWISDAFEEPYRTAAKVLFKRRTYSLEMNSF  397



>ref|NP_001151107.1| F-box domain containing protein [Zea mays]
 gb|ACG41645.1| F-box domain containing protein [Zea mays]
Length=406

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 85/109 (78%), Gaps = 4/109 (4%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S +S RTL+PAL+MRL YAP +ELP GT+LKGATLVAIR
Sbjct  298  QGVLTMDKRQLQELRVRPVSPSGSSHRTLMPALSMRLHYAPLIELPGGTLLKGATLVAIR  357

Query  692  PSE---QHKKDVVGSDGN-WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   +  + V G  G  W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  358  PSEDALREGQGVAGPAGTCWISEAFEEPYRTAAKVLLKRRAYCLEMNSF  406



>ref|XP_002442835.1| hypothetical protein SORBIDRAFT_08g003610 [Sorghum bicolor]
 gb|EES16673.1| hypothetical protein SORBIDRAFT_08g003610 [Sorghum bicolor]
Length=300

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S +S RTL+PAL+MRL YAP +ELP GT+LKGATLVAIR
Sbjct  190  QGVLTMDKRQLQELRVRPVSPSESSHRTLMPALSMRLHYAPLIELPGGTLLKGATLVAIR  249

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++  G+         W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  250  PSEDALREGQGAGAAGPVGTCWISEAFEEPYRTAAKVLLKRRAYCLEMNSF  300



>ref|XP_003569912.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
 ref|XP_003569913.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
Length=396

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL MN++Q +ELRV+P+  S  S RTL+PAL MRLWYAPHLELP G +LKGATLVAIR
Sbjct  286  QGVLTMNKKQLQELRVRPVLPSGNSHRTLMPALIMRLWYAPHLELPGGVLLKGATLVAIR  345

Query  692  PSEQHKKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS+   ++  G      +  +W++ AF+EPY  AA++L KRRTY LEMNSF
Sbjct  346  PSDDVLREGGGFEAAGPAGASWISDAFEEPYRTAAKVLFKRRTYSLEMNSF  396



>ref|XP_009399020.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=397

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 9/114 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+L +NR Q +ELR KP+ +S +S RTL+PALNMRLWYA  LELP   VLKGATL+AIR
Sbjct  284  QGLLTLNRRQLQELRTKPVMSSGSSHRTLLPALNMRLWYAHQLELPGEMVLKGATLLAIR  343

Query  692  PSEQHKKDVVG---------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   + VG         SDG WV+  F+EPY  A RML+KR+T+ LEMNSF
Sbjct  344  PSEERMGEAVGGVVGQSIGFSDGCWVSDTFEEPYRTAIRMLMKRKTHSLEMNSF  397



>ref|XP_002458563.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
 gb|EES03683.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
Length=418

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S +S RTL+PAL+MRL YAP +ELP GT+LKGATLVAIR
Sbjct  308  QGVLTMDKRQLQELRVRPVSPSGSSHRTLMPALSMRLHYAPLIELPGGTLLKGATLVAIR  367

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++  G+         W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  368  PSEDALREGQGAGAAGPVGTCWISEAFEEPYRTAAKVLLKRRAYCLEMNSF  418



>ref|XP_002440052.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
 gb|EES18482.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
Length=398

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV P+S S  S RTL+P L+M LWYAP +ELP G VL GATLVAI+
Sbjct  291  QGVLTMDKCQLQELRVIPISTSRGSHRTLMPELSMWLWYAPCIELPGGLVLNGATLVAIK  350

Query  692  PSEQHKKDVV--GSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   D V  G+DG  WV  AF+EPY  A RML+KRRTY LEMNSF
Sbjct  351  PSEEGTGDTVWNGADGAAWVLDAFEEPYRTAVRMLLKRRTYSLEMNSF  398



>gb|ABK24885.1| unknown [Picea sitchensis]
 gb|ABR16398.1| unknown [Picea sitchensis]
Length=361

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 83/106 (78%), Gaps = 5/106 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCM + Q  E R KPL+AS+ + RT VPALNM+LWYAP+LELP+G  ++GATLV+IR
Sbjct  260  QGMLCMGKAQLREFRDKPLAASATASRTQVPALNMKLWYAPYLELPEGGGMEGATLVSIR  319

Query  692  PSEQ-HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS++  KKD       ++A AFDEP+GAAA+ +VK+RTY LEMNSF
Sbjct  320  PSDRPIKKDAEA----FLAGAFDEPFGAAAKEMVKKRTYLLEMNSF  361



>ref|XP_004970106.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=411

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M++ Q +ELRV+P+SAS++S RTL+PAL+MRL YAP +ELP G +LKGATLVAIR
Sbjct  300  QGELTMDKRQLQELRVRPVSASASSHRTLMPALSMRLHYAPLIELPGGMLLKGATLVAIR  359

Query  692  PSE---QHKKDVVGSDGN----WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   + +   VG+ G+    WV+ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  360  PSEDALRGEGQGVGTAGSVGTCWVSEAFEEPYRTAAKVLLKRRPYCLEMNSF  411



>ref|XP_008649848.1| PREDICTED: F-box protein At5g46170-like [Zea mays]
 gb|AFW78643.1| hypothetical protein ZEAMMB73_212566 [Zea mays]
Length=412

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S  S RTL+P L M LWYAP +ELP G +L GATLVAI+
Sbjct  305  QGVLTMDKCQLQELRVRPVSTSRGSHRTLMPELCMWLWYAPCIELPGGLLLNGATLVAIK  364

Query  692  PSEQHKKDVV---GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   D V    +D  WV  AF+EPY  AA+ML+KRRTY LEMNSF
Sbjct  365  PSEEGTGDTVWNETADAAWVLDAFEEPYRTAAKMLLKRRTYSLEMNSF  412



>ref|XP_008672792.1| PREDICTED: F-box domain containing protein isoform X1 [Zea mays]
 tpg|DAA57445.1| TPA: F-box domain containing protein [Zea mays]
Length=401

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+  S +S RTL+PAL+MRL YAP +ELP GT+LKGATLVAI+
Sbjct  291  QGVLTMDKRQLQELRVRPVFPSGSSHRTLMPALSMRLHYAPLIELPGGTLLKGATLVAIK  350

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++  G+         W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  351  PSEDALREGQGAGAAGPVGTCWISEAFEEPYRTAAKVLLKRRAYCLEMNSF  401



>ref|XP_002455973.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
 gb|EES01093.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
Length=418

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S +S RTL+PAL+MRL YAP +ELP GT+LKGATLVAIR
Sbjct  308  QGVLTMDKRQLQELRVRPVSPSESSHRTLMPALSMRLHYAPLIELPGGTLLKGATLVAIR  367

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE    +  G+         W++ A +EPY  AA++L+KRR YCLEMNSF
Sbjct  368  PSEDALSEGQGAGAAGPVGTCWISEALEEPYRTAAKVLLKRRAYCLEMNSF  418



>ref|NP_001146920.1| F-box domain containing protein [Zea mays]
 gb|ACG24418.1| F-box domain containing protein [Zea mays]
Length=406

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+  S +S RTL+PAL+MRL YAP +ELP GT+LKGATLVAI+
Sbjct  296  QGVLTMDKRQLQELRVRPVFPSGSSHRTLMPALSMRLHYAPLIELPGGTLLKGATLVAIK  355

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   ++  G+         W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  356  PSEDALREGQGAGAAGPVGTCWISEAFEEPYRTAAKVLLKRRAYCLEMNSF  406



>gb|AFW82429.1| F-box domain containing protein [Zea mays]
Length=412

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+PLS S  S RTL+P L+M LWYAP +ELP G VL GATLVAI+
Sbjct  305  QGVLTMDKCQLQELRVRPLSTSRGSHRTLMPELSMWLWYAPCIELPGGLVLNGATLVAIK  364

Query  692  PSEQHKKDVV--GSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   D V  G+ G  WV  AF+EPY  A RML+K+RTY LEMNSF
Sbjct  365  PSEEGTWDTVWNGAAGAAWVLDAFEEPYRTAVRMLLKQRTYSLEMNSF  412



>ref|NP_001151246.1| F-box domain containing protein [Zea mays]
 gb|ACG42117.1| F-box domain containing protein [Zea mays]
Length=411

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QGVL M++ Q +ELRV+P+S S  S RTL+P L+M LWYAP +ELP G VL GATLVAI+
Sbjct  304  QGVLTMDKCQLQELRVRPVSTSRGSHRTLMPELSMWLWYAPCIELPGGLVLNGATLVAIK  363

Query  692  PSEQHKKDVV--GSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE+   D V  G+ G  WV  AF+EPY  A RML+K+RTY LEMNSF
Sbjct  364  PSEEGTGDTVWNGAAGAAWVLDAFEEPYRTAVRMLLKQRTYSLEMNSF  411



>gb|ADE76154.1| unknown [Picea sitchensis]
Length=348

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM REQ  E R KPL+AS +S RT VPALNM+L YAP LELP GTV++GATLV IR
Sbjct  245  QGTLCMGREQLCEFRDKPLAASPSSNRTQVPALNMKLRYAPTLELPSGTVMQGATLVTIR  304

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS+Q       S+G ++  AF+ PY AAA++L +RRTY LEMNSF
Sbjct  305  PSDQTIAAKKESEG-FIVGAFEGPYRAAAKILSRRRTYLLEMNSF  348



>gb|KJB57218.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=369

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 81/123 (66%), Gaps = 27/123 (22%)
 Frame = -1

Query  917  AEHKlg*xgltdtdG-QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLE  741
            AEHK     +      QGVLCMN EQ EELRVKPLSAS+ASKRTLVPALNMRLW      
Sbjct  271  AEHKTLDSLVLTDADGQGVLCMNGEQLEELRVKPLSASAASKRTLVPALNMRLW------  324

Query  740  LPDGTVLKGATLVAIRPSEQ--HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEM  567
                            PSEQ   KK+V  SD +W++SAF+EPYG AA+MLVKRRTYCLEM
Sbjct  325  ----------------PSEQSASKKEV--SDASWLSSAFEEPYGTAAKMLVKRRTYCLEM  366

Query  566  NSF  558
            NSF
Sbjct  367  NSF  369



>ref|XP_002992968.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
 gb|EFJ05914.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
Length=373

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASS-ASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAI  696
            QG LCM++EQ  E R  P++A+S +S RT VPALNM+LWYAP L LPDGT+L+GATLVAI
Sbjct  271  QGTLCMSKEQLCEFRDSPIAAASVSSNRTQVPALNMKLWYAPLLPLPDGTLLRGATLVAI  330

Query  695  RPSEQ-HKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            RPS+    KD+     + VA AF EPY +AA +LVKRRTY LEMN+F
Sbjct  331  RPSDTPAPKDL----QSLVAGAFQEPYASAASLLVKRRTYLLEMNAF  373



>ref|XP_006854457.1| PREDICTED: F-box protein At5g46170 [Amborella trichopoda]
 gb|ERN15924.1| hypothetical protein AMTR_s00039p00227540 [Amborella trichopoda]
Length=354

