BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8147

Length=1180
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB68026.1|  hypothetical protein B456_010G222500                    500   1e-174   Gossypium raimondii
gb|KHG18085.1|  putative CCR4-associated factor 1 -like protein         500   4e-174   Gossypium arboreum [tree cotton]
ref|XP_002527306.1|  ccr4-associated factor, putative                   498   9e-174   Ricinus communis
ref|XP_009605547.1|  PREDICTED: probable CCR4-associated factor 1...    498   1e-173   Nicotiana tomentosiformis
ref|XP_012067515.1|  PREDICTED: probable CCR4-associated factor 1...    498   1e-173   Jatropha curcas
ref|XP_002272165.1|  PREDICTED: probable CCR4-associated factor 1...    498   2e-173   Vitis vinifera
ref|XP_009760590.1|  PREDICTED: probable CCR4-associated factor 1...    496   5e-173   Nicotiana sylvestris
ref|XP_011020623.1|  PREDICTED: probable CCR4-associated factor 1...    495   1e-172   Populus euphratica
ref|XP_011034532.1|  PREDICTED: probable CCR4-associated factor 1...    495   2e-172   Populus euphratica
ref|XP_004235935.1|  PREDICTED: probable CCR4-associated factor 1...    494   2e-172   Solanum lycopersicum
ref|XP_007023408.1|  Polynucleotidyl transferase, ribonuclease H-...    494   2e-172   Theobroma cacao [chocolate]
ref|XP_009594641.1|  PREDICTED: probable CCR4-associated factor 1...    494   3e-172   Nicotiana tomentosiformis
ref|XP_011082241.1|  PREDICTED: probable CCR4-associated factor 1...    494   4e-172   Sesamum indicum [beniseed]
ref|XP_006356242.1|  PREDICTED: probable CCR4-associated factor 1...    494   5e-172   Solanum tuberosum [potatoes]
ref|XP_004241682.1|  PREDICTED: probable CCR4-associated factor 1...    493   6e-172   Solanum lycopersicum
ref|XP_006341359.1|  PREDICTED: probable CCR4-associated factor 1...    493   1e-171   Solanum tuberosum [potatoes]
ref|XP_007023407.1|  CCR4-associated factor 1                           496   1e-171   
ref|XP_002303842.1|  hypothetical protein POPTR_0003s17950g             492   2e-171   
gb|KJB66334.1|  hypothetical protein B456_010G136400                    490   1e-170   Gossypium raimondii
ref|XP_009793121.1|  PREDICTED: probable CCR4-associated factor 1...    490   2e-170   Nicotiana sylvestris
ref|XP_007215794.1|  hypothetical protein PRUPE_ppa009874mg             490   2e-170   Prunus persica
ref|XP_007023403.1|  Polynucleotidyl transferase, ribonuclease H-...    490   2e-170   
ref|XP_010275748.1|  PREDICTED: probable CCR4-associated factor 1...    488   1e-169   Nelumbo nucifera [Indian lotus]
ref|XP_008228784.1|  PREDICTED: probable CCR4-associated factor 1...    486   4e-169   Prunus mume [ume]
gb|EYU24608.1|  hypothetical protein MIMGU_mgv1a011718mg                486   8e-169   Erythranthe guttata [common monkey flower]
emb|CDO98220.1|  unnamed protein product                                486   8e-169   Coffea canephora [robusta coffee]
ref|XP_004305482.1|  PREDICTED: probable CCR4-associated factor 1...    484   3e-168   Fragaria vesca subsp. vesca
ref|XP_009354185.1|  PREDICTED: probable CCR4-associated factor 1...    483   5e-168   Pyrus x bretschneideri [bai li]
ref|XP_008375521.1|  PREDICTED: probable CCR4-associated factor 1...    483   8e-168   Malus domestica [apple tree]
ref|XP_003530297.1|  PREDICTED: probable CCR4-associated factor 1...    483   8e-168   Glycine max [soybeans]
ref|XP_010265638.1|  PREDICTED: probable CCR4-associated factor 1...    483   1e-167   Nelumbo nucifera [Indian lotus]
ref|XP_012076450.1|  PREDICTED: probable CCR4-associated factor 1...    482   2e-167   Jatropha curcas
ref|XP_002515442.1|  ccr4-associated factor, putative                   481   3e-167   
ref|XP_003526204.1|  PREDICTED: probable CCR4-associated factor 1...    481   4e-167   Glycine max [soybeans]
ref|XP_004507083.1|  PREDICTED: probable CCR4-associated factor 1...    481   4e-167   Cicer arietinum [garbanzo]
gb|ACU24625.1|  unknown                                                 481   5e-167   Glycine max [soybeans]
gb|KJB07590.1|  hypothetical protein B456_001G031500                    479   2e-166   Gossypium raimondii
ref|XP_011082251.1|  PREDICTED: probable CCR4-associated factor 1...    478   6e-166   Sesamum indicum [beniseed]
ref|XP_006427595.1|  hypothetical protein CICLE_v10026260mg             478   8e-166   
ref|XP_010092187.1|  putative CCR4-associated factor 1-7-like pro...    478   1e-165   Morus notabilis
ref|XP_007135810.1|  hypothetical protein PHAVU_010G160400g             478   1e-165   Phaseolus vulgaris [French bean]
ref|XP_010089956.1|  putative CCR4-associated factor 1-7-like pro...    478   1e-165   Morus notabilis
ref|XP_003522433.1|  PREDICTED: probable CCR4-associated factor 1...    478   1e-165   Glycine max [soybeans]
ref|XP_011073341.1|  PREDICTED: probable CCR4-associated factor 1...    477   2e-165   Sesamum indicum [beniseed]
gb|EPS71126.1|  hypothetical protein M569_03633                         476   2e-165   Genlisea aurea
ref|XP_007136961.1|  hypothetical protein PHAVU_009G088600g             476   3e-165   Phaseolus vulgaris [French bean]
ref|XP_006465196.1|  PREDICTED: probable CCR4-associated factor 1...    476   3e-165   Citrus sinensis [apfelsine]
ref|XP_006857184.1|  PREDICTED: probable CCR4-associated factor 1...    476   6e-165   Amborella trichopoda
gb|KDO42998.1|  hypothetical protein CISIN_1g023991mg                   476   7e-165   Citrus sinensis [apfelsine]
ref|XP_003531734.1|  PREDICTED: probable CCR4-associated factor 1...    475   2e-164   
gb|KHN07034.1|  Putative CCR4-associated factor 1 like 7                474   2e-164   Glycine soja [wild soybean]
ref|XP_002324905.2|  hypothetical protein POPTR_0018s02370g             474   4e-164   Populus trichocarpa [western balsam poplar]
gb|KHG00404.1|  putative CCR4-associated factor 1 -like protein         473   4e-164   Gossypium arboreum [tree cotton]
ref|XP_011036659.1|  PREDICTED: probable CCR4-associated factor 1...    473   1e-163   Populus euphratica
ref|XP_003604226.1|  Ribonuclease CAF1                                  472   1e-163   
ref|XP_002309667.1|  hypothetical protein POPTR_0006s27840g             472   2e-163   Populus trichocarpa [western balsam poplar]
gb|ACU20942.1|  unknown                                                 472   2e-163   Glycine max [soybeans]
gb|KJB68416.1|  hypothetical protein B456_010G244300                    472   2e-163   Gossypium raimondii
gb|KJB55043.1|  hypothetical protein B456_009G061200                    471   5e-163   Gossypium raimondii
ref|XP_009801027.1|  PREDICTED: probable CCR4-associated factor 1...    470   8e-163   Nicotiana sylvestris
gb|AFK43307.1|  unknown                                                 470   1e-162   Lotus japonicus
ref|XP_010048831.1|  PREDICTED: probable CCR4-associated factor 1...    468   6e-162   Eucalyptus grandis [rose gum]
ref|XP_007011965.1|  Polynucleotidyl transferase, ribonuclease H-...    468   7e-162   
gb|KHG16599.1|  putative CCR4-associated factor 1 -like protein         467   1e-161   Gossypium arboreum [tree cotton]
ref|XP_009620266.1|  PREDICTED: probable CCR4-associated factor 1...    467   2e-161   Nicotiana tomentosiformis
ref|XP_010665982.1|  PREDICTED: probable CCR4-associated factor 1...    466   2e-161   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010532089.1|  PREDICTED: probable CCR4-associated factor 1...    466   3e-161   Tarenaya hassleriana [spider flower]
ref|XP_011039582.1|  PREDICTED: probable CCR4-associated factor 1...    466   3e-161   Populus euphratica
gb|KHF99352.1|  putative CCR4-associated factor 1 -like protein         468   6e-161   Gossypium arboreum [tree cotton]
ref|XP_004504674.1|  PREDICTED: probable CCR4-associated factor 1...    466   8e-161   Cicer arietinum [garbanzo]
ref|XP_008445259.1|  PREDICTED: probable CCR4-associated factor 1...    464   1e-160   Cucumis melo [Oriental melon]
ref|XP_010942117.1|  PREDICTED: probable CCR4-associated factor 1...    464   2e-160   Elaeis guineensis
ref|XP_009417447.1|  PREDICTED: probable CCR4-associated factor 1...    464   3e-160   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006294779.1|  hypothetical protein CARUB_v10023830mg             464   3e-160   Capsella rubella
ref|XP_006356929.1|  PREDICTED: probable CCR4-associated factor 1...    464   4e-160   Solanum tuberosum [potatoes]
ref|XP_004138704.1|  PREDICTED: probable CCR4-associated factor 1...    463   5e-160   Cucumis sativus [cucumbers]
ref|XP_004291948.1|  PREDICTED: probable CCR4-associated factor 1...    462   7e-160   Fragaria vesca subsp. vesca
ref|XP_010532085.1|  PREDICTED: probable CCR4-associated factor 1...    462   8e-160   Tarenaya hassleriana [spider flower]
ref|XP_010469632.1|  PREDICTED: probable CCR4-associated factor 1...    462   9e-160   Camelina sativa [gold-of-pleasure]
ref|XP_010532091.1|  PREDICTED: probable CCR4-associated factor 1...    461   2e-159   Tarenaya hassleriana [spider flower]
ref|XP_010414034.1|  PREDICTED: probable CCR4-associated factor 1...    461   3e-159   Camelina sativa [gold-of-pleasure]
ref|XP_010472873.1|  PREDICTED: probable CCR4-associated factor 1...    461   5e-159   Camelina sativa [gold-of-pleasure]
ref|XP_002881215.1|  hypothetical protein ARALYDRAFT_902256             461   5e-159   Arabidopsis lyrata subsp. lyrata
ref|XP_009128391.1|  PREDICTED: probable CCR4-associated factor 1...    461   5e-159   Brassica rapa
ref|XP_006483458.1|  PREDICTED: probable CCR4-associated factor 1...    461   6e-159   Citrus sinensis [apfelsine]
ref|XP_010929136.1|  PREDICTED: probable CCR4-associated factor 1...    460   7e-159   Elaeis guineensis
emb|CDY63973.1|  BnaC02g46620D                                          460   7e-159   Brassica napus [oilseed rape]
ref|XP_010510101.1|  PREDICTED: probable CCR4-associated factor 1...    460   9e-159   Camelina sativa [gold-of-pleasure]
ref|XP_006302671.1|  hypothetical protein CARUB_v10020778mg             459   2e-158   Capsella rubella
emb|CDP10211.1|  unnamed protein product                                459   2e-158   Coffea canephora [robusta coffee]
ref|XP_010648684.1|  PREDICTED: probable CCR4-associated factor 1...    459   2e-158   Vitis vinifera
ref|XP_010063560.1|  PREDICTED: probable CCR4-associated factor 1...    459   2e-158   Eucalyptus grandis [rose gum]
ref|XP_009390565.1|  PREDICTED: probable CCR4-associated factor 1...    459   3e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009363839.1|  PREDICTED: probable CCR4-associated factor 1...    458   4e-158   Pyrus x bretschneideri [bai li]
ref|NP_565735.1|  polynucleotidyl transferase, ribonuclease H-lik...    459   4e-158   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178193.1|  putative CCR4-associated factor 1-like 6              458   4e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473977.1|  PREDICTED: probable CCR4-associated factor 1...    458   4e-158   Citrus sinensis [apfelsine]
ref|XP_004501372.1|  PREDICTED: probable CCR4-associated factor 1...    457   7e-158   
ref|XP_006450304.1|  hypothetical protein CICLE_v10008276mg             464   9e-158   
gb|EYU21723.1|  hypothetical protein MIMGU_mgv1a019889mg                457   1e-157   Erythranthe guttata [common monkey flower]
ref|XP_010691601.1|  PREDICTED: probable CCR4-associated factor 1...    457   1e-157   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008794330.1|  PREDICTED: probable CCR4-associated factor 1...    457   2e-157   Phoenix dactylifera
ref|XP_006389834.1|  hypothetical protein EUTSA_v10018990mg             456   2e-157   Eutrema salsugineum [saltwater cress]
emb|CAN79806.1|  hypothetical protein VITISV_031504                     456   3e-157   Vitis vinifera
ref|XP_010429900.1|  PREDICTED: probable CCR4-associated factor 1...    456   3e-157   Camelina sativa [gold-of-pleasure]
ref|XP_009106716.1|  PREDICTED: probable CCR4-associated factor 1...    456   6e-157   Brassica rapa
ref|NP_001185452.1|  putative CCR4-associated factor 1-like 6           456   8e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799630.1|  PREDICTED: probable CCR4-associated factor 1...    455   1e-156   Phoenix dactylifera
gb|KJB06630.1|  hypothetical protein B456_001G037000                    454   1e-156   Gossypium raimondii
ref|XP_010048142.1|  PREDICTED: probable CCR4-associated factor 1...    454   1e-156   Eucalyptus grandis [rose gum]
ref|XP_004250764.1|  PREDICTED: probable CCR4-associated factor 1...    454   1e-156   Solanum lycopersicum
ref|XP_008378874.1|  PREDICTED: probable CCR4-associated factor 1...    454   2e-156   Malus domestica [apple tree]
ref|XP_006453661.1|  hypothetical protein CICLE_v10009159mg             454   2e-156   Citrus clementina [clementine]
ref|XP_003603309.1|  Ribonuclease CAF1                                  454   2e-156   
gb|AFK45143.1|  unknown                                                 454   2e-156   Lotus japonicus
ref|XP_010417661.1|  PREDICTED: probable CCR4-associated factor 1...    454   2e-156   Camelina sativa [gold-of-pleasure]
gb|KHN29617.1|  Putative CCR4-associated factor 1 like 7                453   4e-156   Glycine soja [wild soybean]
ref|XP_009399558.1|  PREDICTED: probable CCR4-associated factor 1...    453   6e-156   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY39943.1|  BnaC06g40210D                                          452   1e-155   Brassica napus [oilseed rape]
ref|XP_009144015.1|  PREDICTED: probable CCR4-associated factor 1...    452   1e-155   Brassica rapa
ref|XP_008445257.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    451   4e-155   Cucumis melo [Oriental melon]
emb|CDY12234.1|  BnaC04g12640D                                          451   4e-155   Brassica napus [oilseed rape]
gb|ACJ84891.1|  unknown                                                 450   8e-155   Medicago truncatula
gb|ACN40154.1|  unknown                                                 450   9e-155   Picea sitchensis
ref|XP_004138706.1|  PREDICTED: probable CCR4-associated factor 1...    449   1e-154   Cucumis sativus [cucumbers]
gb|ABK24400.1|  unknown                                                 449   2e-154   Picea sitchensis
ref|XP_011073532.1|  PREDICTED: probable CCR4-associated factor 1...    449   2e-154   Sesamum indicum [beniseed]
ref|XP_007202386.1|  hypothetical protein PRUPE_ppa009376mg             446   6e-153   Prunus persica
ref|XP_008377668.1|  PREDICTED: probable CCR4-associated factor 1...    444   1e-152   Malus domestica [apple tree]
ref|XP_008242960.1|  PREDICTED: probable CCR4-associated factor 1...    444   3e-152   Prunus mume [ume]
ref|XP_008220692.1|  PREDICTED: probable CCR4-associated factor 1...    442   9e-152   Prunus mume [ume]
ref|XP_008242959.1|  PREDICTED: probable CCR4-associated factor 1...    443   2e-151   
ref|XP_008336906.1|  PREDICTED: probable CCR4-associated factor 1...    442   3e-151   
ref|XP_006410344.1|  hypothetical protein EUTSA_v10017059mg             441   3e-151   Eutrema salsugineum [saltwater cress]
ref|XP_009358471.1|  PREDICTED: probable CCR4-associated factor 1...    440   1e-150   Pyrus x bretschneideri [bai li]
ref|XP_010556071.1|  PREDICTED: probable CCR4-associated factor 1...    437   6e-150   Tarenaya hassleriana [spider flower]
ref|XP_008344039.1|  PREDICTED: probable CCR4-associated factor 1...    437   1e-149   
ref|XP_008354337.1|  PREDICTED: probable CCR4-associated factor 1...    437   1e-149   
ref|XP_009366159.1|  PREDICTED: probable CCR4-associated factor 1...    437   2e-149   Pyrus x bretschneideri [bai li]
ref|XP_010537879.1|  PREDICTED: probable CCR4-associated factor 1...    433   4e-148   Tarenaya hassleriana [spider flower]
ref|XP_010541576.1|  PREDICTED: probable CCR4-associated factor 1...    433   4e-148   Tarenaya hassleriana [spider flower]
ref|XP_002279241.1|  PREDICTED: probable CCR4-associated factor 1...    432   6e-148   Vitis vinifera
gb|EYU32376.1|  hypothetical protein MIMGU_mgv1a026872mg                432   7e-148   Erythranthe guttata [common monkey flower]
emb|CAN68032.1|  hypothetical protein VITISV_022019                     430   4e-147   Vitis vinifera
ref|XP_002862886.1|  hypothetical protein ARALYDRAFT_920160             428   2e-146   
ref|XP_006368924.1|  hypothetical protein POPTR_0001s14860g             427   2e-146   
gb|EPS59819.1|  hypothetical protein M569_14984                         428   3e-146   Genlisea aurea
gb|ABK22659.1|  unknown                                                 428   6e-146   Picea sitchensis
ref|XP_007222518.1|  hypothetical protein PRUPE_ppa009848mg             427   7e-146   Prunus persica
ref|XP_007023404.1|  Polynucleotidyl transferase, ribonuclease H-...    422   2e-144   
ref|XP_004287117.1|  PREDICTED: probable CCR4-associated factor 1...    422   1e-143   Fragaria vesca subsp. vesca