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 80/107 (75%), Gaps = 6/107 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+L MN  Q  E+RVKP+SAS+++ RT VPAL+M+LWYAP++ELP+G   KGATLV IR
Sbjct  252  QGILSMNSGQLSEIRVKPISASASANRTQVPALSMKLWYAPYIELPNGMGFKGATLVFIR  311

Query  692  PSEQHKKDVVGSD--GNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS++     +G +    +V+ AFD  YG  AR+LVKR+TY LEMNSF
Sbjct  312  PSDRP----MGKEEADQFVSMAFDGAYGEVARLLVKRKTYILEMNSF  354



>ref|XP_006836201.1| PREDICTED: F-box protein At4g18380 [Amborella trichopoda]
 ref|XP_011620703.1| PREDICTED: F-box protein At4g18380 [Amborella trichopoda]
 gb|ERM99054.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda]
Length=348

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 77/112 (69%), Gaps = 12/112 (11%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R KPL+AS+ S RT VPALNM+L YAP+LELPDG  ++GATLVAI+
Sbjct  242  QGTLSMGIEQLREFREKPLAASAGSSRTQVPALNMKLRYAPYLELPDGMGMQGATLVAIK  301

Query  692  PSEQHKKDVVGSDGN-------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +     +GS GN       +V  AFD P+ AA + LVKRRTY LEMNSF
Sbjct  302  PSGE-----LGSGGNSKREAEAFVCGAFDGPFKAAVKALVKRRTYLLEMNSF  348



>ref|XP_002969001.1| hypothetical protein SELMODRAFT_90428 [Selaginella moellendorffii]
 ref|XP_002990664.1| hypothetical protein SELMODRAFT_132039 [Selaginella moellendorffii]
 gb|EFJ08296.1| hypothetical protein SELMODRAFT_132039 [Selaginella moellendorffii]
 gb|EFJ30117.1| hypothetical protein SELMODRAFT_90428 [Selaginella moellendorffii]
Length=364

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCM++ Q  + R KP++AS++S RT VP LNM+LWYAP L LP+G  +KG TLVAIR
Sbjct  263  QGLLCMSKRQLHDFRDKPVAASASSSRTQVPDLNMKLWYAPSLSLPNGCSMKGVTLVAIR  322

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PSE   +     D  ++A AF EP+  AA +L +RRTY LEMNSF
Sbjct  323  PSE---RPTTKEDDGFIARAFGEPFKTAACLLARRRTYLLEMNSF  364



>ref|XP_010518769.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=168

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = -1

Query  917  AEHKlg*xgltdtdGQGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLEL  738
            AEHKL     TD +GQGVL MNR Q EELR KPLS S+   RTLVP +N+ LWY PHLEL
Sbjct  51   AEHKLDSLVFTDAEGQGVLSMNRGQLEELRAKPLSDSN---RTLVPDMNVNLWYLPHLEL  107

Query  737  PDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P GTVLKGATL+A+ P E  K         WV SAF+EPY  AA+ML K R Y   + SF
Sbjct  108  PGGTVLKGATLIAMAPREAKKMTPCPP---WVYSAFEEPYRTAAKMLFKTRGYRSVLKSF  164



>ref|XP_010907825.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 76/114 (67%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R KPL+AS++S RT VPA NM+L YAP+LELP+G  ++GATLVAI+
Sbjct  247  QGTLTMGVEQLREFREKPLAASASSSRTQVPASNMKLRYAPYLELPEGMGMQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      GS GN         +++ AFD P+ AA + LVKRRTY LEMN F
Sbjct  307  PAGE------GSSGNNSSRKEVEAFISGAFDGPFKAAVKALVKRRTYLLEMNGF  354



>ref|XP_008804990.1| PREDICTED: F-box protein At4g18380-like isoform X2 [Phoenix dactylifera]
Length=354

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S RT VPA NM+L YAP+LELP+G  ++GATLVAI+
Sbjct  247  QGTLSMGVEQLKEFREKPLAASASSSRTQVPASNMKLRYAPYLELPEGMGMQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      GS+ +      +V+ AFD P+ AAA+ LVKRRTY LEMN F
Sbjct  307  PAGE---GTSGSNSSRKEAEAFVSGAFDGPFKAAAKALVKRRTYLLEMNGF  354



>ref|XP_009404692.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404693.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=384

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 13/113 (12%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  +Q +E R KPL+AS++S RT VPA NM+L Y P+LELP+G  L+GATLVAI+
Sbjct  277  QGTLTMGADQLKEFREKPLAASASSNRTQVPASNMKLRYTPYLELPEGMALQGATLVAIK  336

Query  692  PSEQHKKDVVGSDGN--------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+E+       S GN        +V  AFD P+ AAA+ L+KRRTY LEMN F
Sbjct  337  PAEEGT-----SSGNCSRKDAEAFVCGAFDGPFQAAAKALLKRRTYLLEMNGF  384



>ref|XP_010246617.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246618.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246619.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246620.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246621.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 8/109 (7%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S+RT VPA NM+L YAP+L+LP G  ++GATLVAIR
Sbjct  247  QGTLSMGIEQLKEFREKPLAASASSRRTQVPASNMKLRYAPYLDLPKGLGMQGATLVAIR  306

Query  692  P----SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P    S  +KK+V      +V  AFD P+ AA + LVKRRTY LEMN F
Sbjct  307  PAGEGSGSNKKEVEA----FVHGAFDGPFKAAVKALVKRRTYLLEMNGF  351



>ref|XP_008804989.1| PREDICTED: F-box protein At4g18380-like isoform X1 [Phoenix dactylifera]
Length=421

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%), Gaps = 9/111 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S RT VPA NM+L YAP+LELP+G  ++GATLVAI+
Sbjct  314  QGTLSMGVEQLKEFREKPLAASASSSRTQVPASNMKLRYAPYLELPEGMGMQGATLVAIK  373

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      GS+ +      +V+ AFD P+ AAA+ LVKRRTY LEMN F
Sbjct  374  PAGE---GTSGSNSSRKEAEAFVSGAFDGPFKAAAKALVKRRTYLLEMNGF  421



>ref|XP_002441291.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
 gb|EES19721.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
Length=354

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDG---------NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G          +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPE------GSNGGHPNRKEADGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF  354



>ref|XP_010907539.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010907541.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S RT VPA NM+L YAP+LELP+G  ++GATLVAI+
Sbjct  247  QGTLSMGMEQLKEFREKPLAASASSCRTQVPASNMKLRYAPYLELPEGMGMQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +       S      +V+ AFD P+ AAA+ LVKRRTY LEMN F
Sbjct  307  PAGEGSSCSTSSRKEAEAFVSGAFDGPFKAAAKALVKRRTYLLEMNGF  354



>ref|NP_001130615.1| uncharacterized LOC100191714 [Zea mays]
 gb|ACF78905.1| unknown [Zea mays]
 gb|ACF81071.1| unknown [Zea mays]
 gb|ACL52912.1| unknown [Zea mays]
 gb|ACR35595.1| unknown [Zea mays]
 gb|AFW78474.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW78475.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        GS+G+         +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPD------GSNGSHPNRKEADAFVFGAFDGPFKAAVKALMKRRTYLLEMNGF  354



>gb|ACG44263.1| F-box domain containing protein [Zea mays]
Length=354

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        GS+G+         +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPD------GSNGSHPNRKEADAFVFGAFDGPFKAAVKALMKRRTYLLEMNGF  354



>gb|ACR36872.1| unknown [Zea mays]
Length=354

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  +Q EE R   LSAS+ S RT VPA NM+L YAP++ELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAKQLEEFRENQLSASACSNRTQVPACNMKLKYAPYVELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G+         +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPE------GSNGSHPNRKEAEGFVFGAFDGPFKAAVKTLMKRRTYLLEMNGF  354



>ref|XP_004961674.1| PREDICTED: F-box protein At4g18380-like [Setaria italica]
Length=354

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ +E R   LSAS+ S RT VPA NM+L Y+P+LELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYSPYLELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G          +++ AFD P+  A + L+KRRTY LEMN F
Sbjct  307  PSTE------GSNGGHTSRKETDAFISGAFDGPFKVAVKALMKRRTYLLEMNGF  354



>gb|EMS61747.1| hypothetical protein TRIUR3_13519 [Triticum urartu]
Length=305

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  198  QGTLTMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGIALQGATLVAIK  257

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G          +++ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  258  PSTE------GSNGGHISRKETDAFISGAFDGPFKFAAKALMKRRTYLLEMNGF  305



>ref|XP_003568215.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=356

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 75/114 (66%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ +E R   LSAS+ S RT VPA +M+L YAP+LELP G  L+GATLVAI+
Sbjct  249  QGTLCMGAEQLKEFRENQLSASACSNRTQVPACSMKLKYAPYLELPGGIALQGATLVAIK  308

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      GS+G+         +++ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  309  PATE------GSNGSHISRKETDAFISGAFDGPFKFAAKALMKRRTYLLEMNGF  356



>gb|ACG36557.1| F-box domain containing protein [Zea mays]
Length=354

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  +Q EE R   LSAS+ S RT VPA NM+L YAP++ELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAKQLEEFRENQLSASACSNRTQVPACNMKLKYAPYVELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G+         +V  AFD P+  A + L+KRRTY LEMN F
Sbjct  307  PSPE------GSNGSHPNRKEAEGFVFGAFDGPFKVAVKTLMKRRTYLLEMNGF  354



>gb|ACG24953.1| F-box domain containing protein [Zea mays]
Length=354

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  +Q EE R   LS S+ S RT VPA NM+L YAP++ELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAKQLEEFRENQLSTSACSNRTQVPACNMKLKYAPYVELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G+         +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPE------GSNGSHPNRKEAEGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF  354



>ref|XP_008654796.1| PREDICTED: uncharacterized protein LOC100279399 isoform X1 [Zea 
mays]
 gb|ACF85349.1| unknown [Zea mays]
 gb|AFW82355.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW82356.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  +Q EE R   LS S+ S RT VPA NM+L YAP++ELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAKQLEEFRENQLSTSACSNRTQVPACNMKLKYAPYVELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G+         +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPE------GSNGSHPNRKEAEGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF  354



>ref|XP_010270680.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010270681.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S+RT VPA NM+L YAP+L+LP+G  ++GATLV IR
Sbjct  247  QGTLSMGIEQLKEFREKPLAASASSRRTQVPASNMKLRYAPYLDLPEGLGMQGATLVVIR  306

Query  692  PSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             S +  +        +V  AFD P+ AA + LVKRRTY LEMN F
Sbjct  307  TSGEGSRSNKMEVEAFVHGAFDGPFKAAVKALVKRRTYLLEMNGF  351



>ref|NP_001145883.1| uncharacterized protein LOC100279399 [Zea mays]
 gb|ACL52786.1| unknown [Zea mays]
Length=354

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  +Q EE R   LS S+ S RT VPA NM+L YAP++ELP G  L+GATLVAI+
Sbjct  247  QGTLCMGAKQLEEFRENQLSTSACSNRTQVPACNMKLKYAPYVELPGGMALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G+         +V  AFD P+ AA + L+KRRTY LEMN F
Sbjct  307  PSPE------GSNGSHPNRKEAEGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF  354



>ref|XP_002974774.1| hypothetical protein SELMODRAFT_102245 [Selaginella moellendorffii]
 gb|EFJ24294.1| hypothetical protein SELMODRAFT_102245 [Selaginella moellendorffii]
Length=343