ref|NP_196657.1|  polynucleotidyl transferase, ribonuclease H-lik...    419   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871445.1|  hypothetical protein ARALYDRAFT_487926             418   2e-142   
ref|XP_002309331.1|  hypothetical protein POPTR_0006s20130g             417   6e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010419649.1|  PREDICTED: probable CCR4-associated factor 1...    416   2e-141   Camelina sativa [gold-of-pleasure]
ref|XP_006286536.1|  hypothetical protein CARUB_v10001652mg             416   2e-141   Capsella rubella
gb|AAK92792.1|  putative CCR4-associated factor                         416   3e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033459.1|  PREDICTED: probable CCR4-associated factor 1...    415   4e-141   Populus euphratica
ref|XP_006399590.1|  hypothetical protein EUTSA_v10014350mg             416   4e-141   Eutrema salsugineum [saltwater cress]
ref|XP_010453129.1|  PREDICTED: probable CCR4-associated factor 1...    415   6e-141   Camelina sativa [gold-of-pleasure]
ref|XP_010491786.1|  PREDICTED: probable CCR4-associated factor 1...    414   1e-140   Camelina sativa [gold-of-pleasure]
ref|XP_004954218.1|  PREDICTED: probable CCR4-associated factor 1...    414   2e-140   Setaria italica
emb|CDX70376.1|  BnaC03g04600D                                          413   2e-140   
emb|CDX69796.1|  BnaA10g21450D                                          413   3e-140   
ref|XP_009122009.1|  PREDICTED: probable CCR4-associated factor 1...    413   3e-140   Brassica rapa
gb|ACL53982.1|  unknown                                                 413   3e-140   Zea mays [maize]
ref|XP_002452981.1|  hypothetical protein SORBIDRAFT_04g035960          412   9e-140   Sorghum bicolor [broomcorn]
ref|XP_001766532.1|  predicted protein                                  410   3e-139   
ref|XP_001755261.1|  predicted protein                                  410   4e-139   
emb|CDX97069.1|  BnaC09g45560D                                          409   1e-138   
gb|EEC74173.1|  hypothetical protein OsI_09281                          406   3e-137   Oryza sativa Indica Group [Indian rice]
dbj|BAD19081.1|  putative CCR4-NOT transcription complex subunit 7      406   3e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048387.1|  Os02g0796300                                       405   4e-137   
ref|XP_009131188.1|  PREDICTED: probable CCR4-associated factor 1...    405   5e-137   Brassica rapa
dbj|BAJ92910.1|  predicted protein                                      402   9e-136   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001136747.1|  uncharacterized protein LOC100216888               400   5e-135   Zea mays [maize]
dbj|BAK01540.1|  predicted protein                                      399   8e-135   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570299.1|  PREDICTED: probable CCR4-associated factor 1...    399   2e-134   Brachypodium distachyon [annual false brome]
ref|XP_002460215.1|  hypothetical protein SORBIDRAFT_02g024730          396   2e-133   Sorghum bicolor [broomcorn]
ref|NP_001063181.1|  Os09g0416800                                       394   9e-133   
gb|ABK21469.1|  unknown                                                 391   3e-132   Picea sitchensis
ref|XP_010541577.1|  PREDICTED: probable CCR4-associated factor 1...    390   5e-132   Tarenaya hassleriana [spider flower]
ref|XP_006660627.1|  PREDICTED: probable CCR4-associated factor 1...    391   2e-131   Oryza brachyantha
ref|XP_006648046.1|  PREDICTED: probable CCR4-associated factor 1...    390   5e-131   
gb|KJB06631.1|  hypothetical protein B456_001G037000                    385   6e-130   Gossypium raimondii
ref|XP_003578122.1|  PREDICTED: probable CCR4-associated factor 1...    385   3e-129   Brachypodium distachyon [annual false brome]
ref|XP_002965900.1|  hypothetical protein SELMODRAFT_84624              384   6e-129   Selaginella moellendorffii
ref|XP_006665053.1|  PREDICTED: probable CCR4-associated factor 1...    382   1e-127   Oryza brachyantha
ref|NP_001132298.1|  CCR4-NOT transcription complex subunit 7 iso...    381   1e-127   
ref|XP_004956826.1|  PREDICTED: probable CCR4-associated factor 1...    377   5e-126   Setaria italica
gb|KHN38030.1|  Putative CCR4-associated factor 1 like 7                375   2e-125   Glycine soja [wild soybean]
ref|XP_010048148.1|  PREDICTED: probable CCR4-associated factor 1...    374   6e-125   Eucalyptus grandis [rose gum]
ref|XP_002981023.1|  hypothetical protein SELMODRAFT_444748             374   1e-124   Selaginella moellendorffii
ref|XP_002982500.1|  hypothetical protein SELMODRAFT_179583             374   1e-124   Selaginella moellendorffii
ref|XP_009396102.1|  PREDICTED: probable CCR4-associated factor 1...    366   7e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932239.1|  PREDICTED: probable CCR4-associated factor 1...    365   1e-121   Elaeis guineensis
ref|NP_001148663.1|  CCR4-NOT transcription complex subunit 7           362   6e-121   Zea mays [maize]
ref|XP_009418496.1|  PREDICTED: probable CCR4-associated factor 1...    363   7e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395282.1|  PREDICTED: probable CCR4-associated factor 1...    362   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005649974.1|  CCR4-associated factor                             362   3e-120   Coccomyxa subellipsoidea C-169
ref|XP_009395283.1|  PREDICTED: probable CCR4-associated factor 1...    361   5e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW53891.1|  hypothetical protein EUGRSUZ_J03104                     358   2e-119   Eucalyptus grandis [rose gum]
ref|XP_001697447.1|  CCR4-associated factor                             360   2e-119   Chlamydomonas reinhardtii
ref|XP_005843563.1|  hypothetical protein CHLNCDRAFT_59811              357   3e-118   Chlorella variabilis
gb|EMS59499.1|  putative CCR4-associated factor 1-like protein 7        357   3e-118   Triticum urartu
ref|XP_003574542.1|  PREDICTED: probable CCR4-associated factor 1...    356   9e-118   Brachypodium distachyon [annual false brome]
emb|CDY12236.1|  BnaC04g12660D                                          358   1e-116   Brassica napus [oilseed rape]
ref|XP_008796886.1|  PREDICTED: probable CCR4-associated factor 1...    352   3e-116   Phoenix dactylifera
ref|XP_002950174.1|  hypothetical protein VOLCADRAFT_80930              353   3e-116   Volvox carteri f. nagariensis
ref|XP_003056015.1|  predicted protein                                  352   5e-116   Micromonas pusilla CCMP1545
ref|XP_007023405.1|  Polynucleotidyl transferase, ribonuclease H-...    348   5e-116   
gb|KCW62735.1|  hypothetical protein EUGRSUZ_G00324                     347   2e-115   Eucalyptus grandis [rose gum]
ref|XP_002890137.1|  hypothetical protein ARALYDRAFT_312582             348   7e-115   Arabidopsis lyrata subsp. lyrata
ref|NP_173044.1|  polynucleotidyl transferase, ribonuclease H-lik...    347   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304066.1|  hypothetical protein CARUB_v10009915mg             347   5e-114   Capsella rubella
ref|XP_006416864.1|  hypothetical protein EUTSA_v10008404mg             347   5e-114   Eutrema salsugineum [saltwater cress]
dbj|BAD09890.1|  putative CCR4-NOT transcription complex, subunit 7     345   1e-113   Oryza sativa Japonica Group [Japonica rice]
gb|AEN81307.1|  AT1G80780-like protein                                  342   2e-113   Capsella rubella
ref|XP_011395961.1|  putative CCR4-associated factor 1-like prote...    344   6e-113   Auxenochlorella protothecoides
gb|KFK43832.1|  hypothetical protein AALP_AA1G179300                    343   1e-112   Arabis alpina [alpine rockcress]
gb|EYU24605.1|  hypothetical protein MIMGU_mgv1a011876mg                342   2e-112   Erythranthe guttata [common monkey flower]
ref|XP_010927524.1|  PREDICTED: probable CCR4-associated factor 1...    340   8e-112   Elaeis guineensis
ref|XP_006659446.1|  PREDICTED: probable CCR4-associated factor 1...    339   3e-111   
ref|XP_009385031.1|  PREDICTED: probable CCR4-associated factor 1...    337   2e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB06633.1|  hypothetical protein B456_001G037000                    334   3e-110   Gossypium raimondii
ref|XP_010497514.1|  PREDICTED: probable CCR4-associated factor 1...    336   5e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010476692.1|  PREDICTED: probable CCR4-associated factor 1...    336   8e-110   Camelina sativa [gold-of-pleasure]
ref|XP_008779663.1|  PREDICTED: probable CCR4-associated factor 1...    334   2e-109   Phoenix dactylifera
ref|XP_010459127.1|  PREDICTED: probable CCR4-associated factor 1...    331   5e-108   Camelina sativa [gold-of-pleasure]
ref|XP_002507260.1|  predicted protein                                  329   2e-107   Micromonas commoda
ref|XP_007509231.1|  Caf1 CCR4-associated (transcription) factor 1      320   5e-104   Bathycoccus prasinos
ref|XP_001416204.1|  polyA tail-shortening ribonuclease, probable       320   5e-104   Ostreococcus lucimarinus CCE9901
ref|XP_009149028.1|  PREDICTED: probable CCR4-associated factor 1...    320   6e-104   Brassica rapa
emb|CDY35049.1|  BnaA06g10590D                                          319   1e-103   Brassica napus [oilseed rape]
ref|XP_005707256.1|  CCR4-NOT transcription complex subunit 7/8         320   2e-103   Galdieria sulphuraria
emb|CDY33367.1|  BnaC05g12160D                                          324   8e-103   Brassica napus [oilseed rape]
gb|KCW80614.1|  hypothetical protein EUGRSUZ_C01981                     315   1e-102   Eucalyptus grandis [rose gum]
ref|XP_008352217.1|  PREDICTED: probable CCR4-associated factor 1...    313   2e-102   
ref|XP_004354599.1|  CAF1 family protein                                321   2e-102   Cavenderia fasciculata
ref|NP_001140241.1|  uncharacterized protein LOC100272282               316   6e-102   Zea mays [maize]
ref|XP_004337732.1|  ccr4associated factor, putative                    315   6e-102   Acanthamoeba castellanii str. Neff
ref|XP_011006693.1|  PREDICTED: probable CCR4-associated factor 1...    315   7e-102   Populus euphratica
ref|XP_002444415.1|  hypothetical protein SORBIDRAFT_07g021610          315   1e-101   Sorghum bicolor [broomcorn]
ref|XP_006854720.2|  PREDICTED: probable CCR4-associated factor 1...    315   2e-101   
ref|XP_008676671.1|  PREDICTED: uncharacterized protein LOC100216...    314   4e-101   
gb|EMT24915.1|  Putative CCR4-associated factor 1-7-like protein        310   6e-101   
gb|AGT16865.1|  transcription complex                                   313   7e-101   Saccharum hybrid cultivar R570
ref|XP_011006712.1|  PREDICTED: probable CCR4-associated factor 1...    311   2e-100   Populus euphratica
ref|XP_010469633.1|  PREDICTED: probable CCR4-associated factor 1...    310   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_003074753.1|  Caf1 CCR4-associated (transcription) factor,...    311   2e-100   
gb|EAZ07127.1|  hypothetical protein OsI_29374                          310   2e-100   Oryza sativa Indica Group [Indian rice]
gb|KDD75431.1|  CAF1 family ribonuclease                                308   8e-100   Helicosporidium sp. ATCC 50920
ref|XP_006854719.1|  PREDICTED: probable CCR4-associated factor 1...    310   9e-100   
gb|ERN16187.1|  hypothetical protein AMTR_s00030p00236940               309   1e-99    Amborella trichopoda
emb|CDH53595.1|  caf1 family protein                                    310   1e-99    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006384784.1|  CCR4-NOT transcription complex family protein      309   1e-99    Populus trichocarpa [western balsam poplar]
gb|ABY89387.1|  chromatin assembly factor 1                             306   2e-99    Pinus taeda
ref|XP_012084581.1|  PREDICTED: probable CCR4-associated factor 1...    308   2e-99    Jatropha curcas
ref|XP_006361099.1|  PREDICTED: probable CCR4-associated factor 1...    307   6e-99    Solanum tuberosum [potatoes]
ref|XP_007877414.1|  hypothetical protein PFL1_01713                    309   8e-99    Anthracocystis flocculosa PF-1
ref|XP_010246433.1|  PREDICTED: probable CCR4-associated factor 1...    307   9e-99    Nelumbo nucifera [Indian lotus]
gb|EFA83975.1|  CAF1 family protein                                     321   1e-98    Heterostelium album PN500
emb|CEG62914.1|  Putative CCR4-NOT transcription complex subunit 7      307   1e-98    Rhizopus microsporus
ref|XP_012071479.1|  PREDICTED: probable CCR4-associated factor 1...    305   3e-98    
emb|CEP13830.1|  hypothetical protein                                   306   3e-98    Parasitella parasitica
gb|EMS46974.1|  putative CCR4-associated factor 1-like protein 7        304   4e-98    Triticum urartu
emb|CBQ71168.1|  probable CCR4-NOT transcription complex, subunit 7     306   5e-98    Sporisorium reilianum SRZ2
ref|XP_006680570.1|  hypothetical protein BATDEDRAFT_90073              305   6e-98    Batrachochytrium dendrobatidis JAM81
emb|CDH54244.1|  ccr4-not transcription complex subunit 7               306   7e-98    Lichtheimia corymbifera JMRC:FSU:9682
gb|ETS62597.1|  hypothetical protein PaG_03234                          306   8e-98    Moesziomyces aphidis DSM 70725
dbj|GAK65069.1|  ribonuclease CAF1                                      306   9e-98    Moesziomyces antarcticus
gb|ACE98441.1|  ribonuclease CAF1                                       300   1e-97    Populus tremula [European aspen]
gb|KFH71636.1|  hypothetical protein MVEG_01932                         305   2e-97    Mortierella verticillata NRRL 6337
emb|CDS05253.1|  Putative CCR4-NOT transcription complex subunit7       303   2e-97    Lichtheimia ramosa
ref|XP_007346111.1|  CAF1-domain-containing protein                     305   3e-97    
ref|XP_008548221.1|  PREDICTED: CCR4-NOT transcription complex su...    303   3e-97    Microplitis demolitor
ref|XP_008548220.1|  PREDICTED: CCR4-NOT transcription complex su...    304   3e-97    Microplitis demolitor
ref|XP_010262944.1|  PREDICTED: probable CCR4-associated factor 1...    303   3e-97    Nelumbo nucifera [Indian lotus]
ref|XP_008548219.1|  PREDICTED: CCR4-NOT transcription complex su...    304   4e-97    Microplitis demolitor
ref|NP_001131670.1|  uncharacterized protein LOC100193030               303   5e-97    
ref|XP_638651.1|  CAF1 family protein                                   306   6e-97    
gb|KDN37229.1|  CAF1-domain-containing protein                          305   6e-97    
dbj|GAN07390.1|  CCR4 associated factor                                 303   7e-97    
ref|XP_011388715.1|  putative CCR4-NOT core exoribonuclease subun...    303   1e-96    
ref|XP_007015724.1|  Polynucleotidyl transferase, ribonuclease H-...    302   1e-96    
emb|CEI89573.1|  Putative CCR4-NOT transcription complex subunit 7      300   2e-96    
gb|EMS21915.1|  CCR4-NOT transcription complex subunit 7/8              302   3e-96    
gb|KJB35417.1|  hypothetical protein B456_006G114000                    301   3e-96    
ref|XP_004241342.1|  PREDICTED: probable CCR4-associated factor 1...    300   3e-96    
ref|XP_009369921.1|  PREDICTED: probable CCR4-associated factor 1...    301   3e-96    
gb|AGV54478.1|  CCR4-associated factor 1-like protein 11                301   3e-96    
emb|CCF48047.1|  probable CCR4-NOT transcription complex, subunit 7     302   4e-96    
emb|CDS11386.1|  Putative CCR4-NOT transcription complex subunit7       300   4e-96    
gb|ACL52816.1|  unknown                                                 300   5e-96    
ref|XP_011694062.1|  PREDICTED: CCR4-NOT transcription complex su...    300   5e-96    
gb|EFN64855.1|  CCR4-NOT transcription complex subunit 7                300   5e-96    
dbj|GAM18889.1|  hypothetical protein SAMD00019534_020640               303   5e-96    
ref|XP_011337289.1|  PREDICTED: CCR4-NOT transcription complex su...    301   6e-96    
ref|XP_011694058.1|  PREDICTED: CCR4-NOT transcription complex su...    301   6e-96    
ref|XP_011873054.1|  PREDICTED: CCR4-NOT transcription complex su...    301   6e-96    
ref|XP_003521484.1|  PREDICTED: probable CCR4-associated factor 1...    300   7e-96    
gb|KJB21739.1|  hypothetical protein B456_004G011500                    300   7e-96    
ref|XP_006568301.1|  PREDICTED: CCR4-NOT transcription complex su...    300   8e-96    
ref|XP_011261446.1|  PREDICTED: CCR4-NOT transcription complex su...    300   8e-96    
ref|XP_006568302.1|  PREDICTED: CCR4-NOT transcription complex su...    300   8e-96    
ref|XP_003396031.1|  PREDICTED: CCR4-NOT transcription complex su...    300   8e-96    
ref|XP_011873055.1|  PREDICTED: CCR4-NOT transcription complex su...    300   8e-96    
ref|XP_011694059.1|  PREDICTED: CCR4-NOT transcription complex su...    300   8e-96    
emb|CDI55400.1|  probable CCR4-NOT transcription complex, subunit 7     301   9e-96    