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 75/119 (63%), Gaps = 23/119 (19%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSAS-KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAI  696
            QG+LCM++EQ ++ R KPL  SSAS  RT VP+LN++LWYAPH+ELP G  LKGATLV+I
Sbjct  234  QGMLCMDKEQLQQSRDKPLPPSSASSNRTQVPSLNVKLWYAPHIELPGGVALKGATLVSI  293

Query  695  RP-------------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            RP                H+ +V          AF++P+  AA  LVKRRTY LEM SF
Sbjct  294  RPSGDGSGGGGGGDGDGNHRVEV---------EAFEQPFQTAAEELVKRRTYLLEMKSF  343



>gb|EMT09581.1| hypothetical protein F775_20146 [Aegilops tauschii]
Length=356

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  249  QGTLTMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGIALQGATLVAIK  308

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G          +++ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  309  PSTE------GSNGGHVSRKETDAFISGAFDGPFKFAAKALMKRRTYLLEMNGF  356



>ref|NP_001044594.1| Os01g0812200 [Oryza sativa Japonica Group]
 dbj|BAD68209.1| F-box protein family-like [Oryza sativa Japonica Group]
 dbj|BAF06508.1| Os01g0812200 [Oryza sativa Japonica Group]
 gb|EAZ13910.1| hypothetical protein OsJ_03835 [Oryza sativa Japonica Group]
 dbj|BAG93081.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 71/113 (63%), Gaps = 13/113 (12%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLV I+
Sbjct  246  QGTLYMGMEQLREFRENKLSASACSNRTQVPACNMKLKYAPYLELPGGMTLQGATLVVIK  305

Query  692  PSEQHKKDVVGSDGN--------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        GS G+        +V+SAFDEP+  A + L+KRRTY LEMN F
Sbjct  306  PSNDG-----GSGGHSSRKETEAFVSSAFDEPFRFAVKALMKRRTYLLEMNGF  353



>gb|EAY76237.1| hypothetical protein OsI_04173 [Oryza sativa Indica Group]
Length=353

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 71/113 (63%), Gaps = 13/113 (12%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLV I+
Sbjct  246  QGTLYMGMEQLREFRENKLSASACSNRTQVPACNMKLKYAPYLELPGGMTLQGATLVVIK  305

Query  692  PSEQHKKDVVGSDGN--------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        GS G+        +V+SAFDEP+  A + L+KRRTY LEMN F
Sbjct  306  PSNDG-----GSGGHSSRKETEAFVSSAFDEPFRFAVKALMKRRTYLLEMNGF  353



>emb|CAN62572.1| hypothetical protein VITISV_021321 [Vitis vinifera]
Length=128

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 55/67 (82%), Gaps = 2/67 (3%)
 Frame = -1

Query  839  EELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH--KKDV  666
            EELRVKPLSASS SKRTL+PALN RLWY PHLELPDG VLKGATLVAIRPSEQ   KK++
Sbjct  2    EELRVKPLSASSTSKRTLMPALNTRLWYTPHLELPDGIVLKGATLVAIRPSEQSATKKEM  61

Query  665  VGSDGNW  645
            +     W
Sbjct  62   LAQHPKW  68



>ref|XP_010904742.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S RT VPA NM+L YAP+LELP G  L+GATLV I+
Sbjct  247  QGTLSMGVEQLKEFREKPLAASASSNRTQVPASNMKLRYAPYLELPSGMGLQGATLVTIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      GS G+         +   AFD P+ AAA+ L+KRRTY LEMN F
Sbjct  307  PTSE------GSCGSNSFRKETDAFSCGAFDGPFKAAAKALMKRRTYLLEMNGF  354



>gb|AAT69637.1| unknown protein, contains f-box domain [Oryza sativa Japonica 
Group]
 gb|EAY98512.1| hypothetical protein OsI_20423 [Oryza sativa Indica Group]
 dbj|BAG92711.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64186.1| hypothetical protein OsJ_19018 [Oryza sativa Japonica Group]
Length=351

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 72/114 (63%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  244  QGTLSMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGIALQGATLVAIK  303

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G          +V+ AFD P+  A + L+KRRTY LEMN F
Sbjct  304  PSPE------GSNGGHTSRKETDAFVSGAFDGPFKFAVKALMKRRTYLLEMNGF  351



>ref|XP_006654574.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha]
Length=352

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLSMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGIALQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN-WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS  +       + + +++ AFD P+  A + L+KRRTY LEMN F
Sbjct  307  PSTSNGTHTSRKESDAFISGAFDGPFKFAVKALMKRRTYLLEMNGF  352



>ref|XP_008792446.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008792447.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLSMGLEQLKEFREKPLAASASSNRTQVPASNMKLRYAPYLELPGGMGLQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS         S      +V  AFD P+ AAA+ L+KRRTY LEMN F
Sbjct  307  PSPVGSSGSKSSRKEADAFVCGAFDGPHKAAAKALMKRRTYLLEMNGF  354



>ref|XP_010922958.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922959.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922960.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922961.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922962.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS++S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLSMGVEQLKEFREKPLAASASSNRTQVPASNMKLRYAPYLELPGGMGLQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS         S      +V  AFD PY AAA+ L+K+RTY LEMN F
Sbjct  307  PSSMRSSGSTSSRKEADAFVCGAFDGPYKAAAKALMKQRTYLLEMNGF  354



>ref|NP_001055899.2| Os05g0490300 [Oryza sativa Japonica Group]
 dbj|BAF17813.2| Os05g0490300, partial [Oryza sativa Japonica Group]
Length=450

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 72/114 (63%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLVAI+
Sbjct  343  QGTLSMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPGGIALQGATLVAIK  402

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+G          +V+ AFD P+  A + L+KRRTY LEMN F
Sbjct  403  PSPE------GSNGGHTSRKETDAFVSGAFDGPFKFAVKALMKRRTYLLEMNGF  450



>ref|XP_008777014.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R KPL+AS++S RT VPA NM+L YAP+LELP+G  ++GATLVAI+
Sbjct  247  QGTLTMGLEQLREFREKPLAASASSSRTQVPASNMKLRYAPYLELPEGMGMQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN---WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +       S      +V+ AFD P+  A + L+KRRTY LEMN F
Sbjct  307  PAGEGSSGSNSSRKEAEAFVSGAFDGPFKVAVKALLKRRTYLLEMNGF  354



>ref|XP_009410458.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410459.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KP++AS+++ RT VPA NM+L YAP+L++P G  L+GAT+V IR
Sbjct  247  QGTLSMGEEQLKEFREKPVAASASTNRTQVPACNMKLKYAPYLDIPGGMALQGATVVTIR  306

Query  692  PSEQHKKDVVGSDGN--WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +       S     +++ AFD P+ AA R L+KRRTY LEMN F
Sbjct  307  PSSEGSSSSNISSETDAFISGAFDGPFKAAVRTLMKRRTYLLEMNGF  353



>dbj|BAJ85411.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ ++ R   LSAS+ S RT VPA NM+L YAP+LELP+G  L+GATLVAI+
Sbjct  246  QGTLTMGAEQLKDFRENQLSASACSNRTHVPACNMKLKYAPYLELPEGIALQGATLVAIK  305

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS +      GS+           +++ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  306  PSTE------GSNCGHISRKETDAFISGAFDGPFKFAAKALMKRRTYLLEMNGF  353



>dbj|BAB90386.1| P0432B10.4 [Oryza sativa Japonica Group]
Length=451

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 70/111 (63%), Gaps = 13/111 (12%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATLV I+
Sbjct  338  QGTLYMGMEQLREFRENKLSASACSNRTQVPACNMKLKYAPYLELPGGMTLQGATLVVIK  397

Query  692  PSEQHKKDVVGSDGN--------WVASAFDEPYGAAARMLVKRRTYCLEMN  564
            PS        GS G+        +V+SAFDEP+  A + L+KRRTY LEMN
Sbjct  398  PSNDG-----GSGGHSSRKETEAFVSSAFDEPFRFAVKALMKRRTYLLEMN  443



>ref|XP_009420961.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=348

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 72/113 (64%), Gaps = 13/113 (12%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+AS +S RT VPA NM+L YAP+LEL +G  ++G TLVAI+
Sbjct  241  QGTLIMGAEQLKEFREKPLAASLSSNRTQVPASNMKLRYAPYLELAEGMGMQGVTLVAIK  300

Query  692  PSEQHKKDVVGSDGN--------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +       S GN        ++  AFD P+ AA + LVKRRTY LEMN F
Sbjct  301  PAGEGT-----SCGNSSRKEAEAFICGAFDGPFRAAVKALVKRRTYLLEMNGF  348



>ref|XP_008786757.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008786758.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 9/111 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R K L+AS++S RT VPA +M+L YAP+LELP G  L+GATLVAI+
Sbjct  247  QGTLSMGVEQLKEFREKSLAASASSNRTQVPASSMKLRYAPYLELPGGMGLQGATLVAIK  306

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      GS+ +      +   AFD P+ AAA+ L+KRRTY LEMN F
Sbjct  307  PTSEGS---CGSNSSRKETDAFGCGAFDGPFKAAAKALLKRRTYLLEMNGF  354



>emb|CDM84680.1| unnamed protein product [Triticum aestivum]
Length=354

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 69/108 (64%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ  E R   LSAS+ S RT VPA +M+L YAP+LELP G  L+GATLV I+
Sbjct  247  QGTLCMGAEQLAEFRENRLSASACSNRTQVPACSMKLKYAPYLELPGGLGLQGATLVVIK  306

Query  692  PSEQHKKDV-VG--SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        VG      +V+ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  307  PSGDGAGGCHVGRKETDAFVSGAFDGPFRFAAKALMKRRTYLLEMNGF  354



>dbj|BAJ87191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 70/114 (61%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ  E R   LSAS+ S RT VPA +M+L YAP+LELP G  L+GATLV I+
Sbjct  247  QGTLCMGTEQLAEFRENRLSASACSNRTQVPACSMKLKYAPYLELPGGLGLQGATLVVIK  306

Query  692  PSEQHKKDVVGSDG---------NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        G+ G          +V+ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  307  PSGD------GAGGCHAGRKEAEAFVSGAFDGPFRFAAKALMKRRTYLLEMNGF  354



>dbj|BAJ95685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM R+Q +E   KPL+A++A+ RT VPA NM+L YAP LEL DGT ++GATLV I+
Sbjct  261  QGTLCMERQQLKEFTDKPLAAAAAANRTQVPACNMKLRYAPMLELSDGTRIQGATLVVIK  320

Query  692  P------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P          +K++      +VA AFD P+  A  ML KRRTY LEMN F
Sbjct  321  PVGEAGGIGGGRKEL----DEFVAGAFDGPFREAVSMLSKRRTYLLEMNGF  367



>ref|XP_009381361.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 71/111 (64%), Gaps = 9/111 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M   Q +E R KP  AS+AS RT VPA NM+L Y+P+L+LP G  L+GATLV I+
Sbjct  247  QGTLNMGVGQLKEFREKPPVASAASNRTQVPASNMKLKYSPYLDLPGGMALQGATLVTIK  306

Query  692  PSEQHKKDVVGSDGN------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        G++ N      ++  AF+ P+ AAA+ L+KRRTY LEMN F
Sbjct  307  PSSDGSS---GTNTNTTESDAFIFGAFEGPFKAAAKSLMKRRTYLLEMNGF  354



>gb|EEC75147.1| hypothetical protein OsI_11347 [Oryza sativa Indica Group]
Length=384

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M R+Q  E R KPL+A++A+ RT VPA NM+L YAP LEL DGT ++GATLV I+
Sbjct  278  QGTLSMGRDQIREFRDKPLAAAAAANRTQVPACNMKLRYAPMLELSDGTRIQGATLVVIK  337

Query  692  P------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P          +K++      +VA AFD PY  A R L KRRTY LEMN F
Sbjct  338  PVGEAGGIGGGRKEL----DEFVADAFDGPYREAVRALSKRRTYLLEMNGF  384



>gb|EMT15455.1| hypothetical protein F775_29721 [Aegilops tauschii]
Length=103

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 3/103 (3%)
 Frame = -1

Query  857  MNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH  678
            M  EQ  E R   LSAS+ S RT VPA +M+L YAP+LELP G  L+GATLV I+PS   
Sbjct  1    MGAEQLAEFRESRLSASACSNRTQVPACSMKLKYAPYLELPGGLGLQGATLVVIKPSGDG  60

Query  677  KKDV-VGSDGN--WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
                 VG      +V+ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  61   AGGCHVGRKETEAFVSGAFDGPFRFAAKALMKRRTYLLEMNGF  103



>ref|XP_006651329.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=324

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M R+Q +E R KPL+A++A+ RT VPA NM+L YAP LEL DGT ++GATLV I+
Sbjct  218  QGTLSMGRDQIKEFRDKPLAAAAAANRTQVPACNMKLRYAPMLELSDGTRIQGATLVVIK  277

Query  692  P------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P          +K++      +VA AFD PY  A   L KRRTY LEMN F
Sbjct  278  PVGEAGGIGGGRKEL----DEFVADAFDGPYREAVSALSKRRTYLLEMNGF  324



>ref|XP_009406821.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406822.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL AS++S RT +PA NM+L YAP+LELP+G  ++GATLVAI 
Sbjct  247  QGTLSMGIEQLKEFREKPLVASASSTRTHLPASNMKLRYAPYLELPEGMAMQGATLVAIS  306

Query  692  PSEQHKKDVVGSDG-----NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+     D  G+ G     +++  AF+ P  AA + LV+RR Y +E+N F
Sbjct  307  PATD---DTDGNSGREECDSFIRGAFEGPLDAAVKSLVERRIYLMEINGF  353



>ref|XP_004970320.1| PREDICTED: F-box protein At1g30200-like [Setaria italica]
Length=354

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 69/108 (64%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG LCM  EQ ++ R   LSAS+ S RT VPA NM+L YAP+LELP G  L+GATL+ I+
Sbjct  247  QGALCMGAEQLKDFREHQLSASACSNRTQVPACNMKLNYAPYLELPGGLALQGATLLVIK  306

Query  692  PSEQHKKDVVGSDGN---WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+        GS      +V+ AFD P   AA+ L+KRRTY L+MN F
Sbjct  307  PAGDGSSGGHGSRKEAEAFVSGAFDGPLRFAAKALMKRRTYLLDMNGF  354



>ref|XP_006644887.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha]
Length=353

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 68/114 (60%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  E R   LS S+   RT VPA +M+L YAP+LELP G  L+GATLV I+
Sbjct  246  QGALYMGMEQLREFRENNLSTSACFNRTQVPACSMKLKYAPYLELPGGLALQGATLVVIK  305

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        GS G          +V+SAFDEP+  A + L+KRRTY LEMN F
Sbjct  306  PSND------GSCGGHSSRKETEAFVSSAFDEPFRFAVKALMKRRTYLLEMNGF  353



>ref|XP_003564454.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=354

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 69/114 (61%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG + M  EQ +E R   L AS+ S RT VPA +M+L YA +LELPDG  ++GATLV I+
Sbjct  247  QGTISMGMEQLKEFRENQLPASACSNRTQVPACSMKLKYAAYLELPDGLAMQGATLVVIK  306

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            PS        G+ G          +V+ AFD P+  AA+ L+KRRTY LEMN F
Sbjct  307  PSAD------GTSGGHSSRKETEAFVSDAFDGPFKFAAKALMKRRTYLLEMNGF  354



>ref|XP_002467943.1| hypothetical protein SORBIDRAFT_01g036900 [Sorghum bicolor]
 gb|EER94941.1| hypothetical protein SORBIDRAFT_01g036900 [Sorghum bicolor]
Length=380

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M R+Q  E R KPL+A++A+ RT VPA NM+L YAP LEL DGT + GATLV I+
Sbjct  275  QGTLSMGRDQLREFRDKPLAAAAAANRTQVPACNMKLRYAPLLELSDGTRIHGATLVVIK  334

Query  692  PSEQHKKDVVGSDG-----NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P      D  G  G      +VA AFD P+  A   L KRRTY LEMN F
Sbjct  335  PV----GDAAGVGGRKELDEFVAGAFDGPFREAVAALSKRRTYLLEMNGF  380



>ref|NP_001049959.1| Os03g0321300 [Oryza sativa Japonica Group]
 gb|ABF95667.1| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11873.1| Os03g0321300 [Oryza sativa Japonica Group]
 dbj|BAG92352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M R+Q  E R KPL+A++A+ RT VPA NM+L YAP LEL DGT ++GATLV I+
Sbjct  278  QGTLSMGRDQIREFRDKPLAAAAAANRTQVPACNMKLRYAPMLELSDGTRIQGATLVVIK  337

Query  692  P------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P          +K++      +VA AFD PY  A   L KRRTY LEMN F
Sbjct  338  PVGEAGGIGGGRKEL----DEFVADAFDGPYREAVSALSKRRTYLLEMNGF  384



>gb|EEE58967.1| hypothetical protein OsJ_10655 [Oryza sativa Japonica Group]
Length=370

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M R+Q  E R KPL+A++A+ RT VPA NM+L YAP LEL DGT ++GATLV I+
Sbjct  264  QGTLSMGRDQIREFRDKPLAAAAAANRTQVPACNMKLRYAPMLELSDGTRIQGATLVVIK  323

Query  692  P------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P          +K++      +VA AFD PY  A   L KRRTY LEMN F
Sbjct  324  PVGEAGGIGGGRKEL----DEFVADAFDGPYREAVSALSKRRTYLLEMNGF  370



>ref|XP_009393903.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 69/114 (61%), Gaps = 15/114 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ +E R KPL+ S++S RT VPA  M+L YAP LELPDG  ++GATLVAI+
Sbjct  256  QGTLTMGVEQLKEFREKPLAMSASSNRTQVPASYMKLRYAPFLELPDGMGMQGATLVAIK  315

Query  692  PSEQHKKDVVGSDGN---------WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+ +      G+ G          ++  AFD+P     + LVK RTY LEMN F
Sbjct  316  PAGE------GTSGGHYSRKEAEAFICRAFDDPLRDTVKALVKNRTYLLEMNGF  363



>ref|XP_003558028.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=372

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 71/112 (63%), Gaps = 11/112 (10%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG+LCM R Q +E   KPL+A++A+ RT VPA NM+L YAP LEL DGT ++GATLV I+
Sbjct  265  QGMLCMERAQLKEFTDKPLAAAAAANRTQVPACNMKLRYAPMLELSDGTRIQGATLVVIK  324

Query  692  P-------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P           +K++      +VA AFD PY  A   L KRRTY LEMN F
Sbjct  325  PVGETGGIGGGGRKEL----DEFVADAFDGPYREAVWALSKRRTYLLEMNGF  372



>ref|NP_001182880.1| hypothetical protein [Zea mays]
 gb|ACR35006.1| unknown [Zea mays]
 tpg|DAA57163.1| TPA: hypothetical protein ZEAMMB73_107043 [Zea mays]
Length=350

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 69/108 (64%), Gaps = 7/108 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ  + R   LSAS  S RT VPA NM+L YA +LELP G  L+GATL+  +
Sbjct  247  QGALSMGAEQLNDFREHQLSASPCSNRTQVPACNMKLKYAQYLELPGGLALQGATLLVTK  306

Query  692  P-SEQH--KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P S+ H  +K+V      +V+SAFD P   AA+ L+KRRTY LEMN F
Sbjct  307  PASDGHGNRKEVEA----FVSSAFDGPLRFAAKALMKRRTYLLEMNGF  350



>ref|XP_002456519.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
 gb|EES01639.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
Length=354

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M  EQ ++ R   LSAS  S RT VPA NM+L YA +LELP G  L+GATL+ I+
Sbjct  247  QGALSMGAEQLKDFREHQLSASPCSNRTQVPACNMKLKYAQYLELPGGLALQGATLLVIK  306

Query  692  PSEQHKKDVVGSDGN---WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P+        G+      +V+ AFD P   AA+ L+KRRTY LEMN F
Sbjct  307  PASDGSSSGHGNRKEVDAFVSGAFDGPLRFAAKALMKRRTYLLEMNGF  354



>ref|XP_004984553.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=371

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 10/111 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIR  693
            QG L M R+Q +E R KPL+A++A+ RT VPA NM+L YAP LEL DGT + GATLV I+
Sbjct  265  QGTLSMGRDQLKEFRDKPLAAAAAANRTQVPACNMKLRYAPLLELSDGTRIHGATLVVIK  324

Query  692  P------SEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            P          +K++     ++VA  F+ P+  A  +L KRRTY LEMN F
Sbjct  325  PVGESGGIGGGRKEL----DDFVADTFNGPFREAVGVLSKRRTYLLEMNGF  371



>gb|AFW88518.1| hypothetical protein ZEAMMB73_307153 [Zea mays]
Length=435

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 68/112 (61%), Gaps = 8/112 (7%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSAS-KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAI  696
            QG L M REQ +E R KPL+A++A+  RT VPA NM+L YAP LEL DGT + GATLV I
Sbjct  325  QGTLSMGREQLKEFRDKPLAAAAAAANRTQVPACNMKLRYAPLLELSDGTRIHGATLVVI  384

Query  695  RPSEQHKKDVV------GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            RP  +            G D  + A+AFD P   A   L KRRTY LEMN F
Sbjct  385  RPVGEATAGTGGGGGRKGLD-EFAANAFDGPLREAVAALSKRRTYLLEMNGF  435



>tpg|DAA41007.1| TPA: hypothetical protein ZEAMMB73_337936 [Zea mays]
Length=218

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSAS--KRTLVPALNMRLWYAPHLELPDGTVLKGATLVA  699
            QG L M R+Q  E R  PL+A+ A+   RT VPA NM+L YAP LEL DGT + GATLV 
Sbjct  115  QGTLSMGRDQLREFRDSPLAAAPAAAANRTQVPACNMKLRYAPLLELSDGTRIHGATLVV  174

Query  698  IRPSEQHKKDVVGSDGNWV-ASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            I+P      D  G D + + A AFD P   A   L KRR Y LEMN F
Sbjct  175  IKPI----GDAGGKDLDELGAGAFDGPMKEAVAALGKRRAYLLEMNGF  218