ref|XP_010510103.1|  PREDICTED: probable CCR4-associated factor 1...    298   9e-96    
ref|XP_011501465.1|  PREDICTED: CCR4-NOT transcription complex su...    300   9e-96    
ref|XP_003283707.1|  hypothetical protein DICPUDRAFT_20033              299   1e-95    
ref|XP_003424661.1|  PREDICTED: CCR4-NOT transcription complex su...    300   1e-95    
ref|XP_001985184.1|  GH16922                                            301   1e-95    
ref|XP_011299715.1|  PREDICTED: CCR4-NOT transcription complex su...    300   1e-95    
ref|XP_001957405.1|  GF10398                                            300   1e-95    
ref|XP_002061857.1|  GK17222                                            300   1e-95    
ref|XP_002271636.1|  PREDICTED: probable CCR4-associated factor 1...    299   1e-95    
gb|EPB85653.1|  CCR4-NOT transcription complex subunit 7                298   1e-95    
ref|XP_011160728.1|  PREDICTED: CCR4-NOT transcription complex su...    299   1e-95    
gb|EXX67656.1|  Pop2p                                                   303   1e-95    
ref|XP_011299712.1|  PREDICTED: CCR4-NOT transcription complex su...    300   1e-95    
ref|XP_002008770.1|  GI13677                                            301   1e-95    
ref|XP_003693870.1|  PREDICTED: CCR4-NOT transcription complex su...    301   1e-95    
ref|XP_011160727.1|  PREDICTED: CCR4-NOT transcription complex su...    300   1e-95    
ref|XP_001601395.1|  PREDICTED: CCR4-NOT transcription complex su...    300   1e-95    
ref|XP_002523862.1|  ccr4-associated factor, putative                   299   2e-95    
ref|XP_011501464.1|  PREDICTED: CCR4-NOT transcription complex su...    301   2e-95    
ref|XP_008206873.1|  PREDICTED: CCR4-NOT transcription complex su...    300   2e-95    
ref|XP_011135448.1|  PREDICTED: CCR4-NOT transcription complex su...    300   2e-95    
ref|XP_010045176.1|  PREDICTED: probable CCR4-associated factor 1...    299   2e-95    
ref|XP_002048516.1|  GJ14014                                            300   2e-95    
ref|XP_003554457.1|  PREDICTED: probable CCR4-associated factor 1...    298   2e-95    
dbj|GAA97487.1|  hypothetical protein E5Q_04165                         299   2e-95    
gb|EST05943.1|  CCR4-NOT transcription complex, subunit 7               300   3e-95    
ref|XP_010104797.1|  putative CCR4-associated factor 1-9-like pro...    298   3e-95    
ref|XP_008342289.1|  PREDICTED: probable CCR4-associated factor 1...    301   3e-95    
gb|ERL90972.1|  hypothetical protein D910_08314                         299   3e-95    
ref|XP_003491312.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    300   3e-95    
ref|XP_003424663.1|  PREDICTED: CCR4-NOT transcription complex su...    300   3e-95    
ref|XP_001972481.1|  GG13860                                            298   4e-95    
ref|XP_008206772.1|  PREDICTED: CCR4-NOT transcription complex su...    299   4e-95    
gb|AEE62054.1|  unknown                                                 298   5e-95    
ref|XP_007162950.1|  hypothetical protein PHAVU_001G193900g             297   5e-95    
ref|XP_004139505.1|  PREDICTED: probable CCR4-associated factor 1...    297   5e-95    
ref|XP_002024844.1|  GL17886                                            298   6e-95    
dbj|BAM20372.1|  ccr4-associated factor                                 298   6e-95    
gb|KDE04055.1|  hypothetical protein MVLG_05494                         300   9e-95    
ref|XP_011299711.1|  PREDICTED: CCR4-NOT transcription complex su...    299   1e-94    
ref|XP_004251085.1|  PREDICTED: probable CCR4-associated factor 1...    296   2e-94    
emb|CAN76920.1|  hypothetical protein VITISV_015622                     295   2e-94    
ref|XP_003540260.1|  PREDICTED: probable CCR4-associated factor 1...    297   2e-94    
gb|KJB09109.1|  hypothetical protein B456_001G123600                    296   2e-94    
gb|KDQ62591.1|  hypothetical protein JAAARDRAFT_171083                  298   3e-94    
ref|XP_011179611.1|  PREDICTED: CCR4-NOT transcription complex su...    296   3e-94    
ref|XP_012140826.1|  PREDICTED: CCR4-NOT transcription complex su...    296   3e-94    
ref|XP_012140825.1|  PREDICTED: CCR4-NOT transcription complex su...    296   3e-94    
gb|KIL59216.1|  hypothetical protein M378DRAFT_169624                   298   3e-94    
ref|XP_011200256.1|  PREDICTED: CCR4-NOT transcription complex su...    296   3e-94    
ref|XP_006379358.1|  hypothetical protein POPTR_0009s16310g             295   3e-94    
ref|XP_004522122.1|  PREDICTED: CCR4-NOT transcription complex su...    296   3e-94    
ref|XP_011555168.1|  PREDICTED: CCR4-NOT transcription complex su...    296   4e-94    
ref|XP_011200255.1|  PREDICTED: CCR4-NOT transcription complex su...    296   4e-94    
ref|XP_011179602.1|  PREDICTED: CCR4-NOT transcription complex su...    296   4e-94    
ref|XP_005182888.1|  PREDICTED: CCR4-NOT transcription complex su...    296   4e-94    
ref|XP_004522121.1|  PREDICTED: CCR4-NOT transcription complex su...    296   5e-94    
ref|XP_005182887.1|  PREDICTED: CCR4-NOT transcription complex su...    296   5e-94    
ref|XP_007205684.1|  hypothetical protein PRUPE_ppa009650mg             295   5e-94    
gb|ENN73721.1|  hypothetical protein YQE_09671                          296   5e-94    
ref|XP_012140823.1|  PREDICTED: CCR4-NOT transcription complex su...    297   5e-94    
gb|ELT91034.1|  hypothetical protein CAPTEDRAFT_96823                   296   5e-94    
ref|XP_005182886.1|  PREDICTED: CCR4-NOT transcription complex su...    296   5e-94    
ref|XP_011200254.1|  PREDICTED: CCR4-NOT transcription complex su...    296   5e-94    
ref|NP_648538.1|  Pop2, isoform A                                       295   6e-94    
ref|XP_011179593.1|  PREDICTED: CCR4-NOT transcription complex su...    296   6e-94    
ref|XP_004522120.1|  PREDICTED: CCR4-NOT transcription complex su...    296   7e-94    
ref|NP_729775.1|  Pop2, isoform B                                       295   7e-94    
ref|XP_007271716.1|  CAF1-domain-containing protein                     298   7e-94    
gb|EWM25650.1|  ccr4-associated factor                                  297   1e-93    
ref|XP_003033973.1|  hypothetical protein SCHCODRAFT_66866              296   2e-93    
ref|XP_004927882.1|  PREDICTED: CCR4-NOT transcription complex su...    294   2e-93    
gb|AAN71585.1|  RH46192p                                                294   2e-93    
ref|XP_011043248.1|  PREDICTED: probable CCR4-associated factor 1...    293   2e-93    
gb|KIR59674.1|  CCR4-NOT transcription complex subunit 7/8              293   3e-93    
gb|ESA18671.1|  hypothetical protein GLOINDRAFT_75970                   292   3e-93    
gb|KIR85314.1|  CCR4-NOT transcription complex subunit 7/8              293   3e-93    
ref|XP_009804843.1|  PREDICTED: probable CCR4-associated factor 1...    293   3e-93    
gb|EHJ70264.1|  hypothetical protein KGM_18080                          294   3e-93    
ref|XP_008463638.1|  PREDICTED: probable CCR4-associated factor 1...    293   4e-93    
ref|XP_009266106.1|  CCR4-NOT transcription complex subunit 7           294   4e-93    
gb|KII86661.1|  hypothetical protein PLICRDRAFT_43301                   295   4e-93    
gb|KIR46241.1|  CCR4-NOT transcription complex subunit 7/8              293   5e-93    
ref|XP_568004.1|  ccr4-not transcription complex, subunit 7             293   5e-93    
ref|XP_003193445.1|  ccr4-not transcription complex, subunit 7          293   5e-93    
ref|XP_012048529.1|  CCR4-NOT transcription complex subunit 7/8         293   6e-93    
gb|KDR17086.1|  CCR4-NOT transcription complex subunit 7                295   6e-93    
ref|XP_975202.1|  PREDICTED: CCR4-NOT transcription complex subun...    293   7e-93    
gb|KDP38660.1|  hypothetical protein JCGZ_04013                         291   7e-93    
ref|XP_009604779.1|  PREDICTED: probable CCR4-associated factor 1...    292   7e-93    
ref|XP_007768705.1|  CAF1-domain-containing protein                     295   9e-93    
ref|XP_004927883.1|  PREDICTED: CCR4-NOT transcription complex su...    293   9e-93    
ref|XP_009616495.1|  PREDICTED: probable CCR4-associated factor 1...    291   9e-93    
gb|ABG66307.1|  CCR4 associated factor 1-related protein                291   1e-92    
ref|XP_010031548.1|  PREDICTED: probable CCR4-associated factor 1...    291   1e-92    
gb|EMD40070.1|  hypothetical protein CERSUDRAFT_112283                  294   1e-92    
ref|XP_011090316.1|  PREDICTED: probable CCR4-associated factor 1...    291   1e-92    
ref|XP_009020258.1|  hypothetical protein HELRODRAFT_81531              292   1e-92    
gb|KFM79896.1|  CCR4-NOT transcription complex subunit 7                292   2e-92    
ref|XP_007379942.1|  ribonuclease CAF1                                  291   2e-92    
ref|XP_008246147.1|  PREDICTED: probable CCR4-associated factor 1...    291   2e-92    
gb|ACU19702.1|  unknown                                                 292   2e-92    
ref|XP_007027917.1|  Polynucleotidyl transferase                        291   2e-92    
ref|XP_005823461.1|  hypothetical protein GUITHDRAFT_97567              293   3e-92    
ref|XP_002679115.1|  predicted protein                                  292   3e-92    
ref|NP_197617.1|  CCR4-associated factor 1B                             290   3e-92    
ref|XP_010907244.1|  PREDICTED: probable CCR4-associated factor 1...    290   3e-92    
ref|XP_010932240.1|  PREDICTED: probable CCR4-associated factor 1...    290   3e-92    
dbj|BAM20457.1|  ccr4-associated factor                                 291   4e-92    
ref|XP_006362860.1|  PREDICTED: probable CCR4-associated factor 1...    290   4e-92    
gb|AFS65102.1|  CCR4-associated factor 1-related protein                290   5e-92    
ref|XP_005854806.1|  CCR4-NOT transcription complex subunit 7/8         298   5e-92    
ref|XP_006400731.1|  hypothetical protein EUTSA_v10014297mg             290   6e-92    
ref|XP_005026245.1|  PREDICTED: CCR4-NOT transcription complex su...    290   7e-92    
gb|KIM89183.1|  hypothetical protein PILCRDRAFT_813097                  292   7e-92    
ref|XP_007870377.1|  ribonuclease CAF1                                  289   7e-92    
ref|XP_011088949.1|  PREDICTED: probable CCR4-associated factor 1...    289   1e-91    
gb|KIP02893.1|  hypothetical protein PHLGIDRAFT_20367                   291   1e-91    
emb|CDP06864.1|  unnamed protein product                                289   1e-91    
gb|KIJ62736.1|  hypothetical protein HYDPIDRAFT_176502                  291   1e-91    
dbj|BAM18477.1|  ccr4-associated factor                                 290   1e-91    
ref|XP_011441179.1|  PREDICTED: CCR4-NOT transcription complex su...    290   1e-91    
ref|XP_001836043.2|  hypothetical protein CC1G_05036                    291   1e-91    
gb|KIK57152.1|  hypothetical protein GYMLUDRAFT_762307                  291   2e-91    
gb|KGB78687.1|  ccr4-not transcription complex                          289   2e-91    
ref|XP_003538097.1|  PREDICTED: probable CCR4-associated factor 1...    288   2e-91    
ref|XP_004497679.1|  PREDICTED: probable CCR4-associated factor 1...    288   2e-91    
gb|KIY68330.1|  CAF1-domain-containing protein                          290   2e-91    
ref|XP_002403308.1|  CCR4-associated factor, putative                   290   3e-91    
gb|EPZ33260.1|  CCR4-NOT transcription complex subunit 7                288   3e-91    
emb|CBN76829.1|  conserved unknown protein                              293   3e-91    
ref|XP_008896820.1|  hypothetical protein PPTG_05090                    288   3e-91    
gb|KIK97075.1|  hypothetical protein PAXRUDRAFT_825323                  290   3e-91    
gb|ABP35526.1|  CCR4-associated factor                                  288   3e-91    
gb|EYU36042.1|  hypothetical protein MIMGU_mgv1a011524mg                288   3e-91    
ref|XP_007899528.1|  PREDICTED: CCR4-NOT transcription complex su...    288   3e-91    
ref|XP_007319405.1|  hypothetical protein SERLADRAFT_449989             290   3e-91    
ref|XP_010102028.1|  putative CCR4-associated factor 1-11-like pr...    288   4e-91    
ref|XP_010306411.1|  PREDICTED: CCR4-NOT transcription complex su...    288   4e-91    
ref|XP_003539842.1|  PREDICTED: probable CCR4-associated factor 1...    288   4e-91    
ref|XP_007008156.1|  hypothetical protein TREMEDRAFT_65998              288   4e-91    
gb|EGU13456.1|  hypothetical protein RTG_00172                          306   5e-91    
emb|CDX92371.1|  BnaA10g14100D                                          288   5e-91    
ref|XP_009802120.1|  PREDICTED: probable CCR4-associated factor 1...    287   5e-91    
ref|XP_001660003.1|  AAEL009400-PB                                      291   5e-91    
gb|EFX77573.1|  hypothetical protein DAPPUDRAFT_54175                   287   5e-91    
ref|XP_008391953.1|  PREDICTED: probable CCR4-associated factor 1...    287   6e-91    
gb|ETP32561.1|  hypothetical protein F442_18752                         287   7e-91    
ref|XP_006956137.1|  ribonuclease CAF1                                  286   8e-91    
ref|XP_009372560.1|  PREDICTED: probable CCR4-associated factor 1...    287   8e-91    
gb|KIJ17908.1|  hypothetical protein PAXINDRAFT_111622                  289   9e-91    
ref|XP_004494232.1|  PREDICTED: probable CCR4-associated factor 1...    287   1e-90    
ref|XP_009484874.1|  PREDICTED: CCR4-NOT transcription complex su...    288   1e-90    
ref|XP_009347151.1|  PREDICTED: probable CCR4-associated factor 1...    286   1e-90    
dbj|GAC98607.1|  potential mRNA deadenylase and CCR4-NOT complex ...    287   1e-90    
ref|XP_002113052.1|  hypothetical protein TRIADDRAFT_26102              286   1e-90    
gb|KFP89058.1|  CCR4-NOT transcription complex subunit 8                286   1e-90    
emb|CCM05935.1|  predicted protein                                      289   1e-90    
ref|XP_008037531.1|  CAF1-domain-containing protein                     288   1e-90    
ref|XP_638302.1|  CAF1 family protein                                   287   1e-90    
gb|KIK26635.1|  hypothetical protein PISMIDRAFT_675520                  289   1e-90    
ref|XP_009081324.1|  PREDICTED: CCR4-NOT transcription complex su...    286   1e-90    
ref|XP_007329866.1|  hypothetical protein AGABI1DRAFT_113727            288   2e-90    
gb|EHJ70265.1|  ccr4-associated factor                                  287   2e-90    
ref|XP_001660002.1|  AAEL009400-PA                                      291   2e-90    
gb|EJT45179.1|  ccr4-not transcription complex, subunit 7               287   2e-90    
ref|XP_005810986.1|  PREDICTED: CCR4-NOT transcription complex su...    286   2e-90    
ref|XP_007554812.1|  PREDICTED: CCR4-NOT transcription complex su...    286   2e-90    
ref|XP_010009453.1|  PREDICTED: CCR4-NOT transcription complex su...    286   2e-90    
ref|XP_001363106.2|  PREDICTED: CCR4-NOT transcription complex su...    288   2e-90    
ref|XP_008944762.1|  PREDICTED: CCR4-NOT transcription complex su...    286   2e-90    
ref|XP_009349767.1|  PREDICTED: probable CCR4-associated factor 1...    286   2e-90    
ref|NP_001025789.1|  CCR4-NOT transcription complex subunit 8           286   3e-90    
ref|XP_009940907.1|  PREDICTED: CCR4-NOT transcription complex su...    286   3e-90    
ref|XP_004291682.1|  PREDICTED: probable CCR4-associated factor 1...    286   3e-90    
ref|XP_002161572.1|  PREDICTED: CCR4-NOT transcription complex su...    286   3e-90    
emb|CDX98586.1|  BnaC05g37890D                                          285   3e-90    
ref|XP_008627167.1|  PREDICTED: CCR4-NOT transcription complex su...    286   3e-90    
ref|XP_012074359.1|  PREDICTED: probable CCR4-associated factor 1...    285   3e-90    
ref|XP_001363668.3|  PREDICTED: CCR4-NOT transcription complex su...    289   4e-90    
ref|XP_008499798.1|  PREDICTED: CCR4-NOT transcription complex su...    286   4e-90    
ref|XP_006021193.1|  PREDICTED: CCR4-NOT transcription complex su...    285   5e-90    
gb|EPS94721.1|  hypothetical protein FOMPIDRAFT_1026077                 287   6e-90    
ref|XP_006462397.1|  hypothetical protein AGABI2DRAFT_193555            287   6e-90    
ref|XP_003970132.1|  PREDICTED: CCR4-NOT transcription complex su...    285   7e-90    
ref|XP_008798872.1|  PREDICTED: probable CCR4-associated factor 1...    284   8e-90    
ref|XP_009120675.1|  PREDICTED: probable CCR4-associated factor 1...    284   8e-90    
ref|XP_317896.4|  AGAP011413-PA                                         287   8e-90    
ref|XP_007370165.1|  CAF1-domain-containing protein                     287   8e-90    
ref|XP_009396725.1|  PREDICTED: probable CCR4-associated factor 1...    284   9e-90    
ref|XP_009033148.1|  hypothetical protein AURANDRAFT_52324              286   9e-90    