>ref|XP_002446238.1| hypothetical protein SORBIDRAFT_06g008350 [Sorghum bicolor]
 gb|EES10566.1| hypothetical protein SORBIDRAFT_06g008350 [Sorghum bicolor]
Length=102

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 60/102 (59%), Gaps = 2/102 (2%)
 Frame = -1

Query  857  MNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH  678
            M  +Q  E R KPL+A++A+ RT VPA NM+L YAP LEL D T + GATLV I+P    
Sbjct  1    MGCDQLREFRDKPLAAAAAANRTQVPACNMKLRYAPLLELSDDTRIHGATLVVIKPVGDA  60

Query  677  KKDVVGSD--GNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
                 G      +VA  FD P+  A   L KRRTY LEMN F
Sbjct  61   AGVGGGRKELDKFVAGTFDGPFREAVAALSKRRTYLLEMNGF  102



>ref|NP_001132514.1| uncharacterized protein LOC100193974 [Zea mays]
 gb|ACF81382.1| unknown [Zea mays]
Length=359

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSAS--KRTLVPALNMRLWYAPHLELPDGTVLKGATLVA  699
            QG L M R+Q  E R +PL+A+ A+   RT VPA NM+L YAP LEL DGT + GATLV 
Sbjct  256  QGTLSMGRDQLREFRDRPLAAAPAAAANRTQVPACNMKLRYAPLLELSDGTRIHGATLVV  315

Query  698  IRPSEQHKKDVVGSDGNWV-ASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            I+P      D  G D + + A AFD P   A   L KRR Y LEMN F
Sbjct  316  IKPV----GDAGGKDLDELGAGAFDGPLREAVAALGKRRAYLLEMNGF  359



>gb|ACG40631.1| F-box domain containing protein [Zea mays]
Length=358

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSAS--KRTLVPALNMRLWYAPHLELPDGTVLKGATLVA  699
            QG L M R+Q  E R +PL+A+ A+   RT VPA NM+L YAP LEL DGT + GATLV 
Sbjct  255  QGTLSMGRDQLREFRDRPLAAAPAAAANRTQVPACNMKLRYAPLLELSDGTRIHGATLVV  314

Query  698  IRPSEQHKKDVVGSDGNWV-ASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            I+P      D  G D + + A AFD P   A   L KRR Y LEMN F
Sbjct  315  IKPV----GDAGGKDLDELGAGAFDGPLREAVAALGKRRAYLLEMNGF  358



>gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Erythranthe guttata]
Length=375

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 75/126 (60%), Gaps = 23/126 (18%)
 Frame = -1

Query  872  QGVLCMNREQPEELR-VKPLSASSASK-RTLVPALNMRLWYAPHLELPDGTVLKGATLVA  699
            QG LCMNREQ EE R +K   +   S+ R+ VPAL M++WY   LEL  G V++GATLV 
Sbjct  252  QGRLCMNREQIEETRELKANRSGEVSEYRSRVPALRMKMWYLERLELS-GKVMEGATLVV  310

Query  698  IRP------------SEQHKKDVVGSDGNWVASAF--DEPYG-----AAARMLVKRRTYC  576
            IRP            +E+ KK ++ SDG+ VA AF  +E  G     A  +++V ++ Y 
Sbjct  311  IRPAASVAAAGGGVEAEKVKKGMM-SDGDMVAGAFAGEEREGKVLDEAVRKLMVAKKCYT  369

Query  575  LEMNSF  558
            LEMNSF
Sbjct  370  LEMNSF  375



>emb|CDP08472.1| unnamed protein product [Coffea canephora]
Length=354

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 73/123 (59%), Gaps = 21/123 (17%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASK---------RTLVPALNMRLWYAPHLELP-DGTV  723
            QG   MNREQ +E  VK +  S + +         RT +P L M++WY P L+LP  G V
Sbjct  235  QGTFRMNREQIKEF-VKCMDHSGSGEVVDKETLMERTKLPPLRMKMWYVPELKLPASGFV  293

Query  722  LKGATLVAIRPSEQHKKDVV-GSDGNWVASAFD------EPYGAAARMLVK-RRTYCLEM  567
            +KGATL  ++P ++  K+V  G+D  WV +AFD      + +G A R L+K +R+Y LEM
Sbjct  294  MKGATLAVMKPIKEGNKEVERGAD--WVVNAFDGEGEEGKVFGEAVRKLLKMKRSYTLEM  351

Query  566  NSF  558
            NSF
Sbjct  352  NSF  354



>ref|XP_009804959.1| PREDICTED: F-box protein At1g30200-like [Nicotiana sylvestris]
Length=362

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 14/115 (12%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG+  MN EQ EE+R      SS   R+ VPAL +++WY P LELP  G V+KGATLV +
Sbjct  252  QGICSMNCEQVEEMRRNTRVFSS--NRSKVPALKVKMWYVPELELPAKGCVMKGATLVVV  309

Query  695  RPSEQHKKDVVGSDGNWVASAF--------DEPYGAAARMLVK-RRTYCLEMNSF  558
            +P E+  K   G D   VA  F        ++ +   A+ LVK +R+Y LEMNSF
Sbjct  310  KPVEEWSKADDGRD--LVAGGFGFAREGKEEKVFDEVAKELVKLKRSYSLEMNSF  362



>ref|XP_010277597.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=372

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 66/114 (58%), Gaps = 10/114 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASK----RTLVPALNMRLWYAPHLELP-DGTVLKGAT  708
            QG LCM  EQ  E R + L +S  S     RT VPA+N++LWY P LELP  G V++GAT
Sbjct  260  QGTLCMGEEQIAESR-QCLDSSRTSAALPGRTRVPAVNVKLWYVPRLELPGSGYVMEGAT  318

Query  707  LVAIRPS----EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            L+AIRP     E+ + +V    G +      + +G A R + KR+   LEM+SF
Sbjct  319  LMAIRPVDRPPEKEESEVSLMAGAFEGEEQGKTFGEAVRAMAKRKARILEMDSF  372



>emb|CBI24218.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG L M  +Q +ELR K ++     +RT +PA+ ++LWY P LELP  G V+KGATL+ I
Sbjct  234  QGRLRMGEDQFKELR-KCVNTRPPLERTKLPAICIKLWYVPLLELPASGCVMKGATLIVI  292

Query  695  RPSEQHKKDVVGSDGNWVASAFD------EPYGAAARMLVKRRTYCLEMNSF  558
            RP  Q  K  + SDG+ +A AFD          A   +L +++ Y +EMNSF
Sbjct  293  RPLNQVMK--MKSDGDLLAGAFDGEEEAEALCEAVREILKEKKPYLMEMNSF  342



>ref|XP_011080388.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=371

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 61/120 (51%), Gaps = 15/120 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASK-RTLVPALNMRLWYAPHLELPD-GTVLKGATLVA  699
            QG LCMN+ Q EE+R          + R+ VPAL M++WY   LELPD G V++G TLV 
Sbjct  252  QGRLCMNKGQIEEVRKMERKGDELLEYRSRVPALRMKMWYLERLELPDSGKVMEGGTLVV  311

Query  698  IRPSEQHKKDVVG-------SDGNWVASAFDEPYG------AAARMLVKRRTYCLEMNSF  558
            IRP+                 DG   A AF E         A  +++V ++ Y LEMNSF
Sbjct  312  IRPAAACGGAGADELRMGNWGDGGMAAEAFGEEGDGKMLREAVRKLMVAKKCYTLEMNSF  371



>ref|XP_002313372.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
 gb|EEE87327.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
Length=361

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 73/118 (62%), Gaps = 17/118 (14%)
 Frame = -1

Query  872  QGVLCMNREQPEELR--VKPLSASSAS--KRTLVPALNMRLWYAPHLELP-DGTVLKGAT  708
            QG +CM +++  E+R  +K + AS+ S  +RT VP L+M+LWY P LELP +G +++GAT
Sbjct  248  QGRVCMGKDEVAEIRNSMKSMVASTDSSLERTRVPDLSMKLWYVPVLELPENGYIMRGAT  307

Query  707  LVAIRPSEQ------HKKDVVGSDGNWV-ASAFDEPYGAAARMLVK-RRTYCLEMNSF  558
            L  +RP++        K D+ G DG      AF+E    A R +VK +++Y + ++SF
Sbjct  308  LAVLRPNDDGQIGNGSKSDLFGFDGEECEKKAFNE----AVREMVKMKKSYLMTVDSF  361



>ref|XP_009610193.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=371

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 62/117 (53%), Gaps = 18/117 (15%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG+  MN EQ EE+R    +   +  R+ VPAL +++WY P LELP  G   KGATLV I
Sbjct  261  QGICSMNCEQVEEMRRN--TRVFSPNRSKVPALKVKMWYVPELELPAKGCTTKGATLVVI  318

Query  695  RPSEQHKKDVVGSD----------GNWVASAFDEPYGAAARMLVK-RRTYCLEMNSF  558
            RP E+  K   G D                 FDE     A+ LVK +R+Y LEMNSF
Sbjct  319  RPVEEWSKADDGRDLVAGGFGFAGEGKEGKVFDE----VAKELVKLKRSYSLEMNSF  371



>gb|AEW08662.1| hypothetical protein CL1090Contig1_04, partial [Pinus radiata]
 gb|AFG45754.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45755.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45757.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45758.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45759.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45760.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45761.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45762.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
 gb|AFG45763.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
Length=75

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG  729
            QG+LCM ++Q  E R KPL AS++S RT VPALNM+LWYA  LELP G
Sbjct  25   QGMLCMGKQQLCEFREKPLVASASSNRTQVPALNMKLWYAQSLELPGG  72



>gb|KJB35720.1| hypothetical protein B456_006G125400 [Gossypium raimondii]
Length=353

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 69/116 (59%), Gaps = 19/116 (16%)
 Frame = -1

Query  872  QGVLCMNREQPEELR----VKPLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGAT  708
            QG+  M +E+  E+R     K  ++SS+ +R+ +P +NM+LWY P L+LPD G V+KGAT
Sbjct  246  QGMFSMGKEELVEMRNSIDTKQEASSSSMERSPIPEVNMKLWYLPMLDLPDSGYVMKGAT  305

Query  707  LVAIRPS-----EQHKKDVVGSDGNWVASAFDEPYGAAARMLVK-RRTYCLEMNSF  558
            LV IRP      E +  D +  D        ++P+  A R ++K +++Y + M+SF
Sbjct  306  LVLIRPVVDGMIENNSDDPLVGD--------EKPFSEAVREMIKVKKSYLMTMSSF  353



>ref|XP_011032098.1| PREDICTED: F-box protein At4g18380-like [Populus euphratica]
Length=342

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 73/118 (62%), Gaps = 17/118 (14%)
 Frame = -1

Query  872  QGVLCMNREQPEELR--VKPLSASSAS--KRTLVPALNMRLWYAPHLELP-DGTVLKGAT  708
            QG +CM +++  E+R  +K + A++ S  +RT VP L+++LW+ P LELP +G ++KGAT
Sbjct  229  QGRVCMGKDEVAEIRNSMKSMVANTDSSLERTRVPDLSLKLWFVPVLELPENGYIMKGAT  288