>gb|KJB68026.1| hypothetical protein B456_010G222500 [Gossypium raimondii]
Length=274

 Score =   500 bits (1288),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/272 (87%), Positives = 259/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSI IREVWD N+EEEF LIRE+VDDYP++AMDTEFPGIVLRPVG FK+S DY
Sbjct  1    MSLLPKSDSIHIREVWDDNVEEEFALIREIVDDYPYVAMDTEFPGIVLRPVGYFKSSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKL+QLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF+LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQVGFFSLINIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+YSGVLYGLGVENGQ+
Sbjct  241  CTFRKLKENFFSGSLEKYSGVLYGLGVENGQS  272



>gb|KHG18085.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=300

 Score =   500 bits (1288),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 236/272 (87%), Positives = 259/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSI IREVWD N+EEEF LIR++VDDYP++AMDTEFPGIVLRPVG FK+S DY
Sbjct  27   MSLLPKSDSIHIREVWDDNVEEEFALIRDIVDDYPYVAMDTEFPGIVLRPVGYFKSSYDY  86

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKL+QLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  87   HYQTLKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  146

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  147  LRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLP  206

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF+LIN+YFP ++DIKHLM++CNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  207  DTQVGFFSLINIYFPTLYDIKHLMKYCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  266

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+YSGVLYGLGVENGQN
Sbjct  267  CTFRKLKENFFSGSLEKYSGVLYGLGVENGQN  298



>ref|XP_002527306.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF35058.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   498 bits (1282),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 237/272 (87%), Positives = 258/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSIQIREVW+ NLEEEF LIRE+VD+Y +IAMDTEFPGIVLRPVGNFKNS++Y
Sbjct  1    MSLLLKGDSIQIREVWNDNLEEEFSLIREIVDEYSYIAMDTEFPGIVLRPVGNFKNSNEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNERGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQLGFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQ+
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQS  272



>ref|XP_009605547.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
tomentosiformis]
Length=275

 Score =   498 bits (1282),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 235/272 (86%), Positives = 258/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK+DSI IREVW  NLEEEF LIREVVD++P+IAMDTEFPG+V+RPVGNFKNS DY
Sbjct  1    MSILPKTDSIHIREVWIDNLEEEFALIREVVDEFPYIAMDTEFPGVVIRPVGNFKNSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN E GI+A+RFGELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  121  LRQSGIDFTKNIEKGIDAKRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF L+N+YFP +FDIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DTQADFFTLMNVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQN  272



>ref|XP_012067515.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Jatropha 
curcas]
 gb|KDP41983.1| hypothetical protein JCGZ_27001 [Jatropha curcas]
Length=274

 Score =   498 bits (1281),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/272 (87%), Positives = 259/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSIQIREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLLKGDSIQIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLK+IQLGLTFSDE+GNLPTCGT K+CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKMIQLGLTFSDEQGNLPTCGTGKFCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E+GI+A +FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNENGIDAMQFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQVGFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQN  272



>ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010655010.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=274

 Score =   498 bits (1281),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 236/272 (87%), Positives = 259/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIREVW+ NLEEEF LIR +VD++PFIAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIRGIVDEFPFIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQ+GLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQMGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN E GI+A RFGELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQSGIDFMKNNEKGIDAVRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCKNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQAGFFNLINMYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQN  272



>ref|XP_009760590.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=275

 Score =   496 bits (1278),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 237/273 (87%), Positives = 259/273 (95%), Gaps = 1/273 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSI IREVW  NLE+EFDLIRE+VD+YP+IAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEQEFDLIREIVDEYPYIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LP
Sbjct  121  LRQSGIDFKKNIEKGIDATRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP VFDIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DTQTGFFNLINMYFPVVFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLG-VENGQN  176
            CTFRKLK+NFFSGS+E+Y+GVLYGLG VENGQN
Sbjct  241  CTFRKLKENFFSGSMEKYAGVLYGLGVVENGQN  273



>ref|XP_011020623.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   495 bits (1275),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 257/271 (95%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSI IREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSD++GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GID  KN E+GI+A RFGELLMSSGIVLNDSV+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDLNKNNENGIDAVRFGELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLTA
Sbjct  181  DTQAGFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQ  271



>ref|XP_011034532.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   495 bits (1274),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 236/272 (87%), Positives = 258/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSI IREVW+ NLEEEF  IRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLLKGDSILIREVWNDNLEEEFAHIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E+GI+A RFGELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNENGIDAVRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQAGFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQN  272



>ref|XP_004235935.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   494 bits (1273),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK+DSI IREVW  NLEEEF L+RE+VDD+PF+AMDTEFPG+V+RPVGNFKNS+DY
Sbjct  1    MSILPKTDSIHIREVWFDNLEEEFALMREIVDDFPFVAMDTEFPGVVIRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+ N E GI+A+ F ELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  121  LRQSGIDFKMNNEKGIDAKHFAELLMSSGIVLNDSVSWVTFHSGYDFGYLLKVLTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LIN+YFP +FDIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  ETQAGFFTLINVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSL++Y+GVLYGLGVENGQ+
Sbjct  241  CTFRKLKENFFSGSLDKYAGVLYGLGVENGQS  272



>ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007023409.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26030.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26031.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   494 bits (1273),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/272 (86%), Positives = 258/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYPF+AMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPFVAMDTEFPGIVLRPVGNFKNSYDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLT SD++GNLPTCGTDKYCIWQFNF EF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTLSDDQGNLPTCGTDKYCIWQFNFCEFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF+LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQVEFFSLINIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+YSGVLYGLG+ENGQ+
Sbjct  241  CTFRKLKENFFSGSLEKYSGVLYGLGIENGQS  272



>ref|XP_009594641.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=275

 Score =   494 bits (1272),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 236/273 (86%), Positives = 259/273 (95%), Gaps = 1/273 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSI IREVW  NLE+EFDLIRE+VD+YP+IAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEQEFDLIREIVDEYPYIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKY IWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYYIWQFNFCDFNPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+RFGELLMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LP
Sbjct  121  LRQSGIDFKKNIEKGIDAKRFGELLMSSGIVLNDTVYWVTFHSGYDFGYLLKILTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP VFDIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DTQAGFFNLINMYFPVVFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLG-VENGQN  176
            CTFRKLK+NFFSGS+E+Y+GVLYGLG VENGQN
Sbjct  241  CTFRKLKENFFSGSMEKYAGVLYGLGVVENGQN  273



>ref|XP_011082241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=272

 Score =   494 bits (1271),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 233/272 (86%), Positives = 257/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIREVW  NL+EEF LIRE+VDDYP+IAMDTEFPG+VLRPVGNFKNS D+
Sbjct  1    MSLLPKSDSIQIREVWADNLDEEFALIREIVDDYPYIAMDTEFPGVVLRPVGNFKNSSDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPDCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF +N E GI++RRF ELLMSSGIVLN++V+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFARNNEKGIDSRRFAELLMSSGIVLNNNVYWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LIN+YFP ++DIKHLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  ETQAGFFTLINIYFPVLYDIKHLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+YSGVLYGLGVE+GQ+
Sbjct  241  CTFRKLKENFFSGSLEKYSGVLYGLGVESGQS  272



>ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=273

 Score =   494 bits (1271),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 235/271 (87%), Positives = 260/271 (96%), Gaps = 1/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSI IREVW+ NLEEEFDLIRE+VDDYPFIAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWNDNLEEEFDLIREIVDDYPFIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E+GI+A+RFGE+LMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LP
Sbjct  121  LRQSGIDFKKNIENGIDAKRFGEILMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ+GFF LINMYFP ++D+KHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  ETQEGFFNLINMYFPVLYDVKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLG-VENG  182
            CTFRKLK+NFF GSLE+Y+GVLYGLG VENG
Sbjct  241  CTFRKLKENFFIGSLEKYAGVLYGLGVVENG  271



>ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Solanum 
lycopersicum]
Length=274

 Score =   493 bits (1270),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 236/271 (87%), Positives = 259/271 (96%), Gaps = 1/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSI IREVW  NLEEEFDLIREVVDDYPFIAMDTEFPG+VLRPVGNFKNS+DY
Sbjct  1    MSLLPKSDSIHIREVWSDNLEEEFDLIREVVDDYPFIAMDTEFPGVVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEDGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E+GI+A+RFGE+LMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LP
Sbjct  121  LRQSGIDFKKNIENGIDAKRFGEILMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ+GFF LINMYFP ++D+KHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  ETQEGFFNLINMYFPVLYDVKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLG-VENG  182
            CTFRKLK+NFF GSLE+Y+GVLYGLG VENG
Sbjct  241  CTFRKLKENFFIGSLEKYAGVLYGLGVVENG  271



>ref|XP_006341359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   493 bits (1269),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 230/272 (85%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK+DSI IREVW  NLEEEF L+RE+VDD+PF+AMDTEFPG+V+RPVGNFKNS+DY
Sbjct  1    MSILPKTDSIHIREVWFDNLEEEFALMREIVDDFPFVAMDTEFPGVVIRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+ N E G++A+ F ELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  121  LRQSGIDFKMNHEKGVDAKHFAELLMSSGIVLNDSVSWVTFHSGYDFGYLLKLLTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LIN+YFP +FDIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  ETQAGFFTLINVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSL++Y+GVLYGLGVENGQ+
Sbjct  241  CTFRKLKENFFSGSLDKYAGVLYGLGVENGQS  272



>ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao]
 gb|EOY26029.1| CCR4-associated factor 1 [Theobroma cacao]
Length=356

 Score =   496 bits (1277),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 257/271 (95%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFKNS DY
Sbjct  1    MSLLPKGDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKNSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTC TDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCATDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF+LIN+YFP ++DIKHLM+F NSL+GGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQAGFFSLINIYFPTLYDIKHLMKFSNSLYGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFFSGSLE+YSGVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFSGSLEKYSGVLYGLGVENGQ  271



>ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 ref|XP_006385927.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
 gb|EEE78821.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 gb|ERP63724.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
Length=274

 Score =   492 bits (1267),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 233/271 (86%), Positives = 256/271 (94%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSI IREVW+ NLEEEF LIRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSD++GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GID  KN E+GI+A RFGELLMSSGIVLNDSV+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDLNKNNENGIDAVRFGELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLTA
Sbjct  181  DTQAGFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFFS SLE+Y+GVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFSCSLEKYAGVLYGLGVENGQ  271



>gb|KJB66334.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66335.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66336.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
Length=271

 Score =   490 bits (1262),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 234/271 (86%), Positives = 256/271 (94%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK+S DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKSSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNF EF+ +EDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFCEFNVDEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELL+SSGIVLNDSV+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAMRFGELLISSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQVGFFNLINIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFFSG+LE+YSGVLYGLGVEN  
Sbjct  241  CTFRKLKENFFSGTLEKYSGVLYGLGVENAH  271



>ref|XP_009793121.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
sylvestris]
Length=275

 Score =   490 bits (1261),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 232/272 (85%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK++SI IREVW  NLEEEF LIREVVD++P+IAMDTEFPG+V+RPVGNFKNS DY
Sbjct  1    MSILPKTESILIREVWIDNLEEEFALIREVVDEFPYIAMDTEFPGVVIRPVGNFKNSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN E GI+A+RFGELLMSSGIVLND+V+WVTFHSGYDFGYLL +LTCQ+LP
Sbjct  121  LRQSGIDFTKNIEKGIDAKRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLNLLTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF L+N+YFP +FDIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DTQADFFTLMNVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFS SLE+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKENFFSCSLEKYAGVLYGLGVENGQN  272



>ref|XP_007215794.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
 gb|EMJ16993.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
Length=274

 Score =   490 bits (1261),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 255/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M LLPK DSIQIREVW+ N EEEF LIR++VDDYP++AMDTEFPGIVLRPVGNFKNS DY
Sbjct  1    MKLLPKPDSIQIREVWNDNFEEEFALIRKIVDDYPYVAMDTEFPGIVLRPVGNFKNSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDK+CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAKRFGELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  ETQAEFFNLINIYFPTIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK++FFSGSLE+Y+GVLYGLGVEN  N
Sbjct  241  CTFRKLKESFFSGSLEKYAGVLYGLGVENVLN  272



>ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26025.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   490 bits (1261),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 233/272 (86%), Positives = 258/272 (95%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFK   DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKYICDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF+LIN+YFP ++DIKHLM+FCNSL+GGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQVGFFSLINIYFPTLYDIKHLMKFCNSLYGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTF KLK+NFFSGSLE+YSGVLYGLGVENGQ+
Sbjct  241  CTFMKLKENFFSGSLEKYSGVLYGLGVENGQS  272



>ref|XP_010275748.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   488 bits (1256),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKSDSI IREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK S DY
Sbjct  1    MSILPKSDSIHIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKTSSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK NVD+LKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREF+ +EDVFA+DSIEL
Sbjct  61   HYQTLKANVDLLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+RFGELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAQRFGELLMSSGIVLNDSVLWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT+
Sbjct  181  DTQAGFFTLIKMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+ FF+G  E+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKEAFFNGQTEKYAGVLYGLGVENGQN  272



>ref|XP_008228784.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228785.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228786.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
Length=274

 Score =   486 bits (1252),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 254/272 (93%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M LLPK DSIQIREVW+ N EEEF LIR+++DDYP++AMDTEFPGIVLRPVGNFKN+ DY
Sbjct  1    MKLLPKPDSIQIREVWNDNFEEEFALIRKIIDDYPYVAMDTEFPGIVLRPVGNFKNNYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDK+CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+R GELLMSSGIVLNDSVHWVTFHSGYDFGYL+K+LTC  LP
Sbjct  121  LRQSGIDFKKNNEKGIDAKRLGELLMSSGIVLNDSVHWVTFHSGYDFGYLIKLLTCHNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  ETQAEFFNLINIYFPTIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK++FFSGSLE+Y+GVLYGLGVENG N
Sbjct  241  CTFRKLKESFFSGSLEKYAGVLYGLGVENGLN  272



>gb|EYU24608.1| hypothetical protein MIMGU_mgv1a011718mg [Erythranthe guttata]
Length=272

 Score =   486 bits (1250),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 229/270 (85%), Positives = 253/270 (94%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIR+VW  NLEEEF+LIRE+VD YP+IAMDTEFPG+VLRPVG FKNS DY
Sbjct  1    MSLLPKSDSIQIRDVWADNLEEEFELIREIVDAYPYIAMDTEFPGVVLRPVGTFKNSSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN ++GI+ARRFGELLMSSGIVLND+V WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFAKNKDNGIDARRFGELLMSSGIVLNDNVVWVTFHSGYDFGYLLKVLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF LIN+YFP ++DIKHLM+F NSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+
Sbjct  181  DTQTAFFNLINLYFPVLYDIKHLMKFSNSLHGGLNKLAELLDVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTFRKLK+NFFSGS++ YSGVLYGLGVENG
Sbjct  241  CTFRKLKENFFSGSMDRYSGVLYGLGVENG  270



>emb|CDO98220.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   486 bits (1250),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 229/273 (84%), Positives = 255/273 (93%), Gaps = 1/273 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKS+S+QIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRPVGNFK++ D+
Sbjct  1    MSLLPKSESVQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPVGNFKSNTDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLP CG D KYC WQFNFREF+PNEDVFA+DSIE
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPKCGVDNKYCTWQFNFREFNPNEDVFANDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ G DF KN E GI+A+ FGELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLRQSGFDFAKNNEKGIDAKHFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ  FF LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT
Sbjct  181  PDTQAEFFTLINIYFPVIYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            ACTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQN
Sbjct  241  ACTFRKLKENFFSGSLEKYTGVLYGLGVENGQN  273



>ref|XP_004305482.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   484 bits (1246),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 227/272 (83%), Positives = 257/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M LLPK+DSIQIREVW+ NL+EEF+LIR++VDDYP++AMDTEFPGIV RPVGNF+NS DY
Sbjct  1    MPLLPKNDSIQIREVWNDNLDEEFELIRKIVDDYPYVAMDTEFPGIVCRPVGNFRNSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTL+DNVD+LKLIQLGLTFSDE+GNLPTCGTD+ CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   HYQTLRDNVDVLKLIQLGLTFSDEEGNLPTCGTDQQCIWQFNFREFNLNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+ FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAKLFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKVLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQVGFFNLINIYFPTIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENG +
Sbjct  241  CTFRKLKENFFSGSLEKYAGVLYGLGVENGHS  272



>ref|XP_009354185.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=274

 Score =   483 bits (1244),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 256/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M LLPK DSI IREVW+ NLEEEF LIR++VDDYP++AMDTEFPGIV+RPVGNFKNS DY
Sbjct  1    MPLLPKIDSIHIREVWNDNLEEEFALIRKIVDDYPYVAMDTEFPGIVIRPVGNFKNSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GN P+CGTDK CIWQFNFREF+ N+DVF+SDSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFNLNKDVFSSDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ  P
Sbjct  121  LRQSGIDFKKNNEKGIDAKRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNSP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN+YFP+++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  QTQAGFFNLINIYFPKIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK++FFSGS+E+Y+GVLYGLGV+NGQ+
Sbjct  241  CTFRKLKESFFSGSMEKYAGVLYGLGVDNGQD  272



>ref|XP_008375521.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008375525.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   483 bits (1243),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 255/272 (94%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M LLPK DSI IREVW+ NLEEEF LIR++VDDYP++AMDTEFPGIV+RPVGNFKN  DY
Sbjct  1    MPLLPKIDSIHIREVWNDNLEEEFALIRKIVDDYPYVAMDTEFPGIVIRPVGNFKNGYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GN P+CGTDK CIWQFNFREF+ NEDVF+SDSIEL
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFNLNEDVFSSDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ  P
Sbjct  121  LRQSGIDFKKNNEKGIDAKRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNSP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN+YFP+++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  QTQAGFFNLINIYFPKIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK++FFSGS+E+Y+GVLYGLGV+NGQ+
Sbjct  241  CTFRKLKESFFSGSMEKYAGVLYGLGVDNGQD  272



>ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Glycine max]
 ref|XP_003530298.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Glycine max]
 gb|KHN04172.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=277

 Score =   483 bits (1243),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 233/271 (86%), Positives = 254/271 (94%), Gaps = 2/271 (1%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +L KSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFDPNEDVFASDSIEL  632
            QTLKDNVDMLKLIQLGLTFSDE GNLPTCG  +   CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIEL  123

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF++N E+GI+A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  124  LRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQDLP  183

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  184  DTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  243

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  244  CTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  274



>ref|XP_010265638.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
 ref|XP_010265639.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   483 bits (1242),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 228/272 (84%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+L K DSI IREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK S DY
Sbjct  1    MSILSKGDSIHIREVWNDNLEEEFVLIREIVDDYPYIAMDTEFPGIVLRPVGNFKTSSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREF+ +EDVFA+DSIEL
Sbjct  61   HYQTLKANVDMLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR+ GIDF+KN E GI+A RFGELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRESGIDFKKNNEKGIDAHRFGELLMSSGIVLNDSVLWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT+
Sbjct  181  DTQAGFFNLIKMYFPNVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLKD FF+G  E+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLKDAFFNGQTEKYAGVLYGLGVENGQN  272