Query  707  LVAIRPSEQ------HKKDVVGSDG-NWVASAFDEPYGAAARMLVK-RRTYCLEMNSF  558
            L  +RP++        K D+ G DG      AF+E    A R +VK +++Y + M+SF
Sbjct  289  LAVLRPNDDGQIGNGSKSDLFGFDGEEREKKAFNE----AVREMVKMKKSYLMTMDSF  342



>gb|AFG45756.1| hypothetical protein CL1090Contig1_04, partial [Pinus taeda]
Length=75

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDG  729
            QG+LCM ++Q  + R KPL AS++S RT VPALNM+LWYA  LELP G
Sbjct  25   QGMLCMGKQQLCDFREKPLVASASSNRTQVPALNMKLWYAQSLELPGG  72



>ref|XP_002531125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31259.1| conserved hypothetical protein [Ricinus communis]
Length=356

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 18/119 (15%)
 Frame = -1

Query  872  QGVLCMNREQPEELR--VKPLSASSAS---KRTLVPALNMRLWYAPHLELP-DGTVLKGA  711
            QG LC+ ++Q  E+R  +K L+ S +S   +RT VP L+M+LWY P LELP  G ++KGA
Sbjct  242  QGRLCVGKDQIVEMRNAMKSLAVSESSSSIERTPVPDLSMKLWYVPVLELPATGYLMKGA  301

Query  710  TLVAIRPSE------QHKKDVVGSDGNWVAS-AFDEPYGAAARMLVK-RRTYCLEMNSF  558
            TLV I+P         ++ D    DG+     AF E    AARM+VK +++Y + MNSF
Sbjct  302  TLVVIKPVNGVTRKGSNQSDSFDFDGDKSEKMAFVE----AARMMVKMKKSYAMTMNSF  356



>emb|CBI19143.3| unnamed protein product [Vitis vinifera]
Length=158

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGATLVAI  696
            +G + M+RE   E             RT VPA+ MR+ + P LEL   G  + GATLV +
Sbjct  64   EGTVVMDREALRE----------DKSRTKVPAVQMRMRHEPLLELEGCGVRMGGATLVVV  113

Query  695  RPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             P +  +K     +   V  AF+  +G AAR L+K RTY LEMNSF
Sbjct  114  TPIKDGRKTGT-EEAGLVCDAFEGMFGEAARTLLKTRTYLLEMNSF  158



>ref|XP_011464592.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At1g22220 [Fragaria 
vesca subsp. vesca]
Length=328

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -1

Query  794  RTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF-DEPY  618
            RT VP++ MR+ + P LEL  G  ++GATLV +RPS     D+   DG     AF D  Y
Sbjct  250  RTRVPSVRMRMRHVPRLELKGGLWVEGATLVVVRPS-YGGGDMAAEDGELALKAFGDGLY  308

Query  617  GAAARMLVKRRTYCLEMNSF  558
            G  A+ LVK R+Y LEMNSF
Sbjct  309  GEVAQKLVKARSYLLEMNSF  328



>ref|XP_010269221.1| PREDICTED: F-box protein At1g22220-like [Nelumbo nucifera]
Length=346

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 8/87 (9%)
 Frame = -1

Query  794  RTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVAS-------  636
            RT VPA+ MR+ + P L+LP G  +KGATLV + P+    +    +D +   S       
Sbjct  260  RTTVPAVRMRMMHEPRLDLPGGVRMKGATLVVVSPAAAQGQGTETADDSAKESEEQKLAL  319

Query  635  -AFDEPYGAAARMLVKRRTYCLEMNSF  558
             AF   +G AA+ LVK R+Y LEMNSF
Sbjct  320  DAFGGMFGEAAKALVKSRSYLLEMNSF  346



>ref|XP_010651665.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At1g30200-like 
[Vitis vinifera]
Length=638

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG L M  +Q +ELR K ++     +RT +PA+ ++LWY P LELP  G V+KGATL+ I
Sbjct  234  QGRLRMGEDQFKELR-KCVNTRPPLERTKLPAICIKLWYVPLLELPASGCVMKGATLIVI  292

Query  695  RPSEQHKKDVVGSDGNWVASAFD  627
            RP  Q  K  + SDG+ +A AFD
Sbjct  293  RPLNQVMK--MKSDGDLLAGAFD  313


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 58/108 (54%), Gaps = 21/108 (19%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGATLVAI  696
            QG L M +E  EELR      +S+ +RT VPAL ++L Y   LELP+ G V++GATLV I
Sbjct  549  QGRLWMRQELLEELRT---CVNSSMERTRVPALRVKLXYVSVLELPESGRVMQGATLVII  605

Query  695  RPSEQHKKDVVGSDGNW-VASAFDEPYGAAARMLVK-RRTYCLEMNSF  558
                            W V    +E +  A R +VK ++ Y +E+NSF
Sbjct  606  ---------------GWPVPVDPEEAFNEAMREMVKDKKLYIMEINSF  638



>ref|XP_010105899.1| F-box protein [Morus notabilis]
 gb|EXC06718.1| F-box protein [Morus notabilis]
Length=348

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 4/84 (5%)
 Frame = -1

Query  797  KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSD---GNWVASAFD  627
             RT VP++ MR+ +AP LEL  G   +GATLV +RP+++     VG D    N    AF 
Sbjct  265  NRTRVPSVRMRMRHAPRLELKGGFWAEGATLVVVRPTKEGSGAQVGDDVEEANLATMAFG  324

Query  626  EP-YGAAARMLVKRRTYCLEMNSF  558
            E  YG A   L+K R+Y LEMNSF
Sbjct  325  EGLYGEAVGSLLKCRSYILEMNSF  348



>ref|XP_002513900.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48483.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 9/111 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASS-----ASKRTLVPALNMRLWYAPHLELPDGTVLKGAT  708
            +G + M ++   E R+   +         ++RT+VP++ MR+ +   + L DGT L+GAT
Sbjct  196  EGTVVMEKDDLRECRIDMAARGKDEWEWQARRTVVPSVRMRVRHETRVRLSDGTWLEGAT  255

Query  707  LVAIRPSEQHKKDVVGSDGNWVASAF-DEPYGAAARMLVKRRTYCLEMNSF  558
            LV +RP      D    D      AF  E YG A ++L+K ++Y LEMNSF
Sbjct  256  LVVVRPC---VADADVEDAELAMDAFGGEVYGEAVKLLLKTKSYVLEMNSF  303



>ref|XP_002890500.1| hypothetical protein ARALYDRAFT_472458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66759.1| hypothetical protein ARALYDRAFT_472458 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 8/112 (7%)
 Frame = -1

Query  872  QGVLCMNREQPEELR-----VKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGAT  708
            +G + M+ E  +E R     V+       + R++VP++ M + +AP L+L  G  L+ AT
Sbjct  207  EGTVVMDAEGLKEFRNTEARVEDEERVVKNSRSVVPSVRMSMRHAPSLKLKSGICLESAT  266

Query  707  LVAIRPSEQHKKDVVGSDGNWVASAF--DEPYGAAARMLVKRRTYCLEMNSF  558
            LV IRPS ++  DVVG D      AF  D  YG A   L+K +   LEMNSF
Sbjct  267  LVIIRPSGEY-SDVVGDDAELATEAFAGDCMYGEAVVALLKCKKNALEMNSF  317



>ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Citrus sinensis]
Length=345

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 10/114 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG LCM+ EQ  E+R K +  SS  +RT  P L++++ Y P LELP  G  ++GATLV I
Sbjct  233  QGQLCMDEEQIAEMR-KSVDDSSLKERTPFPDLSIKMLYLPVLELPASGYTMRGATLVVI  291

Query  695  RPSEQHKKDVVGSDGNWVASAFD-------EPYGAAARMLVK-RRTYCLEMNSF  558
            RP      D   + G+ +   FD       + +G A R L+K +++Y + MNSF
Sbjct  292  RPDHDDNDDDDDAGGDLLGGWFDGDGEEKKKAFGEAVRELMKVKKSYVMTMNSF  345



>ref|XP_009786216.1| PREDICTED: F-box protein At1g78100 [Nicotiana sylvestris]
Length=345

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = -1

Query  800  SKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQ---HKKDVVGSDGN--WVAS  636
            S RT VPA+ MR+ +   +EL DGT + GATLV +RP  Q    + +V   +G+     +
Sbjct  258  SNRTTVPAVRMRMRHEARMELSDGTKMVGATLVVVRPINQGNGERSEVEEQNGDVGLALA  317

Query  635  AF--DEPYGAAARMLVKRRTYCLEMNSF  558
            AF  D  YG A   L+K R+Y LEMNSF
Sbjct  318  AFGDDAVYGEAVERLLKSRSYILEMNSF  345



>ref|XP_004139055.1| PREDICTED: F-box protein At4g18380-like [Cucumis sativus]
 gb|KGN66522.1| hypothetical protein Csa_1G617380 [Cucumis sativus]
Length=354

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVK-PLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGATLVA  699
            QG LCM  E+  ELR    LS+SS  +R+++P L M++WY P L+LP+ G V+  ATLV 
Sbjct  243  QGRLCMEEEEVMELRESMQLSSSSYVERSVIPDLKMKMWYVPVLDLPEAGFVMTAATLVV  302

Query  698  IRPSEQHKKDVVGSDG-NWVASAFDEP-------YGAAARMLVK-RRTYCLEMNSF  558
            I+PS       +G DG   +   FD         YG A R L+K +R Y LE+NSF
Sbjct  303  IKPSGGG----MGLDGLERIGDEFDSEDGEKFGVYGEAVRKLMKLKRNYALEVNSF  354



>ref|XP_009600740.1| PREDICTED: F-box protein At1g78100 [Nicotiana tomentosiformis]
Length=344

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 7/88 (8%)
 Frame = -1

Query  800  SKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQ---HKKDVVGSDGN--WVAS  636
            S RT VPA+ MR+ +   +EL DGT + GATLV +RP  Q    + +V   +G+      
Sbjct  257  SNRTTVPAVRMRMRHEARMELSDGTKMIGATLVVVRPINQGNGERSEVEEQNGDVGLALG  316

Query  635  AF--DEPYGAAARMLVKRRTYCLEMNSF  558
            AF  D  YG A   L+K R+Y LEMNSF
Sbjct  317  AFGDDAMYGEAVERLLKSRSYILEMNSF  344



>ref|XP_002279458.1| PREDICTED: F-box protein At5g46170-like [Vitis vinifera]
Length=341

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 10/112 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG L M  EQ +ELR + ++ ++  +RT+VPA+ ++LW+ P LELP  G V+ GATL+ I
Sbjct  233  QGRLIMGEEQFKELR-RSMNPTAPVERTMVPAVRVKLWHVPVLELPASGRVMNGATLIVI  291

Query  695  RPSEQHKKDVVGSDGNWVASAFDEPYG------AAARMLVKRRTYCLEMNSF  558
            RP+E+  K  + S+   +   F+          A   ML +++ Y +EM+S 
Sbjct  292  RPAERTMK--MESEDEGLGDCFEGEEEEEDLREAVREMLKEKKPYKIEMDSL  341



>ref|XP_002284195.1| PREDICTED: F-box protein At1g22220 [Vitis vinifera]
Length=320

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 57/116 (49%), Gaps = 12/116 (10%)
 Frame = -1

Query  872  QGVLCMNREQPEELR----------VKPLSASSASKRTLVPALNMRLWYAPHLELPD-GT  726
            +G + M+RE   E R                     RT VPA+ MR+ + P LEL   G 
Sbjct  206  EGTVVMDREALRECRDGEGEEEQEEEAVEPGERDKSRTKVPAVQMRMRHEPLLELEGCGV  265

Query  725  VLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             + GATLV + P +  +K     +   V  AF+  +G AAR L+K RTY LEMNSF
Sbjct  266  RMGGATLVVVTPIKDGRKTGT-EEAGLVCDAFEGMFGEAARTLLKTRTYLLEMNSF  320



>ref|NP_173641.1| F-box protein [Arabidopsis thaliana]
 sp|Q9LM18.1|FB303_ARATH RecName: Full=F-box protein At1g22220 [Arabidopsis thaliana]
 gb|AAF87851.1|AC073942_5 Contains similarity to an unknown protein T11I11.4 gi|6587858 
from Arabidopsis thaliana BAC T11I11 gb|AC012680. EST gb|AA395079 
comes from this gene [Arabidopsis thaliana]
 gb|AAT06470.1| At1g22220 [Arabidopsis thaliana]
 dbj|BAD44000.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30213.1| F-box protein [Arabidopsis thaliana]
Length=314

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 60/112 (54%), Gaps = 9/112 (8%)
 Frame = -1

Query  872  QGVLCMNREQPEELR-----VKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGAT  708
            +G + MN E  +ELR     V+       +KR++VP++ M + +AP L+L  G  L+ AT
Sbjct  205  EGTVVMNEEGLKELRNTEARVEDEERVVKNKRSVVPSVRMSMRHAPSLKLKSGICLESAT  264

Query  707  LVAIRPSEQHKKDVVGSDGNWVASAF--DEPYGAAARMLVKRRTYCLEMNSF  558
            LV +RPS    +  VG D      AF  D  YG A   L+K +   LEMNSF
Sbjct  265  LVIVRPSGADFE--VGDDAELATEAFVGDCMYGEAVVALLKCKKNALEMNSF  314



>ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citrus clementina]
 gb|ESR59488.1| hypothetical protein CICLE_v10015553mg [Citrus clementina]
Length=389

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (53%), Gaps = 17/117 (15%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELP-DGTVLKGATLVAI  696
            QG LCM+ EQ  ++R K ++ SS  +RT  P L++++ Y P LELP  G  ++GATLV I
Sbjct  278  QGQLCMDEEQIAQMR-KSVNDSSLKERTPFPDLSIKMLYLPVLELPASGYTMRGATLVVI  336

Query  695  RPSEQHKKDV----------VGSDGNWVASAFDEPYGAAARMLVK-RRTYCLEMNSF  558
            RP      D              DG     AF    G A R L+K +++Y + MNSF
Sbjct  337  RPDHDDNDDDDAGGDLLGGWFDGDGEEKKKAF----GEAVRELMKVKKSYVMTMNSF  389



>ref|XP_010521192.1| PREDICTED: F-box protein At1g78100-like [Tarenaya hassleriana]
Length=323

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 48/85 (56%), Gaps = 7/85 (8%)
 Frame = -1

Query  794  RTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF-----  630
            RT+VP++ M + +AP L L  G  L+GATLV +RPS  +  +V G D     SAF     
Sbjct  240  RTVVPSVRMSMRHAPSLRLKSGICLEGATLVVVRPSGAYTAEVAG-DAELATSAFAGDNG  298

Query  629  -DEPYGAAARMLVKRRTYCLEMNSF  558
             +  YG A   L+K R   LEMNSF
Sbjct  299  GESMYGEAVAALLKCRRNVLEMNSF  323



>ref|XP_010535602.1| PREDICTED: F-box protein At1g78100-like [Tarenaya hassleriana]
Length=323

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -1

Query  794  RTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEPYG  615
            RT+VP++ M + +AP L L  G  L+GATLV +RPS     D + ++        D  YG
Sbjct  245  RTVVPSVRMSMRHAPSLRLKSGICLEGATLVVVRPSGATGDDDLAAEAFAGDMGGDCMYG  304

Query  614  AAARMLVKRRTYCLEMNSF  558
             A   L+KRR   LEMNSF
Sbjct  305  EAVAALLKRRRNVLEMNSF  323



>ref|XP_008450369.1| PREDICTED: F-box protein At4g18380-like [Cucumis melo]
Length=368

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 15/116 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVK-PLSASSASKRTLVPALNMRLWYAPHLEL-PDGTVLKGATLVA  699
            QG LCM  E+  ELR    LS+SS  +R+++P L M++WY P L+L   G V+  ATLV 
Sbjct  257  QGRLCMEEEEVMELRESMKLSSSSCVERSVIPDLKMKMWYVPVLDLAAAGFVMTAATLVV  316

Query  698  IRPSEQHKKDVVGSDG-NWVASAFDEP-------YGAAARMLVK-RRTYCLEMNSF  558
            I+PS       +G DG   +   FD         YG A R L+K +R Y LE+NSF
Sbjct  317  IKPSGGG----MGLDGLERIGDEFDSEDGEKFGVYGEAVRKLMKLKRNYALEVNSF  368



>gb|KFK42192.1| hypothetical protein AALP_AA2G223400 [Arabis alpina]
Length=338

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 12/106 (11%)
 Frame = -1

Query  851  REQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKK  672
            RE   E+  K +    A +RT+VP++ M + +AP L+L  G  L+ ATLV +RPS     
Sbjct  237  REMAREIE-KGVVERVAKERTVVPSVRMSMRHAPSLKLKSGICLEAATLVVVRPS---GG  292

Query  671  DVVGSDGNWV---ASAF-----DEPYGAAARMLVKRRTYCLEMNSF  558
             VV  D N V     AF     D  YG A   L+KRR   LEMNSF
Sbjct  293  GVVSDDDNDVELATEAFAGDGGDCMYGEAVTALLKRRRNVLEMNSF  338



>ref|XP_010428925.1| PREDICTED: F-box protein At1g78100 [Camelina sativa]
Length=333

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -1

Query  797  KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF----  630
            +RT+VP++ M + +AP L L  G  L+ ATLV +RPS     D   +D   V  AF    
Sbjct  252  ERTVVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPSGVASDD---NDAELVTEAFAGDG  308

Query  629  -DEPYGAAARMLVKRRTYCLEMNSF  558
             D  YG A   L+KRR   LEMNSF
Sbjct  309  GDCMYGEAVTALLKRRRNVLEMNSF  333



>ref|XP_006353995.1| PREDICTED: F-box protein At1g78100-like isoform X1 [Solanum tuberosum]
 ref|XP_006353996.1| PREDICTED: F-box protein At1g78100-like isoform X2 [Solanum tuberosum]
 ref|XP_006353997.1| PREDICTED: F-box protein At1g78100-like isoform X3 [Solanum tuberosum]
 ref|XP_006353998.1| PREDICTED: F-box protein At1g78100-like isoform X4 [Solanum tuberosum]
Length=340

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = -1

Query  800  SKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPS----EQHKKDVVGSDGNWVASA  633
            + RT VPA+ MR+W+   +EL  G  + GATLV +RP+    E+ + +    D      A
Sbjct  254  NNRTTVPAVRMRMWHEARMELSGGMKMVGATLVVVRPTNGGGERSEVEEQNGDVGLALGA  313

Query  632  F--DEPYGAAARMLVKRRTYCLEMNSF  558
            F  D  Y  A   L+K R+Y LEMNSF
Sbjct  314  FGEDAVYCEAVERLLKSRSYILEMNSF  340



>ref|XP_004237895.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320162.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320163.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
 ref|XP_010320164.1| PREDICTED: F-box protein At1g78100 [Solanum lycopersicum]
Length=340

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 6/87 (7%)
 Frame = -1

Query  800  SKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPS----EQHKKDVVGSDGNWVASA  633
            + RT VPA+ MR+W+   +EL  G  + GATLV +RP+    E+ + +    D      A
Sbjct  254  NNRTTVPAVRMRMWHEARMELSGGMKMVGATLVVVRPTNGGGERSEVEEQNGDVGLALGA  313

Query  632  F--DEPYGAAARMLVKRRTYCLEMNSF  558
            F  D  Y  A   L+K R+Y LEMNSF
Sbjct  314  FGEDAVYCEAVERLLKSRSYILEMNSF  340



>ref|XP_009106459.1| PREDICTED: F-box protein At1g78100-like [Brassica rapa]
Length=321

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = -1

Query  851  REQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKK  672
            RE    +  K L       RT VP + M + +AP L+L  G  L+ ATLV +RPS     
Sbjct  225  REAEARVDEKGLGVERVRDRTEVPNVRMSMRHAPMLKLKSGICLEAATLVVVRPSGVSSD  284

Query  671  DVVGSDGNWVASAF--DEPYGAAARMLVKRRTYCLEMNSF  558
            D   +D      AF  D  YG A   L+KRR   LEMNSF
Sbjct  285  D---NDAELATEAFAADCMYGEAVTALLKRRRNVLEMNSF  321



>emb|CDX87476.1| BnaA07g33970D [Brassica napus]
Length=321

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = -1

Query  851  REQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKK  672
            RE    +  K L       RT VP + M + +AP L+L  G  L+ ATLV +RPS     
Sbjct  225  REAEARVDEKGLGVERVRDRTEVPNVRMSMRHAPMLKLKSGICLEAATLVVVRPSGVSSD  284

Query  671  DVVGSDGNWVASAF--DEPYGAAARMLVKRRTYCLEMNSF  558
            D   +D      AF  D  YG A   L+KRR   LEMNSF
Sbjct  285  D---NDAELATEAFAADCMYGEAVTALLKRRRNVLEMNSF  321



>ref|XP_010416779.1| PREDICTED: F-box protein At1g78100-like [Camelina sativa]
Length=336

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -1

Query  797  KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF----  630
            +RT+VP++ M + +AP L L  G  L+ ATLV +RPS     D   +D   V  AF    
Sbjct  255  ERTVVPSVRMSMRHAPSLLLKSGICLEAATLVVVRPSGVASDD---NDAELVTEAFAGDG  311

Query  629  -DEPYGAAARMLVKRRTYCLEMNSF  558
             D  YG A   L+KRR   LEMNSF
Sbjct  312  GDCMYGEAVTALLKRRRNVLEMNSF  336



>ref|XP_006390021.1| hypothetical protein EUTSA_v10018841mg [Eutrema salsugineum]
 gb|ESQ27307.1| hypothetical protein EUTSA_v10018841mg [Eutrema salsugineum]
Length=330

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (49%), Gaps = 8/105 (8%)
 Frame = -1

Query  857  MNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH  678
            M   +  E RV          RT+VP++ M + +AP L+L  G  L+ ATLV +RP+   
Sbjct  229  MKEYRETEARVDEKGFERVRDRTVVPSVRMSMRHAPSLKLKSGICLEAATLVVVRPTGVA  288

Query  677  KKDVVGSDGNWVASAF-----DEPYGAAARMLVKRRTYCLEMNSF  558
              D   +D      AF     D  YG A   L+KRR   LEMNSF
Sbjct  289  SDD---NDAELATEAFAADGGDCMYGEAVTALLKRRRNVLEMNSF  330