>ref|XP_012076450.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Jatropha 
curcas]
 gb|KDP33530.1| hypothetical protein JCGZ_07101 [Jatropha curcas]
Length=275

 Score =   482 bits (1240),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 227/273 (83%), Positives = 256/273 (94%), Gaps = 1/273 (0%)
 Frame = -1

Query  991  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            MS++PK+D SIQIREVW+ NLEEEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN +D
Sbjct  1    MSIIPKNDDSIQIREVWNDNLEEEFALIREIVDQFNYVAMDTEFPGVVLRPVGNFKNIND  60

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIE
Sbjct  61   YNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQCGIDF+KN E GI+  RFGELLMSSG+VLNDSV+WVTFHSGYDFGYLLK+LTC+ L
Sbjct  121  LLRQCGIDFKKNNEKGIDVNRFGELLMSSGVVLNDSVYWVTFHSGYDFGYLLKLLTCRSL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT
Sbjct  181  PDTQAGFFDLINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            +CTFRKL+DNFF+GS E+Y+GVLYGLGVENGQN
Sbjct  241  SCTFRKLRDNFFNGSAEKYAGVLYGLGVENGQN  273



>ref|XP_002515442.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF46891.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   481 bits (1239),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 224/272 (82%), Positives = 252/272 (93%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS++PK DSI IREVW+ NLEEEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSIIPKGDSIHIREVWNDNLEEEFTLIREIVDQFNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVNRFGELMMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DTQAGFFDLINTYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+DNFF+GS E+Y+GVLYGLGVENGQN
Sbjct  241  CTFRKLRDNFFNGSTEKYAGVLYGLGVENGQN  272



>ref|XP_003526204.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   481 bits (1239),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/271 (83%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN+E GI+  RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNSEKGIDVNRFGELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  ETQAGFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FFSGS E+Y+GVLYGLGVE+GQ
Sbjct  241  CTFRKLRDAFFSGSTEKYAGVLYGLGVESGQ  271



>ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=277

 Score =   481 bits (1239),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 231/272 (85%), Positives = 254/272 (93%), Gaps = 2/272 (1%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +LPKSD IQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFK+S DYHY
Sbjct  4    ILPKSDLIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKSSYDYHY  63

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSIEL  632
            QTLKDNVDMLKLIQLGLTFSDE GNLP  G D  ++CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPKIGDDDDRFCIWQFNFREFNVNEDVFANDSIEL  123

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+ARRFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  124  LRQSGIDFKKNNEEGIDARRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLP  183

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  184  DTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  243

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGS+E+Y+GVLYGLGVENGQ+
Sbjct  244  CTFRKLKENFFSGSMEKYAGVLYGLGVENGQS  275



>gb|ACU24625.1| unknown [Glycine max]
Length=277

 Score =   481 bits (1238),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 232/271 (86%), Positives = 253/271 (93%), Gaps = 2/271 (1%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +L KSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--TDKYCIWQFNFREFDPNEDVFASDSIEL  632
            QTLKDNVDMLKLIQLGLTFSDE GNLPTCG  +   CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIEL  123

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF++N E+GI+A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  124  LRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQDLP  183

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDS LT+
Sbjct  184  DTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSFLTS  243

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  244  CTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  274



>gb|KJB07590.1| hypothetical protein B456_001G031500 [Gossypium raimondii]
Length=274

 Score =   479 bits (1234),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 250/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKS+SI IREVWD NL  EF+LIRE+VDDYPFIAMDTEFPGIVLRP+GNFK+S DY
Sbjct  1    MSILPKSESIHIREVWDENLNCEFELIREIVDDYPFIAMDTEFPGIVLRPIGNFKSSFDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLTFSD KGNLPTCGTDKYC+WQFNFREFDPNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E GI A  F ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LSQSGIDFQKNKEKGISAHDFSELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF+LI +YFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT 
Sbjct  181  ETQTGFFSLIKIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTF KLK+NFFSGS E+Y+GVLYGLGVENGQN
Sbjct  241  CTFMKLKENFFSGSAEKYAGVLYGLGVENGQN  272



>ref|XP_011082251.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=276

 Score =   478 bits (1231),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 227/272 (83%), Positives = 253/272 (93%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSIQIREVW  NL+EEF LI+E+VDDYP+IAMDTEFPG+VLRPVGNFKNS DY
Sbjct  1    MSLLAKGDSIQIREVWADNLDEEFALIKEIVDDYPYIAMDTEFPGVVLRPVGNFKNSSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLTFSDEKGNLPTCGT+K CIWQFNF EF+PNEDVFA+DS+EL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTFSDEKGNLPTCGTNKQCIWQFNFCEFNPNEDVFANDSVEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN E GI+A+RFGELLMSSGIVLN+ ++WVTFHSGYDFGYLLK+LT Q LP
Sbjct  121  LRQSGIDFVKNNEKGIDAKRFGELLMSSGIVLNNDMYWVTFHSGYDFGYLLKLLTRQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN++FP ++DIKHLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DTQAGFFTLINIFFPVLYDIKHLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFF+GSLE+YSGVLYGLGVENGQN
Sbjct  241  CTFRKLKENFFNGSLEKYSGVLYGLGVENGQN  272



>ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 ref|XP_006427596.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40835.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40836.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
Length=274

 Score =   478 bits (1230),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 250/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIEL
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GI+F KN E GI+A RFGEL+MSSGIVL+DS+HWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGINFTKNNEIGIDAMRFGELMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQVEFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             TFRKLK+NFFS SLE+Y+GVLYGLGVENGQN
Sbjct  241  STFRKLKENFFSSSLEKYAGVLYGLGVENGQN  272



>ref|XP_010092187.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=277

 Score =   478 bits (1229),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/273 (83%), Positives = 252/273 (92%), Gaps = 1/273 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M  LPK+DSI IREVW+ NL+EEF LIR++VD YP++AMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MPELPKTDSIHIREVWNDNLDEEFALIRDIVDQYPYVAMDTEFPGIVLRPVGNFKNSYDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIE  635
            HYQTLKDNVDMLKLIQLGLTFSDE GNLP CG + +YCIWQFNFREF+ NEDVFA+DSIE
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEHGNLPACGASGEYCIWQFNFREFNVNEDVFANDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GID +KN E GI+A+RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ+L
Sbjct  121  LLRQSGIDLKKNNEEGIDAKRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQDL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PDTQAGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            +C FRKLK+NFFSGSLE+Y+GVLYGLGVENG N
Sbjct  241  SCAFRKLKENFFSGSLEKYAGVLYGLGVENGLN  273



>ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
 gb|ESW07804.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
Length=283

 Score =   478 bits (1230),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/277 (84%), Positives = 251/277 (91%), Gaps = 8/277 (3%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +LPKSDSIQIREVW+ NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCG--------TDKYCIWQFNFREFDPNEDVFA  650
            QTLKDNVDMLKLIQLGLTFSDE GNLPTC         +   CIWQFNFREF+ NEDVFA
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEYGNLPTCAGAGDVDEESHSCCIWQFNFREFNVNEDVFA  123

Query  649  SDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKIL  470
            +DSIELLRQ GIDF+KN E GI+A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+L
Sbjct  124  NDSIELLRQSGIDFKKNNEDGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLL  183

Query  469  TCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGS  290
            TCQ LP+TQ  FF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGS
Sbjct  184  TCQNLPDTQVEFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGS  243

Query  289  DSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            DSLLT+CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  244  DSLLTSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  280



>ref|XP_010089956.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB38652.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=276

 Score =   478 bits (1229),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/273 (83%), Positives = 251/273 (92%), Gaps = 2/273 (1%)
 Frame = -1

Query  991  MSLLPKSD--SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD  818
            MS+L K D  SIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFKN +
Sbjct  1    MSILTKGDGDSIQIREVWNDNLEEEFALIREIVDKYNYVAMDTEFPGVVLRPVGNFKNIN  60

Query  817  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSI  638
            DY+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSI
Sbjct  61   DYNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSI  120

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            ELLRQCGIDF+KN E GI+  RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTCQ 
Sbjct  121  ELLRQCGIDFKKNNEKGIDVNRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCQS  180

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LP+TQ GFF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL
Sbjct  181  LPDTQAGFFDLINVYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  240

Query  277  TACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            T+CTFRKL+D FF+GS E+Y+GVLYGLGVENGQ
Sbjct  241  TSCTFRKLRDTFFNGSTEKYAGVLYGLGVENGQ  273



>ref|XP_003522433.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   478 bits (1229),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 224/271 (83%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN+E+GI+  RFGELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNSENGIDVNRFGELLMSSGIVLNDSVRWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DTQAGFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FFSGS E+Y+GVLYGLGVE+GQ
Sbjct  241  CTFRKLRDTFFSGSTEKYAGVLYGLGVESGQ  271



>ref|XP_011073341.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Sesamum 
indicum]
Length=270

 Score =   477 bits (1227),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 223/270 (83%), Positives = 252/270 (93%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDS+QIREVW  NL+EEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKN++DY
Sbjct  1    MSLLPKSDSVQIREVWAGNLDEEFALIREIVDEYPYIAMDTEFPGIVLRPVGNFKNANDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK+NV++LKLIQLGLTFSDEKGNLPTCGTDK+CIWQFNFREF+P+EDVFA+DSIEL
Sbjct  61   HYQTLKENVNLLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFNPDEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GID  +N E+GI+ARRF ELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LSQSGIDLVRNNENGIDARRFAELLMSSGIVLNDNVNWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            + Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT 
Sbjct  181  DAQAAFFTLINVYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTF KLK NFFSGS+++Y+GVLYGLGVE+G
Sbjct  241  CTFMKLKGNFFSGSMDKYAGVLYGLGVESG  270



>gb|EPS71126.1| hypothetical protein M569_03633, partial [Genlisea aurea]
Length=268

 Score =   476 bits (1226),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK+DSIQIREVW  NLE+EFDLIR +VD+YP+IAMDTEFPG+VLRP+GNFKNS DY
Sbjct  1    MSLLPKTDSIQIREVWADNLEQEFDLIRGIVDEYPYIAMDTEFPGVVLRPIGNFKNSSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVD+LKLIQLGLT SDEKGNLP+ GTDK CIWQFNFREF+PNEDVFA+DSIEL
Sbjct  61   HYQTLKDNVDLLKLIQLGLTLSDEKGNLPSFGTDKRCIWQFNFREFNPNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF  N + GI+  RFGELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFVMNNDKGIDVGRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQRLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF+LINM+FP ++DIKHLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  ETQAGFFSLINMFFPVLYDIKHLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            CTFRKLK+NFFSGSLE+YSGVLYGLGVE
Sbjct  241  CTFRKLKENFFSGSLEKYSGVLYGLGVE  268



>ref|XP_007136961.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 ref|XP_007136962.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08955.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08956.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
Length=273

 Score =   476 bits (1226),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 222/271 (82%), Positives = 252/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS++PK DS+QIREVW+ NL+EEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSIIPKGDSVQIREVWNDNLDEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG++  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGSESPCIWQFNFREFNISEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN+E GI+  RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNSEKGIDVNRFGELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DTQTGFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FF+GS E+YSGVLYGLGVENGQ
Sbjct  241  CTFRKLRDTFFNGSTEKYSGVLYGLGVENGQ  271



>ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
Length=274

 Score =   476 bits (1226),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 224/272 (82%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIEL
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GI+F KN E GI+A RFGE +MSSGIVL+DS+HWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGINFTKNNEIGIDAMRFGEFMMSSGIVLSDSIHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQVEFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             TFRKLK+NFFS SLE+Y+GVLYGLGVENGQN
Sbjct  241  STFRKLKENFFSSSLEKYAGVLYGLGVENGQN  272



>ref|XP_006857184.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Amborella 
trichopoda]
 gb|ERN18651.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
Length=274

 Score =   476 bits (1224),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 223/272 (82%), Positives = 253/272 (93%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK+++I IREVW  NLE+EF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS D+
Sbjct  1    MSILPKNETILIREVWGDNLEDEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSSDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NVDMLKLIQLGLTFSDE GNLPTCGTDK+ IWQFNFREF+  EDV+A+DSIEL
Sbjct  61   HYKTLKANVDMLKLIQLGLTFSDEDGNLPTCGTDKFYIWQFNFREFNVLEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A+RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAQRFGELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+
Sbjct  181  ETQAGFFGLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK++FF+GS E+Y+GVLYGLGVENG +
Sbjct  241  CTFRKLKESFFNGSTEKYAGVLYGLGVENGNS  272



>gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sinensis]
Length=274

 Score =   476 bits (1224),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 224/272 (82%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSIQIREVW  NLE EFDLIR++VDDYP++AMDTEFPGI LRPVG+FK+S +Y
Sbjct  1    MSLLPKGDSIQIREVWSDNLELEFDLIRKIVDDYPYVAMDTEFPGIALRPVGSFKSSYEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK NVDMLKLIQLGLTFSDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIEL
Sbjct  61   HYQTLKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GI+F KN E GI+A RFGE +MSSGIVL+DS+HWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGINFTKNNEIGIDAMRFGEFMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  181  DTQVEFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             TFRKLK+NFFS SLE+Y+GVLYGLGVENGQN
Sbjct  241  STFRKLKENFFSSSLEKYAGVLYGLGVENGQN  272



>ref|XP_003531734.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Glycine max]
 ref|XP_006585611.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Glycine max]
Length=281

 Score =   475 bits (1222),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 230/275 (84%), Positives = 252/275 (92%), Gaps = 6/275 (2%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDK------YCIWQFNFREFDPNEDVFASD  644
            QTLKDNVDMLKLIQLGLTFSDE GNLP CG D        CIWQFNFREF+ NEDVFA+D
Sbjct  64   QTLKDNVDMLKLIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFAND  123

Query  643  SIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTC  464
            SIELLRQ GIDF++N E+GI+A RFGELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTC
Sbjct  124  SIELLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTC  183

Query  463  QELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDS  284
            Q+LP+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDS
Sbjct  184  QDLPDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDS  243

Query  283  LLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            LLT+CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  244  LLTSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  278



>gb|KHN07034.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=274

 Score =   474 bits (1221),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 225/272 (83%), Positives = 251/272 (92%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHS-GYDFGYLLKILTCQEL  455
            LRQCGIDF+KN+E GI+  RFGELLMSSGIVLNDSV WVTFHS GYDFGYLLK+LTC+ L
Sbjct  121  LRQCGIDFKKNSEKGIDVNRFGELLMSSGIVLNDSVRWVTFHSGGYDFGYLLKLLTCRSL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT
Sbjct  181  PETQAGFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL+D FFSGS E+Y+GVLYGLGVE+GQ
Sbjct  241  SCTFRKLRDAFFSGSTEKYAGVLYGLGVESGQ  272



>ref|XP_002324905.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
 gb|EEF03470.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
Length=277

 Score =   474 bits (1219),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            PK DSIQIREVW+ NLEEEF LIRE+VD +  +AMDTEFPG+VLRPVGNFKN  DY+YQT
Sbjct  8    PKEDSIQIREVWNDNLEEEFALIREIVDQFNHVAMDTEFPGVVLRPVGNFKNISDYNYQT  67

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQC  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF+KN+E GI+  RFGELLMSSGIVLND V+WVTFHSGYDFGYLLK+LTC+ LP++Q 
Sbjct  128  GIDFKKNSEMGIDVNRFGELLMSSGIVLNDGVNWVTFHSGYDFGYLLKLLTCRSLPDSQA  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+ TF+
Sbjct  188  GFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSSTFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLKDNFFSGS E+Y+GVLYGLGVENGQN
Sbjct  248  KLKDNFFSGSTEKYAGVLYGLGVENGQN  275



>gb|KHG00404.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=274

 Score =   473 bits (1218),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 222/272 (82%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKS+SI IREVWD NL  EF+LIR++VDDYPFIAMDTEFPGIVLRP+GNFK+S DY
Sbjct  1    MSILPKSESIHIREVWDENLNCEFELIRDIVDDYPFIAMDTEFPGIVLRPIGNFKSSFDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLTFSD KGNLPTCGTDKYC+WQFNFREFDPNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E GI +  F ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LSQSGIDFQKNKEKGISSHDFSELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF+LI +YFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT 
Sbjct  181  ETQTGFFSLIKIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTF KLK+NFFSG  E+Y+GVLYGLGVENGQN
Sbjct  241  CTFMKLKENFFSGLAEKYAGVLYGLGVENGQN  272



>ref|XP_011036659.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   473 bits (1216),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 222/268 (83%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            PK DSIQIREVW+ NLEEEF LIRE+VD +  +AMDTEFPG+VLRPVGNFKN  DY+YQT
Sbjct  8    PKEDSIQIREVWNDNLEEEFALIREIVDQFNHVAMDTEFPGVVLRPVGNFKNISDYNYQT  67

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQC  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF+KN+E GI+  RFGELLMSSGIVLND V+WVTFHSGYDFGYLLK+LTC+ LP++Q 
Sbjct  128  GIDFKKNSEMGIDVNRFGELLMSSGIVLNDGVNWVTFHSGYDFGYLLKLLTCRSLPDSQA  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+ TF+
Sbjct  188  GFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSSTFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLKDNFFSGS ++Y+GVLYGLGVENGQN
Sbjct  248  KLKDNFFSGSTKKYAGVLYGLGVENGQN  275



>ref|XP_003604226.1| Ribonuclease CAF1 [Medicago truncatula]
Length=277

 Score =   472 bits (1215),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/272 (83%), Positives = 254/272 (93%), Gaps = 2/272 (1%)
 Frame = -1

Query  985  LLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            +LP++D SIQIREVW  NLEEEF +IRE+VDDYPFIAMDTEFPGIVLRPVGNFK++ DYH
Sbjct  4    ILPQNDDSIQIREVWSDNLEEEFAVIREIVDDYPFIAMDTEFPGIVLRPVGNFKSNYDYH  63

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIEL  632
            YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG D ++CIWQFNFREF+ NEDVFA+DSIEL
Sbjct  64   YQTLKDNVDMLKLIQLGLTFSDEHGNLPTCGEDDRFCIWQFNFREFNVNEDVFANDSIEL  123

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+ARRFGELLMSSGIVLND+VHW+TFHSGYDFGYLLK+LTCQ LP
Sbjct  124  LRQSGIDFKKNNEDGIDARRFGELLMSSGIVLNDNVHWITFHSGYDFGYLLKLLTCQNLP  183

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEV+RVG+CHQAGSDSLLT+
Sbjct  184  DTQVGFFNLINMYFPMLYDIKHLMKFCNSLHGGLNKLAELLEVKRVGICHQAGSDSLLTS  243

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
              FRKLK+NFFSGSLE+Y+GVLYGLGVENGQ+
Sbjct  244  SAFRKLKENFFSGSLEKYAGVLYGLGVENGQS  275



>ref|XP_002309667.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
 gb|EEE93190.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
Length=277

 Score =   472 bits (1215),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 221/268 (82%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            PK +SIQIREVW+ NLEEEF LIRE+VD + F+AMDTEFPG+VLRPVGNFKN +DY+YQT
Sbjct  8    PKEESIQIREVWNDNLEEEFALIREIVDQFNFVAMDTEFPGVVLRPVGNFKNINDYNYQT  67

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTKDIFASDSIELLRQC  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF+ N E GI+  +FGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+T  
Sbjct  128  GIDFKMNNEKGIDVNQFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPA  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+CTFR
Sbjct  188  GFFDLINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFR  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KL+DNFF+GS E+Y+GVLYGLGVENGQN
Sbjct  248  KLRDNFFNGSAEKYAGVLYGLGVENGQN  275



>gb|ACU20942.1| unknown [Glycine max]
Length=281

 Score =   472 bits (1215),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/275 (83%), Positives = 251/275 (91%), Gaps = 6/275 (2%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  63

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDK------YCIWQFNFREFDPNEDVFASD  644
            QTLKDNVDMLK IQLGLTFSDE GNLP CG D        CIWQFNFREF+ NEDVFA+D
Sbjct  64   QTLKDNVDMLKPIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFAND  123

Query  643  SIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTC  464
            SIELLRQ GIDF++N E+GI+A RFGELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTC
Sbjct  124  SIELLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTC  183

Query  463  QELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDS  284
            Q+LP+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDS
Sbjct  184  QDLPDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDS  243

Query  283  LLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            LLT+CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  244  LLTSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  278



>gb|KJB68416.1| hypothetical protein B456_010G244300 [Gossypium raimondii]
Length=274

 Score =   472 bits (1214),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS LPK +S+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSGLPKGESVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGTFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD +CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSG+VLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVTRFGELLMSSGVVLNDDVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LI +YFP V+DIKH+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DSQAGFFDLIKIYFPMVYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+DNFF+GS E+Y+GVLYGLGV+NGQN
Sbjct  241  CTFRKLRDNFFNGSTEKYAGVLYGLGVQNGQN  272



>gb|KJB55043.1| hypothetical protein B456_009G061200 [Gossypium raimondii]
Length=274

 Score =   471 bits (1211),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 220/271 (81%), Positives = 248/271 (92%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DS+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG+FKN  DY
Sbjct  1    MSVLPKGDSVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGSFKNISDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD  CIWQFNF EF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSSCIWQFNFCEFNISEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+ +RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            + Q GFF LINMYFP ++DIKH+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DNQAGFFDLINMYFPMLYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+DNFF+GS E+Y+GVLYGLGVE+GQ
Sbjct  241  CTFRKLRDNFFNGSTEKYAGVLYGLGVESGQ  271



>ref|XP_009801027.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
 ref|XP_009801028.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=274

 Score =   470 bits (1210),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 218/272 (80%), Positives = 251/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKSDSIQIREVW  NLEEEF LIRE+VD YP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSVLPKSDSIQIREVWSNNLEEEFALIREIVDAYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCG+++YCIWQFNFREFD + D+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGSERYCIWQFNFREFDTSADIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E GI+A+RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LMQSGIDFKKNNEMGIDAKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF L+N+YFP V+DIKHLM+FCNSLHGGLNKLAELLE+ER+G+CHQAGSDSLLT+
Sbjct  181  ETQAGFFDLLNVYFPLVYDIKHLMKFCNSLHGGLNKLAELLELERIGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            C F+KLKDNFF+G+ E+Y+GVLYGLGVE G +
Sbjct  241  CAFKKLKDNFFNGATEKYAGVLYGLGVEYGSD  272



>gb|AFK43307.1| unknown [Lotus japonicus]
Length=274

 Score =   470 bits (1209),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 222/267 (83%), Positives = 248/267 (93%), Gaps = 1/267 (0%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            PK++SIQIREVW+ NLE+EF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHYQT
Sbjct  6    PKAESIQIREVWNENLEQEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSHDYHYQT  65

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            LKDNVDMLKLIQLGLTFSDE+GNLP+C     CIWQFNFREF+ NEDVFA+DSIELLRQ 
Sbjct  66   LKDNVDMLKLIQLGLTFSDEEGNLPSCDGSS-CIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF KN E GI+ARRFGELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTCQ+LP+TQ 
Sbjct  125  GIDFSKNNEMGIDARRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQDLPDTQV  184

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF +INMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDSLLT+CTFR
Sbjct  185  GFFNMINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLLTSCTFR  244

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            KLK+NFFSGSLE+Y+G+LYGLG ENG 
Sbjct  245  KLKENFFSGSLEKYAGILYGLGCENGH  271



>ref|XP_010048831.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW81224.1| hypothetical protein EUGRSUZ_C02596 [Eucalyptus grandis]
Length=274

 Score =   468 bits (1205),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 218/272 (80%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+L KSDS++IREVW+YNLE+EF  IRE+VDDYP+IAMDTEFPG+VLRPVGNFK+S +Y
Sbjct  1    MSVLSKSDSVEIREVWEYNLEDEFSFIREIVDDYPYIAMDTEFPGMVLRPVGNFKSSSEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLTF+DEKGNLPTCGTDKY +WQFNFREF+ NEDV+A DSI+L
Sbjct  61   NYQTLKANVDLLKLIQLGLTFADEKGNLPTCGTDKYYVWQFNFREFNLNEDVYAHDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GI+F+KN E G++ARRF ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LSQSGINFKKNNEVGVDARRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKVLTCQSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             TQ GFF LI MYFP ++DIKHLM+FCNSLHGGLNK+AELLEVERVG+CHQAGSDSLLT 
Sbjct  181  STQSGFFDLIKMYFPVLYDIKHLMKFCNSLHGGLNKVAELLEVERVGICHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             TF KLK+NFF+GS E+Y+GVLYGLGVENGQN
Sbjct  241  STFMKLKENFFNGSPEKYAGVLYGLGVENGQN  272



>ref|XP_007011965.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
 gb|EOY29584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
Length=274

 Score =   468 bits (1204),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 215/272 (79%), Positives = 250/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKS+SI IREVW+ NL  E +LI+  VD+YP+IAMDTEFPGIVLRP+GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWEENLGSEIELIKNTVDEYPYIAMDTEFPGIVLRPIGNFKSSFEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLTFSD+KGNLPTCGTDK+C+WQFNFREFDPNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTFSDDKGNLPTCGTDKFCVWQFNFREFDPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E G+ A RF ELLMSSG+VLNDSVHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LSQSGIDFKKNKEKGVSAHRFSELLMSSGVVLNDSVHWVTFHSGYDFGYLLKLLTCKNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF+LI++YFP ++DIKHLM+FCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+
Sbjct  181  ETQAEFFSLIDIYFPTLYDIKHLMKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTF KLK+NFFSGS E+Y+GVLYGLGVENGQN
Sbjct  241  CTFMKLKENFFSGSTEKYAGVLYGLGVENGQN  272



>gb|KHG16599.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=270

 Score =   467 bits (1202),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 216/270 (80%), Positives = 248/270 (92%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS LPK +S+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSGLPKGESVHIREVWNDNLEEEFALIREIVDSYNYVAMDTEFPGVVLRPVGTFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTD +CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+ +RFGELLMSSG+VLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVKRFGELLMSSGVVLNDDVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LI +YFP V+DIKH+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DSQAGFFDLIKIYFPMVYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTFRKL+DNFF+GS ++Y+GVLYGLGV+NG
Sbjct  241  CTFRKLRDNFFNGSTKKYAGVLYGLGVQNG  270



>ref|XP_009620266.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=274

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 217/272 (80%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS LPKSDSIQIREVW  NLEEEF LIRE+VD YP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSALPKSDSIQIREVWSDNLEEEFALIREIVDAYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLP CG+++YCIWQFNFREFD + D+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPICGSERYCIWQFNFREFDTSADIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E GI+A+RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LMQSGIDFKKNNEMGIDAKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF L+N+YFP V+DIKHLM+FCNSLHGGLNKLAELLE+ER+G+CHQAGSDSLLT+
Sbjct  181  ETQAGFFDLLNVYFPLVYDIKHLMKFCNSLHGGLNKLAELLELERIGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            C F+KLKDNFF+G+ E+Y+GVLYGLGVE G +
Sbjct  241  CAFKKLKDNFFNGATEKYAGVLYGLGVEYGSD  272



>ref|XP_010665982.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Beta 
vulgaris subsp. vulgaris]
Length=272

 Score =   466 bits (1200),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 216/270 (80%), Positives = 248/270 (92%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            + L    DSI IREVW++NLEEEF  IRE+VDDYP++AMD+EFPG+V+RPVGNFKN  DY
Sbjct  3    LGLTKSDDSIHIREVWNHNLEEEFGYIREIVDDYPYVAMDSEFPGVVIRPVGNFKNITDY  62

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVDMLKLIQLGLTFSDEKGNLPTCGTDK+CIWQFNFREFD  EDV+ASDSIEL
Sbjct  63   NYKTLKENVDMLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFDVGEDVYASDSIEL  122

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+QCGIDFEKN+E GI++ RF ELLMSSGIVLNDS+ WVTFHSGYDFGYLLK+LTC++LP
Sbjct  123  LKQCGIDFEKNSEMGIDSNRFAELLMSSGIVLNDSIKWVTFHSGYDFGYLLKLLTCRDLP  182

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT 
Sbjct  183  ETQSGFFNLINIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTC  242

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTF KLK+NFF+GS E+Y+GVLYGLGVE+G
Sbjct  243  CTFMKLKENFFNGSTEKYAGVLYGLGVEDG  272



>ref|XP_010532089.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010532090.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
Length=274

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 219/271 (81%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEEF LIR +V+D+P++AMDTEFPGIV RPVG FK S+DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRRIVEDFPYVAMDTEFPGIVCRPVGTFKTSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD N D+FA DSI+L
Sbjct  61   NYETLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN ++GI++RR+ ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFAKNNDNGIDSRRYAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E   GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  EKASGFFELIKIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTF KLK+NFFSGS+E+YSGVLYGLGVENGQ
Sbjct  241  CTFWKLKENFFSGSMEKYSGVLYGLGVENGQ  271



>ref|XP_011039582.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 218/268 (81%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            PK +SIQIREVW+ NL+EEF LIRE+VD + ++AMDTEFPG+VLRPVGNFKN +DY+YQT
Sbjct  8    PKEESIQIREVWNDNLQEEFALIREIVDQFNYVAMDTEFPGVVLRPVGNFKNINDYNYQT  67

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            LKDNVDMLKLIQLGLTFSDE GNLPTCGTDK CIWQFNFREF+  +D+FASDSIELLRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKSCIWQFNFREFNVTKDIFASDSIELLRQC  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF+ N E GI+  +FGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+T  
Sbjct  128  GIDFKMNNEKGIDVNQFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPA  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+CTFR
Sbjct  188  GFFDLINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFR  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KL+DNFF+GS  +Y+GVLYGLGVENGQN
Sbjct  248  KLRDNFFNGSAVKYAGVLYGLGVENGQN  275



>gb|KHF99352.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
 gb|KHG05538.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=327

 Score =   468 bits (1203),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 218/272 (80%), Positives = 248/272 (91%), Gaps = 0/272 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            +MS+LPK DS+ IREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG+FKN  D
Sbjct  53   EMSILPKGDSVHIREVWNDNLEEEFALIREIVDTYNYVAMDTEFPGVVLRPVGSFKNISD  112

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLP+CGTD  CIWQFNF EF+ +ED+FASDSIE
Sbjct  113  YNYQTLKDNVDMLKLIQLGLTFSDENGNLPSCGTDSSCIWQFNFCEFNISEDIFASDSIE  172

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQCGIDF+KN E GI+ +RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ L
Sbjct  173  LLRQCGIDFKKNNEKGIDVKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSL  232

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+ Q  FF LINMYFP ++DIKH+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT
Sbjct  233  PDNQARFFDLINMYFPMLYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  292

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL+DNFF+GS E+Y+GVLYGLGVE+GQ
Sbjct  293  SCTFRKLRDNFFNGSTEKYAGVLYGLGVESGQ  324



>ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=282

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/272 (81%), Positives = 249/272 (92%), Gaps = 2/272 (1%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +LPKSDSIQIREVW  NLEEEF LIRE+VDDYP+IAMDTEFPGIVLRPVGNFKNS DYHY
Sbjct  10   ILPKSDSIQIREVWSDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFKNSYDYHY  69

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            QTLKDNVDMLKLIQLG T SDE GNLP      D++C+WQFNFREF+ +EDVFA+DSIEL
Sbjct  70   QTLKDNVDMLKLIQLGFTLSDEDGNLPNFDDADDRFCVWQFNFREFNVSEDVFANDSIEL  129

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN + GI+A+ FG++LMSSGIVLND+VHW+TFHSGYDFGYLLK+LTCQ LP
Sbjct  130  LRQSGIDFKKNNDKGIDAQCFGDILMSSGIVLNDNVHWLTFHSGYDFGYLLKLLTCQNLP  189

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT 
Sbjct  190  DTQVGFFNLINMYFPNVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTL  249

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGS+E+Y+GVLYGLG+ENGQ+
Sbjct  250  CTFRKLKENFFSGSMEKYAGVLYGLGIENGQS  281



>ref|XP_008445259.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
melo]
Length=274

 Score =   464 bits (1195),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 216/271 (80%), Positives = 247/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSIQIREVW+ NLEEEF LIR +VD + +IAMDTEFPG+VLRP+G FKN +D+
Sbjct  1    MSILPKGDSIQIREVWNANLEEEFALIRAIVDKFNYIAMDTEFPGVVLRPLGTFKNINDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIEL
Sbjct  61   NYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSG+VLND V+WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFQKNNEEGIDVNRFGELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q GFF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLTA
Sbjct  181  NDQAGFFELINVYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FF+GS+++Y+GVLYGLGVENGQ
Sbjct  241  CTFRKLRDTFFNGSIQKYAGVLYGLGVENGQ  271



>ref|XP_010942117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   464 bits (1194),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 215/271 (79%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPKS+++QIREVW+ NL+ EF LIRE+VDD+PF+AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKSETVQIREVWNDNLDAEFSLIREIVDDFPFVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT + C+WQFNFREFD   D+FASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFDAQRDIFASDSIELL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+L+CQ LP+
Sbjct  123  RQSGIDFKKNNERGIDASRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLSCQNLPD  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LI ++FP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQAGFFNLIKIFFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            TFRKLK++FF+GS E Y+GVLYGLGVENGQN
Sbjct  243  TFRKLKESFFNGSTERYAGVLYGLGVENGQN  273



>ref|XP_009417447.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 215/270 (80%), Positives = 246/270 (91%), Gaps = 0/270 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPK++++QIREVW  NLE+EF LIRE+VDD+PF+AMDTEFPGIV RP+GNF+ S D++
Sbjct  3    SILPKNETVQIREVWSNNLEQEFALIREIVDDFPFVAMDTEFPGIVCRPLGNFRTSSDFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLT SDE G+LPTCGTD+ C+WQFNFREFD   DVFASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTLSDEHGSLPTCGTDRGCVWQFNFREFDIQRDVFASDSIELL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN E GI+A+RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LPE
Sbjct  123  RQSGIDFKKNNEKGIDAQRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPE  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQAGFFNLIKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
             FRKLK++FF+GS E+Y+GVLYGLGVENGQ
Sbjct  243  AFRKLKESFFNGSTEKYAGVLYGLGVENGQ  272



>ref|XP_006294779.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
 gb|EOA27677.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
Length=275

 Score =   464 bits (1193),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/272 (80%), Positives = 247/272 (91%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIFATDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF KN + GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLRQSGIDFAKNNQMGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF +IN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PETQTGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF GS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 217/272 (80%), Positives = 249/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK+DSIQIREVW  NLEEEF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSVLPKTDSIQIREVWSDNLEEEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDML LIQLGLTFSDE GNLPTCG++ Y IWQFNFREFD + D+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLNLIQLGLTFSDENGNLPTCGSEYYYIWQFNFREFDTSADIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E GI+A++FGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LIQSGIDFKKNNEMGIDAKQFGELLMSSGIVLNDMVHWVTFHSGYDFGYLLKLLTCRTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF L+NMYFP V+DIKHLM+FCNSLHGGLNKLAELLE+ERVG+CHQAGSDSLLT+
Sbjct  181  ETQAGFFDLLNMYFPLVYDIKHLMKFCNSLHGGLNKLAELLELERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            C F+KLKDNFF+GS E+Y+GVLYGLGVE G +
Sbjct  241  CAFKKLKDNFFNGSTEKYAGVLYGLGVEYGSD  272



>ref|XP_004138704.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
sativus]
 gb|KGN62988.1| hypothetical protein Csa_2G382610 [Cucumis sativus]
Length=274

 Score =   463 bits (1192),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 215/271 (79%), Positives = 247/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSIQIREVW+ NLEEEF LIR +VD + +IAMDTEFPG+VLRP+G FKN +D+
Sbjct  1    MSILPKGDSIQIREVWNANLEEEFALIRAIVDKFNYIAMDTEFPGVVLRPLGTFKNINDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLKDNV+MLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIEL
Sbjct  61   NYRTLKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSG+VLND V+WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFQKNNEEGIDVNRFGELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q GFF LIN+YFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLTA
Sbjct  181  NDQAGFFELINVYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FF+GS+++Y+GVLYGLGVENGQ
Sbjct  241  CTFRKLRDTFFNGSIQKYAGVLYGLGVENGQ  271



>ref|XP_004291948.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   462 bits (1190),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 215/272 (79%), Positives = 246/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSI+IREVW+ NLEEEF +IR +VD Y ++AMDTEFPG+VLRPVG FKN  DY
Sbjct  1    MSILPKEDSIRIREVWNDNLEEEFHIIRGIVDKYNYVAMDTEFPGVVLRPVGAFKNISDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+ + IWQFNFREF+  ED+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTENFFIWQFNFREFNVTEDIFAADSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN+E GI+  RF ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNSEKGIDVNRFAELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI MYFP V+DIKH+M+FCNSLHGGLNKLAELL+VER+GVCHQAGSDSLLTA
Sbjct  181  DTQAGFFDLIKMYFPLVYDIKHMMKFCNSLHGGLNKLAELLDVERIGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+D+FF+GS E+Y+GVLYGLGVEN  N
Sbjct  241  CTFRKLRDSFFNGSTEKYAGVLYGLGVENSTN  272