>ref|XP_007015207.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY32826.1| F-box family protein, putative [Theobroma cacao]
Length=354

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 64/117 (55%), Gaps = 15/117 (13%)
 Frame = -1

Query  872  QGVLCMNREQPEELR-----VKPLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGA  711
            QG L M  E+  +LR      K    SS  +RT VP L+M+LWY P LELP+ G V++GA
Sbjct  241  QGKLYMGTEKLVQLRNSMNSQKETLESSTLERTPVPELSMKLWYLPVLELPESGYVMRGA  300

Query  710  TLVAIRP----SEQHKKDV-VGS-DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            TLV IRP    +E+   D+ VG  D      AF E   A   M+  ++ Y + M+SF
Sbjct  301  TLVLIRPVAWTTERRNSDLTVGKLDLEGDGKAFSE---AVREMIKVKKNYLMTMSSF  354



>ref|XP_006302534.1| hypothetical protein CARUB_v10020634mg [Capsella rubella]
 gb|EOA35432.1| hypothetical protein CARUB_v10020634mg [Capsella rubella]
Length=330

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -1

Query  797  KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF----  630
            +RTLVP++ M + +AP L L  G  L+ ATLV +RPS     D   +D   V  AF    
Sbjct  249  ERTLVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPSGVPADD---NDVELVTEAFAGDG  305

Query  629  -DEPYGAAARMLVKRRTYCLEMNSF  558
             D  YG A   L+KRR   LEMNSF
Sbjct  306  GDCMYGEAVTALLKRRRNVLEMNSF  330



>ref|XP_011016269.1| PREDICTED: F-box protein At1g22220 [Populus euphratica]
Length=323

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASSAS------KRTLVPALNMRLWYAPHLELPDGTVLKGA  711
            +G + M RE   E R +   A+  +      KRT+VP++ MR+ +   ++L DG  ++GA
Sbjct  215  EGTVAMGREGLRECREESGMAARGADWQEEGKRTVVPSVRMRMRHEQRVQLKDGVWVEGA  274

Query  710  TLVAIRPSEQHKKDVVGSDGNWVASAFDEP-YGAAARMLVKRRTYCLEMNSF  558
            TLV +RP      DV   D      AF    +G A ++L+K  +Y LEMNSF
Sbjct  275  TLVVVRPC-NGGGDV--EDAELALGAFGGGIFGEAVQVLLKNESYLLEMNSF  323



>ref|NP_565169.1| F-box protein [Arabidopsis thaliana]
 sp|Q9C9S2.1|FB91_ARATH RecName: Full=F-box protein At1g78100 [Arabidopsis thaliana]
 gb|AAG52096.1|AC012680_7 unknown protein; 22671-23675 [Arabidopsis thaliana]
 gb|AAK96759.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10256.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36067.1| F-box protein [Arabidopsis thaliana]
Length=334

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 8/105 (8%)
 Frame = -1

Query  857  MNREQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQH  678
            M   +  E+R     +    +RT+VP++ M + +AP L L  G  L+ ATLV +RP+   
Sbjct  233  MKEYRETEVRGDNKESERVGERTVVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPTGVA  292

Query  677  KKDVVGSDGNWVASAF-----DEPYGAAARMLVKRRTYCLEMNSF  558
              D   +D   V  AF     D  YG A   L+KRR   LEMNSF
Sbjct  293  SDD---NDVELVTEAFAGDGDDCMYGEAVTALLKRRRNVLEMNSF  334



>ref|XP_010046705.1| PREDICTED: F-box protein At4g18380-like [Eucalyptus grandis]
Length=403

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 69/131 (53%), Gaps = 29/131 (22%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVK---PLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGATL  705
            QG + M  E+  E+R       + SS+++R  VP L M+LWYAP LELP+ G V++GAT+
Sbjct  276  QGKVRMLEEEIAEMRRSFDSEAADSSSAERIRVPDLRMKLWYAPELELPESGYVMRGATM  335

Query  704  VAIRPS-----EQHKK------------DVVGS-----DGNWVASAFDEPYGAAARMLVK  591
            V I P+     E+H K            DV+ S      G    +AF E   AA  M   
Sbjct  336  VLIAPASEAEGEEHGKAKEGGGGGGDLGDVMRSASFEGGGGEDEAAFRE---AATEMGKL  392

Query  590  RRTYCLEMNSF  558
            +RTY LEMNSF
Sbjct  393  KRTYTLEMNSF  403



>emb|CDX88418.1| BnaC06g38620D [Brassica napus]
Length=321

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
 Frame = -1

Query  851  REQPEELRVKPLSASSASKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKK  672
            RE    +  K L       RT VP + M + +AP L+L  G  L+ ATLV +RPS     
Sbjct  225  REAEARVDEKGLGLERVRDRTEVPNVRMSMRHAPMLKLKSGICLEAATLVVVRPSGVTSD  284

Query  671  DVVGSDGNWVASAF--DEPYGAAARMLVKRRTYCLEMNSF  558
            D   +D      AF  D  YG A   L+KRR   LEMNSF
Sbjct  285  D---NDAELATEAFAADCMYGEAVTALLKRRRNVLEMNSF  321



>ref|XP_010472011.1| PREDICTED: F-box protein At1g78100-like [Camelina sativa]
Length=332

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -1

Query  797  KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF----  630
            +RT+VP++ M + +AP L L  G  L+ ATLV +RP+     D   +D   V  AF    
Sbjct  251  ERTVVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPTGLASDD---NDAELVTEAFAGDG  307

Query  629  -DEPYGAAARMLVKRRTYCLEMNSF  558
             D  YG A   L+KRR   LEMNSF
Sbjct  308  GDCMYGEAVTALLKRRRNVLEMNSF  332



>ref|XP_012067843.1| PREDICTED: F-box protein At1g22220 [Jatropha curcas]
 gb|KDP41362.1| hypothetical protein JCGZ_15769 [Jatropha curcas]
Length=324

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 27/125 (22%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVKPLSASS-----ASKRTLVPALNMRLWYAPHLELPDGTVLKGAT  708
            +G + M++E   E R++  +  S      + RT+VP++ MR+ +   ++L +G+ ++GAT
Sbjct  207  EGKVVMDKEGLRECRMETTAPESDEWEWEASRTMVPSVRMRMRHKRRVQLNNGSWVEGAT  266

Query  707  LVAIRPSEQHKKDVVGSDGNW---VASAFDEP------------YGAAARMLVKRRTYCL  573
            LV +RPS       VG DG+    VA+A  E             YG A ++L+K + Y L
Sbjct  267  LVVVRPS-------VGKDGDGRSEVAAADVEDAELATTAFGGGVYGEAVQLLLKSKGYLL  319

Query  572  EMNSF  558
            EMNSF
Sbjct  320  EMNSF  324



>ref|XP_008219667.1| PREDICTED: F-box protein At1g22220 [Prunus mume]
Length=324

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = -1

Query  794  RTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF--DEP  621
            R+ VP++ MR+ + P +EL  G  ++GATLV +RPS     DV   DG+    AF  D  
Sbjct  248  RSRVPSVRMRMRHVPRMELKGGVWVEGATLVVVRPS--LSGDV--EDGDLAMGAFGGDVL  303

Query  620  YGAAARMLVKRRTYCLEMNSF  558
            YG     L+K ++Y LEMNSF
Sbjct  304  YGEVVEALLKAKSYLLEMNSF  324



>ref|XP_007227716.1| hypothetical protein PRUPE_ppa009011mg [Prunus persica]
 gb|EMJ28915.1| hypothetical protein PRUPE_ppa009011mg [Prunus persica]
Length=310

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = -1

Query  794  RTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF--DEP  621
            R+ VP++ MR+ + P +EL  G  ++GATLV +RPS     DV   DG+    AF  D  
Sbjct  234  RSRVPSVRMRMRHVPRMELKGGVWVEGATLVVVRPS--LSGDV--EDGDLAMGAFGGDVL  289

Query  620  YGAAARMLVKRRTYCLEMNSF  558
            YG     L+K ++Y LEMNSF
Sbjct  290  YGEVVEALLKAKSYLLEMNSF  310



>gb|KCW87201.1| hypothetical protein EUGRSUZ_B03721 [Eucalyptus grandis]
Length=503

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 69/131 (53%), Gaps = 29/131 (22%)
 Frame = -1

Query  872  QGVLCMNREQPEELRVK---PLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGATL  705
            QG + M  E+  E+R       + SS+++R  VP L M+LWYAP LELP+ G V++GAT+
Sbjct  376  QGKVRMLEEEIAEMRRSFDSEAADSSSAERIRVPDLRMKLWYAPELELPESGYVMRGATM  435

Query  704  VAIRPS-----EQHKK------------DVVGS-----DGNWVASAFDEPYGAAARMLVK  591
            V I P+     E+H K            DV+ S      G    +AF E   AA  M   
Sbjct  436  VLIAPASEAEGEEHGKAKEGGGGGGDLGDVMRSASFEGGGGEDEAAFRE---AATEMGKL  492

Query  590  RRTYCLEMNSF  558
            +RTY LEMNSF
Sbjct  493  KRTYTLEMNSF  503



>ref|XP_002887721.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63980.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -1

Query  797  KRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAF----  630
            +RT+VP++ M + +AP L L  G  L+ ATLV +RP+     D   +D   V  AF    
Sbjct  252  ERTVVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPTGVASDD---NDVELVTEAFAGDG  308

Query  629  -DEPYGAAARMLVKRRTYCLEMNSF  558
             D  YG A   L+KRR   LEMNSF
Sbjct  309  GDCMYGEAVTALLKRRRNVLEMNSF  333



>ref|XP_006416219.1| hypothetical protein EUTSA_v10010014mg [Eutrema salsugineum]
 gb|ESQ34572.1| hypothetical protein EUTSA_v10010014mg [Eutrema salsugineum]
Length=324

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -1

Query  800  SKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEP  621
            ++R++VP++ M + +AP L+L  G  L+ ATLV +RP+E +  DV   +    A A D  
Sbjct  245  NRRSVVPSVRMSMRHAPSLKLKSGICLESATLVVVRPNEDY-SDVGDDELATEAFAGDCM  303

Query  620  YGAAARMLVKRRTYCLEMNSF  558
            YG A   L+KR+   LEMNSF
Sbjct  304  YGEAVVALLKRKKNPLEMNSF  324



>gb|KFK44323.1| hypothetical protein AALP_AA1G243300 [Arabis alpina]
Length=320

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -1

Query  800  SKRTLVPALNMRLWYAPHLELPDGTVLKGATLVAIRPSEQHKKDVVGSDGNWVASAFDEP  621
            ++R++VP++ M + +AP L+L +G  L+ ATLV +RPSE++  DV   +    A A D  
Sbjct  241  NRRSVVPSVKMSMRHAPSLKLKNGICLESATLVIVRPSEEY-SDVGDDEMATEAFAGDCI  299

Query  620  YGAAARMLVKRRTYCLEMNSF  558
            YG A   L+K +   LEMNSF
Sbjct  300  YGEAVVALLKCKKNHLEMNSF  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2131933200072