>ref|XP_010532085.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=274

 Score =   462 bits (1190),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 217/271 (80%), Positives = 245/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEEF LIR++V+D+P++AMDTEFPGIV +PVG FK S+DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRKIVEDFPYVAMDTEFPGIVCKPVGTFKTSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD   D+FA DSIEL
Sbjct  61   NYKTLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLTSDIFARDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF KN ++GI++RR+ ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LHQSGIDFAKNKDNGIDSRRYAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E   GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  EKASGFFELIKIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTF KLK+NFFSGS+E+YSGVLYGLGVENGQ
Sbjct  241  CTFWKLKENFFSGSMEKYSGVLYGLGVENGQ  271



>ref|XP_010469632.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   462 bits (1190),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 217/272 (80%), Positives = 247/272 (91%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGADNKYCIWQFNFREFDLESDIFATDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF KN + GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+L
Sbjct  121  LLRQSGIDFAKNNQMGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF +IN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PETQTGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF GS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_010532091.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Tarenaya hassleriana]
Length=275

 Score =   461 bits (1187),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 246/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEEF LIR +V+D+P++AMDTEFPGIV RPVG FK S+DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEFALIRRIVEDFPYVAMDTEFPGIVCRPVGTFKTSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFD N D+FA DSI+L
Sbjct  61   NYETLKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHS-GYDFGYLLKILTCQEL  455
            LRQ GIDF KN ++GI++RR+ ELLMSSGIVLN++VHWVTFHS GYDFGYLLK+LTCQ L
Sbjct  121  LRQSGIDFAKNNDNGIDSRRYAELLMSSGIVLNENVHWVTFHSGGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PE   GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PEKASGFFELIKIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTF KLK+NFFSGS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFWKLKENFFSGSMEKYSGVLYGLGVENGQ  272



>ref|XP_010414034.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   461 bits (1187),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/272 (80%), Positives = 246/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGADSKYCIWQFNFREFDLESDIFATDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF KN + GI++ RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+L
Sbjct  121  LLRQSGIDFAKNNQMGIDSERFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF +IN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PETQTGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF GS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_010472873.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=274

 Score =   461 bits (1185),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 248/271 (92%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGTDKYCIWQFNFREFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GID  KNT+ GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFF G L++YSGVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFVGPLQKYSGVLYGLGVENGQ  271



>ref|XP_002881215.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57474.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   461 bits (1185),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 216/272 (79%), Positives = 246/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNENLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF KN + GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLRQSGIDFAKNNQFGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF +I++YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PETQTGFFEMISVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF GS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_009128391.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDY53227.1| BnaA02g19410D [Brassica napus]
Length=274

 Score =   461 bits (1185),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 249/271 (92%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NL EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLLEEMDLIRQVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSI+L
Sbjct  61   HYETLKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF KNT+ GIE+ RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  121  LKQSGIDFAKNTQEGIESNRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DSQTGFFQLINVYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFF+G L++Y+GVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFAGPLQKYAGVLYGLGVENGQ  271



>ref|XP_006483458.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO67487.1| hypothetical protein CISIN_1g023967mg [Citrus sinensis]
Length=274

 Score =   461 bits (1185),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 246/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKS-DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            MS+LPK  D IQIREVW+ NLEEEF LIRE+VD Y +IAMDTEFPG+VLRPVG FKN +D
Sbjct  1    MSVLPKGGDEIQIREVWNDNLEEEFALIREIVDKYNYIAMDTEFPGVVLRPVGAFKNIND  60

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            Y+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDS+E
Sbjct  61   YNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNLIDDIFASDSVE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL QCGIDF+KN E GI+  RFGELLMSSGIVLND V WVTFHSGYDFGYLLK+LTC+ L
Sbjct  121  LLHQCGIDFKKNNEKGIDVNRFGELLMSSGIVLNDVVRWVTFHSGYDFGYLLKLLTCRSL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PDTQAGFFELINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF+G  E+Y+GVLYGLGVEN +
Sbjct  241  SCTFRKLRENFFNGCTEKYAGVLYGLGVENDK  272



>ref|XP_010929136.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   460 bits (1184),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 245/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKNETVQIREVWNDNVDAEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD + D+FASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFASDSIELL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN E GI+  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+
Sbjct  123  RQSGIDFKKNNERGIDTNRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPD  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQAGFFNLIKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            TFRKLK++FF+GS E Y+GVLYGLGVENGQN
Sbjct  243  TFRKLKESFFNGSTERYAGVLYGLGVENGQN  273



>emb|CDY63973.1| BnaC02g46620D [Brassica napus]
Length=274

 Score =   460 bits (1184),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 248/271 (92%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NL EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLHEEMDLIRQVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSI+L
Sbjct  61   HYETLKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF KNT+ GIE+ RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  121  LKQSGIDFAKNTQEGIESNRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DSQTGFFQLINVYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFF+G L++Y+GVLYGLGVEN Q
Sbjct  241  CTFRKLKENFFAGPLQKYAGVLYGLGVENAQ  271



>ref|XP_010510101.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   460 bits (1184),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 218/272 (80%), Positives = 246/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW  NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG+FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWYDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGSFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGPDNKYCIWQFNFREFDLESDIFATDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF KN E GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+L
Sbjct  121  LLRQSGIDFAKNNEMGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF +IN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PETQTGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF GS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_006302671.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
 gb|EOA35569.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
Length=274

 Score =   459 bits (1182),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 247/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNF EFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFGEFDLDSDIFAVDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GID  KNT+ GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFF G L++YSGVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFVGPLQKYSGVLYGLGVENGQ  271



>emb|CDP10211.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   459 bits (1182),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 245/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M++LP  DSI IREVW+ NLE+EF LIRE+VDDYP+IAMDTEFPG+VLRP+G++KN  D+
Sbjct  1    MTVLPSHDSIHIREVWNDNLEDEFALIREIVDDYPYIAMDTEFPGVVLRPLGDYKNFTDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            H++TLK NVD+LKLIQLGLTFSDEKGNLPTCGT KYC+WQFNFREF+PNEDV+A DSIEL
Sbjct  61   HFKTLKANVDLLKLIQLGLTFSDEKGNLPTCGTGKYCVWQFNFREFNPNEDVYAHDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR+ G DF+KN ++G++A RF ELLMSSGIVLNDSV WV FHSGYDFGYLLKILTCQ LP
Sbjct  121  LRRSGFDFKKNVDNGVDAYRFSELLMSSGIVLNDSVSWVAFHSGYDFGYLLKILTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ+GFF LI MYFP V+DIKH+MRFCN LHGGLNKLAELLEVERVG+CHQAGSDSLLT 
Sbjct  181  ETQEGFFKLIKMYFPTVYDIKHMMRFCNHLHGGLNKLAELLEVERVGICHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTF KLK++FF G+ E+Y+GVLYGLGV+NG N
Sbjct  241  CTFMKLKESFFHGTTEKYAGVLYGLGVDNGPN  272



>ref|XP_010648684.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010648686.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=273

 Score =   459 bits (1181),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 214/271 (79%), Positives = 245/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+ PK++S+ IREVW+ NLE EF LIRE+VD YP+IAMDTEFPG+VLRP+G FKN +DY
Sbjct  1    MSISPKTESVLIREVWNENLESEFALIREIVDKYPYIAMDTEFPGVVLRPMGTFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSD  GNLPTCGTDK CIWQFNFREFD  EDVFASDSI++
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQM  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L++CG+DF+KN E GI+  +FGELLMSSGIVLND+V WVTFHSGYDFGYLLK+LT + LP
Sbjct  121  LQECGMDFKKNNEKGIDVNQFGELLMSSGIVLNDNVSWVTFHSGYDFGYLLKLLTRRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  GTQAGFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D+FF+GS E+Y+GVLYGLGVE GQ
Sbjct  241  CTFRKLRDSFFNGSTEKYAGVLYGLGVETGQ  271



>ref|XP_010063560.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063561.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063562.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063564.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 gb|KCW70795.1| hypothetical protein EUGRSUZ_F03953 [Eucalyptus grandis]
Length=281

 Score =   459 bits (1182),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/268 (81%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  KS+SIQIR+VWD NL+EEF  IRE+VDDYP++AMDTEFPGIV+RPVGNFKNS ++
Sbjct  1    MSLSAKSESIQIRDVWDDNLDEEFARIREIVDDYPYVAMDTEFPGIVVRPVGNFKNSSEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK+NVDMLKLIQLGLTFSDE+GNLPTCG+DK CIWQFNFREF+ NED FA DSIEL
Sbjct  61   HYQTLKENVDMLKLIQLGLTFSDERGNLPTCGSDKCCIWQFNFREFNANEDFFADDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF+KN + GI A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDFKKNRDRGINAVRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKVLTCQTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI+MYFP ++DIKHLM+FC+SLHGGLNK+AELL+VERVGVCHQAGSDSLLT+
Sbjct  181  DTQAGFFKLIHMYFPTLYDIKHLMKFCDSLHGGLNKVAELLKVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
             TF+KLK++FFSGSLE+YSGVLYGL VE
Sbjct  241  STFKKLKESFFSGSLEKYSGVLYGLCVE  268



>ref|XP_009390565.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   459 bits (1180),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 210/270 (78%), Positives = 247/270 (91%), Gaps = 0/270 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPK++++QIREVW  NL  EF LIRE+VDD+P++AMDTEFPGIV RP+GNF+ S +++
Sbjct  3    SILPKNETVQIREVWSDNLAAEFALIREIVDDFPYVAMDTEFPGIVCRPLGNFRTSSEFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLTFSD+ GNLPTCGTD+ C+WQFNFREFD  +DVFASDSI+LL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDQLGNLPTCGTDRGCVWQFNFREFDIQQDVFASDSIDLL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN E GI+++RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+
Sbjct  123  RQSGIDFQKNNEKGIDSQRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPD  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LIN+YFP V+DIKH+M+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQAGFFNLINIYFPTVYDIKHIMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
             FRKLK++FF+GS E+Y+GVLYGLGVENGQ
Sbjct  243  AFRKLKESFFNGSTEKYAGVLYGLGVENGQ  272



>ref|XP_009363839.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=273

 Score =   458 bits (1179),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 216/272 (79%), Positives = 246/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DSIQIREVWD NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG FKN +++
Sbjct  1    MSLLPKGDSIQIREVWDDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGAFKNINEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLKDNVDMLKLIQLGLTFSDE GNLPT GT+ + IWQFNFREF+ +ED+FASDSI+L
Sbjct  61   HYKTLKDNVDMLKLIQLGLTFSDENGNLPTLGTENHYIWQFNFREFNVSEDIFASDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGE LMSSG+VL+D+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVNRFGEALMSSGLVLSDNVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E Q  FF LI +YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  ENQMEFFNLIKIYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+D FFSGS E+YSGVLYGLGVENGQ+
Sbjct  241  CTFRKLRDTFFSGSAEKYSGVLYGLGVENGQS  272



>ref|NP_565735.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9SKZ2.2|CAF1G_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 7 [Arabidopsis 
thaliana]
 gb|AAK93623.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAD15397.2| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAN13153.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEC08630.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=275

 Score =   459 bits (1180),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 216/272 (79%), Positives = 246/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWNDNLESEMALIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFSDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF KN E GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLRQSGIDFVKNNEFGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PETQ GFF +I++YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT
Sbjct  181  PETQTGFFEMISVYFPRVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKL++NFF GS+E+YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|NP_178193.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 ref|NP_849915.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 sp|Q9SAI2.1|CAF1F_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 6 [Arabidopsis 
thaliana]
 gb|AAF14666.1|AC011713_14 Similar to gb|U21855 CCR4-associated factor 1 (CAF1) from Mus 
musculus. ESTs gb|AAA394972, gb|AA585812 and gb|H77015 come 
from this gene [Arabidopsis thaliana]
 gb|AAL49916.1| putative CCR4-associated factorCCR4-associated factor [Arabidopsis 
thaliana]
 gb|AAM20381.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEE36448.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
 gb|AEE36449.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=274

 Score =   458 bits (1179),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NL+EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GID  KNT  GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDLAKNTLDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFF G L +YSGVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFVGPLHKYSGVLYGLGVENGQ  271



>ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO59415.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
 gb|KDO59416.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
Length=274

 Score =   458 bits (1179),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 213/271 (79%), Positives = 244/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKS+SI IREVW+ NLE EF LIR++VDDYP+IAMDTEFPGIVLR +GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFKSSSEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQ LK NVD+LKLIQLGLTF+DE GNLP CGTDKYC+WQFNFREF P+EDV+A DSI+L
Sbjct  61   NYQNLKVNVDLLKLIQLGLTFTDENGNLPKCGTDKYCLWQFNFREFSPDEDVYAYDSIKL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L + GIDF+KN E G++A RF ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTC++LP
Sbjct  121  LSRSGIDFKKNKEKGVDAMRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF LI MYFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT 
Sbjct  181  ETQACFFDLIKMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTF K+KDNFF GS E+Y+GVLYGLGVENGQ
Sbjct  241  CTFMKMKDNFFKGSPEKYAGVLYGLGVENGQ  271



>ref|XP_004501372.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501373.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501374.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501375.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X4 [Cicer arietinum]
Length=271

 Score =   457 bits (1177),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 215/268 (80%), Positives = 242/268 (90%), Gaps = 0/268 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+  K DS+QIREVW+ NL+EEF LIRE+VD + FIAMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSVSSKGDSVQIREVWNDNLDEEFALIREIVDQFNFIAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLP CGTD  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPNCGTDSSCIWQFNFREFNVSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN+E GI+  RF ELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNSEKGIDVNRFAELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF +I +YFP V+DIKHLM+FCN+LHGGLNKLAELL+VERVGVCHQAGSDSLLTA
Sbjct  181  DTQTGFFDMIKIYFPVVYDIKHLMKFCNNLHGGLNKLAELLDVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            CTFRKL+D FF+G  E+YSGVLYGLGVE
Sbjct  241  CTFRKLRDAFFNGETEKYSGVLYGLGVE  268



>ref|XP_006450304.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
 gb|ESR63544.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
Length=449

 Score =   464 bits (1194),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 222/280 (79%), Positives = 250/280 (89%), Gaps = 2/280 (1%)
 Frame = -1

Query  1012  KFWVDWKMSLLPKS-DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  836
             KF V  +MS+LPK  D IQIREVW+ NLEEEF LIRE+VD Y +IAMDTEFPG+VLRPVG
Sbjct  170   KFAV-LEMSVLPKGGDEIQIREVWNDNLEEEFALIREIVDKYNYIAMDTEFPGVVLRPVG  228

Query  835   NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDV  656
              FKN +DY+YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D+
Sbjct  229   AFKNINDYNYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNLIDDI  288

Query  655   FASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK  476
             FASDS+ELL QCGIDF+KN E GI+  RFGELLMSSGIVLND V WVTFHSGYDFGYLLK
Sbjct  289   FASDSVELLHQCGIDFKKNNEKGIDVNRFGELLMSSGIVLNDVVRWVTFHSGYDFGYLLK  348

Query  475   ILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQA  296
             +LTC+ LP+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQA
Sbjct  349   LLTCRSLPDTQAGFFELINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQA  408

Query  295   GSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             GSDSLLT+CTFRKL++NFF+G  E+Y+GVLYGLGVEN + 
Sbjct  409   GSDSLLTSCTFRKLRENFFNGCTEKYAGVLYGLGVENDKT  448



>gb|EYU21723.1| hypothetical protein MIMGU_mgv1a019889mg [Erythranthe guttata]
Length=272

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 214/272 (79%), Positives = 251/272 (92%), Gaps = 3/272 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL+PKS+S+QIREVW +NL+EEFDLIRE+VD+YP+IAMDTEFPGIVLRPVG F++++DY
Sbjct  1    MSLMPKSESVQIREVWAHNLDEEFDLIREIVDEYPYIAMDTEFPGIVLRPVGTFRSANDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC---GTDKYCIWQFNFREFDPNEDVFASDS  641
            HYQTLKDNV++LKLIQLGLTFSDE GNLP C   G +++CIWQFNFREFDPNEDVFA+DS
Sbjct  61   HYQTLKDNVNLLKLIQLGLTFSDENGNLPECSGAGKNRHCIWQFNFREFDPNEDVFANDS  120

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            IELL + GID  +NTE+GIE+RRF ELLMSSGIVLN+SV+WVTFHSGYDFGYL+K++T Q
Sbjct  121  IELLSRSGIDLARNTENGIESRRFAELLMSSGIVLNESVYWVTFHSGYDFGYLIKLVTGQ  180

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
            +LPE Q+GFF LI++YFP V+DIKHLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSL
Sbjct  181  KLPEEQEGFFGLIDVYFPVVYDIKHLMKFVNSLHGGLNKLAELLEVERVGVCHQAGSDSL  240

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
            LT CTF KLKDNFFSG+L +YSGVLYGLG+E+
Sbjct  241  LTCCTFFKLKDNFFSGTLHKYSGVLYGLGIES  272



>ref|XP_010691601.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Beta 
vulgaris subsp. vulgaris]
Length=274

 Score =   457 bits (1176),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 250/272 (92%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS++ KSDS+ IREVW+ NLE+EF LIR++VD YPF+AMDTEFPGIVLR VG F+N+ D+
Sbjct  1    MSVVLKSDSVHIREVWEENLEQEFGLIRDIVDAYPFVAMDTEFPGIVLRAVGEFENNTDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLKDNVDMLKLIQLGLTFSDE+GNLPTCGT+++CIWQFNF EF+ NEDVFA DSI+L
Sbjct  61   NYRTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTEQFCIWQFNFCEFNLNEDVFAHDSIQL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN + GI A RFGELLMSSG+VLND+VHW+TFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFQKNNDRGINALRFGELLMSSGVVLNDNVHWITFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ+ FF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+GV HQAGSDSLLT+
Sbjct  181  DTQREFFHLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGVSHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLKDNFFSGS+E+Y+GVLYGLG +NGQ+
Sbjct  241  CTFRKLKDNFFSGSMEKYAGVLYGLGSDNGQS  272



>ref|XP_008794330.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   457 bits (1175),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 211/271 (78%), Positives = 245/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPK++++QIREVW+ N++ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKNETVQIREVWNDNVDVEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT   C+WQFNFREFD + D+FA+DSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFATDSIELL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GID +KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+
Sbjct  123  RQSGIDLKKNNERGIDANRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPD  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQPGFFNLIKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            TFRKLK++FF+G+ E Y+GVLYGLGVENGQN
Sbjct  243  TFRKLKESFFNGATERYAGVLYGLGVENGQN  273



>ref|XP_006389834.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
 gb|ESQ27120.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
Length=274

 Score =   456 bits (1174),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 210/271 (77%), Positives = 247/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NL+EE DLIREVVDD+P++AMDTEFPGIV+RPV  FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVMAFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGT+KYCIWQFNFREFD + D++A DSI+L
Sbjct  61   HYETLKMNVNILKIIQLGLTFSNEQGNLPTCGTEKYCIWQFNFREFDVDSDIYALDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF KNT+ G++++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDFAKNTQQGVDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             +Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  NSQTSFFELINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKLK+NFF G L++YSGVLYGLGVENGQ
Sbjct  241  CTFRKLKENFFVGPLQKYSGVLYGLGVENGQ  271



>emb|CAN79806.1| hypothetical protein VITISV_031504 [Vitis vinifera]
Length=270

 Score =   456 bits (1173),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 212/268 (79%), Positives = 243/268 (91%), Gaps = 0/268 (0%)
 Frame = -1

Query  982  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  803
            +PK++S+ IREVW+ NLE EF LIRE+VD YP+IAMDTEFPG+VLRP+G FKN +DY+YQ
Sbjct  1    MPKTESVLIREVWNENLESEFALIREIVDKYPYIAMDTEFPGVVLRPMGTFKNINDYNYQ  60

Query  802  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  623
            TLKDNVDMLKLIQLGLTFSD  GNLPTCGTDK CIWQFNFREFD  EDVFASDSI++L++
Sbjct  61   TLKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQMLQE  120

Query  622  CGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQ  443
            CG+DF+KN E GI+  +FGELLMSSGIVLND+V WVTFHSGYDFGYLLK+LT + LP TQ
Sbjct  121  CGMDFKKNNEKGIDVNQFGELLMSSGIVLNDNVSWVTFHSGYDFGYLLKLLTRRSLPGTQ  180

Query  442  QGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTF  263
             GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTF
Sbjct  181  AGFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  240

Query  262  RKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            RKL+D+FF+GS E+Y+GVLYGLGVE GQ
Sbjct  241  RKLRDSFFNGSTEKYAGVLYGLGVETGQ  268



>ref|XP_010429900.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
 ref|XP_010429901.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   456 bits (1174),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 248/272 (91%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGTD KYCIWQFNFREFD + D+FA DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL+Q GID  KNT+ GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLKQSGIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PDSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKLK+NFF G L++YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLKENFFVGPLQKYSGVLYGLGVENGQ  272



>ref|XP_009106716.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDX87343.1| BnaA07g35300D [Brassica napus]
Length=275

 Score =   456 bits (1172),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 214/272 (79%), Positives = 245/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW  NL+EE DLIREVVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWSDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTD KYCIWQFNFREFD + D+FA DSI+
Sbjct  61   HYETLKLNVNILNIIQLGLTFSNEQGNLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSID  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL+Q GIDF KNT  GIE+RRF ELLMSSGIVLN +VHWVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLKQSGIDFAKNTREGIESRRFAELLMSSGIVLNGNVHWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PDSQTSFFELINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKLK+NFF G L++Y+GVLYGLGVENGQ
Sbjct  241  SCTFRKLKENFFVGPLQKYAGVLYGLGVENGQ  272



>ref|NP_001185452.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 gb|AEE36450.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=286

 Score =   456 bits (1172),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 245/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NL+EE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLQEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSIEL
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GID  KNT  GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDLAKNTLDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+
Sbjct  181  DSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFF G L +YSGVLYGLGVEN  N
Sbjct  241  CTFRKLKENFFVGPLHKYSGVLYGLGVENEAN  272



>ref|XP_008799630.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   455 bits (1170),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 214/271 (79%), Positives = 244/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPKS+++QIREVW+ NL+ EF LIRE+VDD+P++AMDTEFPGIV RP+GNFK S D++
Sbjct  3    SILPKSETVQIREVWNDNLDAEFALIREIVDDFPYVAMDTEFPGIVARPLGNFKTSSDFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGT + C+WQFNFREFD   D+FASDSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFDVQCDIFASDSIELL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LT Q LP+
Sbjct  123  RQSGIDFKKNNERGIDANRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTRQNLPD  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LI ++FP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQPGFFNLIKIFFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            TFRKLK +FF+GS E Y+GVLYGLGVENGQN
Sbjct  243  TFRKLKGSFFNGSTERYAGVLYGLGVENGQN  273



>gb|KJB06630.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
 gb|KJB06632.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=273

 Score =   454 bits (1169),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 243/272 (89%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DS+QIR+VW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVG FKN  DY
Sbjct  1    MSVLPKGDSVQIRKVWNDNLEEEFVLIREIVDTYNYVAMDTEFPGVVLRPVGTFKNVSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVDMLKLIQLGLTFSD  GNLPTCGTD +CIWQFNFREF+ +ED+F SDSIEL
Sbjct  61   NYQTLKGNVDMLKLIQLGLTFSDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L QCGIDF+KN E GI+ +RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LLQCGIDFKKNNEKGIDVKRFGELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LI +YFP V+DIKH+M+FCN LHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  DSQTGFFKLIKLYFPMVYDIKHMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+DNFF  S+++Y+GVLYGL VE GQN
Sbjct  241  CTFRKLRDNFFK-SVQKYAGVLYGLEVEGGQN  271



>ref|XP_010048142.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 ref|XP_010048359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80304.1| hypothetical protein EUGRSUZ_C01665 [Eucalyptus grandis]
 gb|KCW80609.1| hypothetical protein EUGRSUZ_C01976 [Eucalyptus grandis]
Length=274

 Score =   454 bits (1169),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 216/270 (80%), Positives = 242/270 (90%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M++  K DSI IREVW+ NLEEEF LIREVVD + ++AMDTEFPG+V RPVGNFKN  DY
Sbjct  1    MAVPLKDDSIDIREVWNDNLEEEFALIREVVDRFSYVAMDTEFPGVVSRPVGNFKNISDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDKYCIWQFNFREF+  ED+FA DSIEL
Sbjct  61   NYLTLKNNVDMLKLIQLGLTFSDENGNLPTCGTDKYCIWQFNFREFNVTEDMFAGDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR+CGIDF+KNTE G++ RRFGELLMSSGIVLN  VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRECGIDFKKNTEKGVDVRRFGELLMSSGIVLNADVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVER GVCHQAGSDSLLTA
Sbjct  181  DTQVGFFDLINIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERFGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTF KL+D FF+GS E+Y+GVLYGLGVE+G
Sbjct  241  CTFLKLRDMFFNGSTEKYAGVLYGLGVEDG  270



>ref|XP_004250764.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
 ref|XP_004250765.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   454 bits (1169),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 246/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSI+IREVW  NLE+EF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK+ ++Y
Sbjct  1    MSVLPKIDSIKIREVWSDNLEKEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFKHINEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDML LIQLGLTFSDE GNLPTC ++ Y +WQFNFREFD   ++FA+DSIEL
Sbjct  61   NYQTLKDNVDMLNLIQLGLTFSDENGNLPTCESEYYYVWQFNFREFDTKANIFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF+KN E GI+A++FGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LIQSGIDFKKNNEMGIDAKQFGELLMSSGIVLNDMVHWVTFHSGYDFGYLLKLLTCRTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF L+NMYFP V+DIKHLM+FCNSLHGGLNKLAELLE+ERVG+CHQAGSDSLLT+
Sbjct  181  ETQSGFFDLLNMYFPLVYDIKHLMKFCNSLHGGLNKLAELLEIERVGICHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            C F+KLKDNFF+GS E+Y+GVLYGLGVE G +
Sbjct  241  CAFKKLKDNFFNGSTEKYAGVLYGLGVEYGSD  272



>ref|XP_008378874.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008343758.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=271

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK+DSIQIREVW+ NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG FKN +++
Sbjct  1    MSLLPKADSIQIREVWNDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGAFKNINEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLKDNVDMLKLIQLGLTFSDE G+LPT  T+ + IWQFNFREF+ +ED+FASDSI+L
Sbjct  61   HYKTLKDNVDMLKLIQLGLTFSDENGDLPTLATENHYIWQFNFREFNVSEDIFASDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSG+VL+D+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVNRFGELLMSSGLVLSDNVHWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            + Q  FF LI +YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DNQMEFFNLIKIYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FFSGS E+YSGVLYGLG+ENGQ
Sbjct  241  CTFRKLRDTFFSGSAEKYSGVLYGLGIENGQ  271



>ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
 gb|ESR66901.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
Length=274

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 212/271 (78%), Positives = 243/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKS+SI IREVW+ NLE EF LIR++VDDYP+IAMDTEFPGIVLR +GNFK+S +Y
Sbjct  1    MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFKSSSEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQ LK NVD+LKLIQLGLTF+DE GNLP  GTDKYC+WQFNFREF P+EDV+A DSI+L
Sbjct  61   NYQNLKVNVDLLKLIQLGLTFTDENGNLPKYGTDKYCLWQFNFREFSPDEDVYAYDSIKL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L + GIDF+KN E G++A RF ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTC++LP
Sbjct  121  LSRSGIDFKKNKEKGVDAMRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF LI MYFP ++DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT 
Sbjct  181  ETQACFFDLIKMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTF K+KDNFF GS E+Y+GVLYGLGVENGQ
Sbjct  241  CTFMKMKDNFFKGSPEKYAGVLYGLGVENGQ  271



>ref|XP_003603309.1| Ribonuclease CAF1 [Medicago truncatula]
 gb|ACJ84747.1| unknown [Medicago truncatula]
 gb|AFK46979.1| unknown [Medicago truncatula]
Length=275

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/265 (81%), Positives = 243/265 (92%), Gaps = 0/265 (0%)
 Frame = -1

Query  982  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  803
            L K DSIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFK+ +D++YQ
Sbjct  8    LQKGDSIQIREVWNDNLEEEFVLIREIVDKYNYVAMDTEFPGVVLRPVGNFKHINDFNYQ  67

Query  802  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  623
            TLKDNVDMLKLIQLGLTFSDE GNLPTCGTD  CIWQFNFREF+ +ED+FA+DSIELLRQ
Sbjct  68   TLKDNVDMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQ  127

Query  622  CGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQ  443
            CGIDF+KN+E GI+  RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ
Sbjct  128  CGIDFKKNSEQGIDVNRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQ  187

Query  442  QGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTF  263
             GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVGVCHQAGSDSLLTACTF
Sbjct  188  AGFFDLIGIYFPIVYDIKHLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTF  247

Query  262  RKLKDNFFSGSLEEYSGVLYGLGVE  188
            RKL++ FF+G  E+YSGVLYGLGVE
Sbjct  248  RKLRETFFNGETEKYSGVLYGLGVE  272



>gb|AFK45143.1| unknown [Lotus japonicus]
Length=272

 Score =   454 bits (1167),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 245/269 (91%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+L K DS+QIREVW+ NLEEEF LIRE+VDD+ ++AMDTEFPG+VLRP+GNFKN +DY
Sbjct  1    MSILQKGDSVQIREVWNDNLEEEFALIREIVDDFSYVAMDTEFPGVVLRPLGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTETPCIWQFNFREFNVSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GID +K  E GI+  RFGELLMSSG+VLND+VHWVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQSGIDLKKINEKGIDVSRFGELLMSSGVVLNDNVHWVTFHSGYDFGYLLKLLTCRVLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E+Q GFF LI +YFP ++DIKHLM+FCN+LHGGLNKLAELLEV+RVG+CHQAGSDSLLT+
Sbjct  181  ESQAGFFELIKIYFPMLYDIKHLMKFCNNLHGGLNKLAELLEVDRVGMCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
            CTFRKL+D +FSGS E+Y+GVLYGLGVEN
Sbjct  241  CTFRKLRDTYFSGSTEKYAGVLYGLGVEN  269



>ref|XP_010417661.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 211/272 (78%), Positives = 248/272 (91%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW+ NLEEE DLIR+VVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWNDNLEEEMDLIRDVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++LK+IQLGLTFS+E+G+LPTCGT+ KYCIWQFNFREFD + D+FA DSIE
Sbjct  61   HYETLKTNVNILKMIQLGLTFSNEQGDLPTCGTNNKYCIWQFNFREFDLDSDIFAVDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL+Q GID  KNT+ GI+++RF ELLMSSG+VLN++VHWVTFHSGYDFGYLLK+LTCQ L
Sbjct  121  LLKQSGIDLAKNTQDGIDSKRFAELLMSSGVVLNENVHWVTFHSGYDFGYLLKLLTCQNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PDSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKLK+NFF G L++YSGVLYGLGVENGQ
Sbjct  241  SCTFRKLKENFFVGPLQKYSGVLYGLGVENGQ  272



>gb|KHN29617.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=265

 Score =   453 bits (1165),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 216/271 (80%), Positives = 244/271 (90%), Gaps = 8/271 (3%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DS+QIREVW+ NLEEEF LIRE+VD+Y ++AMDTEFPG+VLRPVGNFKN +DY
Sbjct  1    MSILPKGDSVQIREVWNDNLEEEFALIREIVDEYNYVAMDTEFPGVVLRPVGNFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN+E+GI+  RFGELLMSSGIV         FHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNSENGIDVNRFGELLMSSGIVF--------FHSGYDFGYLLKLLTCRSLP  172

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LI MYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  173  DTQAGFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  232

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FFSGS E+Y+GVLYGLGVE+GQ
Sbjct  233  CTFRKLRDTFFSGSTEKYAGVLYGLGVESGQ  263



>ref|XP_009399558.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   453 bits (1165),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 210/271 (77%), Positives = 242/271 (89%), Gaps = 0/271 (0%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            S+LPKS++++IREVW  NLE EF LIRE+VDD+P++AMDTEFPGIV RP+G F+ S D++
Sbjct  3    SILPKSETVEIREVWSDNLEAEFSLIREIVDDFPYVAMDTEFPGIVCRPLGCFRTSSDFN  62

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NVDMLKLIQLGLTFSDE GNLPTCGTD+ C+WQFNFREFD   DVFA+DSIELL
Sbjct  63   YATLKANVDMLKLIQLGLTFSDELGNLPTCGTDRGCVWQFNFREFDMQLDVFATDSIELL  122

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN + GI+A RFGELLMSSGIVLNDS++WVTFHSGYDFGYLLK+LTCQ LP+
Sbjct  123  RQSGIDFKKNNDKGIDAHRFGELLMSSGIVLNDSIYWVTFHSGYDFGYLLKVLTCQNLPD  182

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C
Sbjct  183  TQAGFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSC  242

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             FRKLK++FFSGS E Y+GVLYGL VENGQ 
Sbjct  243  AFRKLKESFFSGSTERYAGVLYGLSVENGQT  273



>emb|CDY39943.1| BnaC06g40210D [Brassica napus]
Length=275

 Score =   452 bits (1163),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 244/272 (90%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW  NL+EE DLIREVVDD+P++AMDTEFPGIV+RPVG FK++ DY
Sbjct  1    MSLFLKDDSIQIREVWSDNLQEEMDLIREVVDDFPYVAMDTEFPGIVVRPVGTFKSNADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            HY+TLK NV++L +IQLGLTFS+E+GNLPTCGTD KYCIWQFNFREFD + D+FA DSI+
Sbjct  61   HYETLKLNVNILNIIQLGLTFSNEQGNLPTCGTDSKYCIWQFNFREFDLDSDIFAVDSID  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL+Q GIDF KNT  GIE+ RF ELLMSSGIVLN +VHWVTFHSGYDFGYLLK+LTC+ L
Sbjct  121  LLKQSGIDFAKNTRQGIESSRFAELLMSSGIVLNGNVHWVTFHSGYDFGYLLKLLTCKNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT
Sbjct  181  PDSQTSFFELINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKLK+NFF G L++Y+GVLYGLGVENGQ
Sbjct  241  SCTFRKLKENFFVGPLQKYAGVLYGLGVENGQ  272



>ref|XP_009144015.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brassica 
rapa]
 emb|CDY64914.1| BnaA05g35260D [Brassica napus]
Length=276

 Score =   452 bits (1163),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 211/274 (77%), Positives = 246/274 (90%), Gaps = 2/274 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSL  K DSIQIREVW  NLE E  LIR++VDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLFLKDDSIQIREVWHDNLESEMALIRDIVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSI  638
            HY+TL+ NV++LK+IQLGLTFSDE+GNLPTCG D  KYCIWQFNFREFD + D+FA DSI
Sbjct  61   HYETLRTNVNLLKMIQLGLTFSDERGNLPTCGPDDSKYCIWQFNFREFDLSSDIFAHDSI  120

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            ELLRQ GIDF+KN  +G+++RRF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTC++
Sbjct  121  ELLRQSGIDFDKNKRNGVDSRRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCRD  180

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LPETQ GFF +I +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLL
Sbjct  181  LPETQVGFFEMIRVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLL  240

Query  277  TACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            T+CTFRKL++NFF GS+E+YSGVLYGLGVENGQ+
Sbjct  241  TSCTFRKLQENFFIGSMEKYSGVLYGLGVENGQS  274



>ref|XP_008445257.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7 [Cucumis melo]
Length=274

 Score =   451 bits (1160),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 209/271 (77%), Positives = 246/271 (91%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN ++Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIEL
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR+CGIDF+K  E GI+  RFGELLMSSGIVLND++ WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRECGIDFQKTHEEGIDVNRFGELLMSSGIVLNDNIXWVTFHSGYDFGYLLKLLTCRNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF LI+MYFP V+DIKHLMRFCNS HGGLNKLAELLEVER+GVCHQAGSDSLLTA
Sbjct  181  ETQAEFFDLIHMYFPMVYDIKHLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FF+GS+++Y+GVLYGLGVE GQ
Sbjct  241  CTFRKLRDTFFNGSIQKYAGVLYGLGVETGQ  271



>emb|CDY12234.1| BnaC04g12640D [Brassica napus]
Length=276

 Score =   451 bits (1159),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 211/274 (77%), Positives = 245/274 (89%), Gaps = 2/274 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSIQIREVW  NLE E  LIR++VDD+PF+AMDTEFPGIV RPVG FK + +Y
Sbjct  1    MSLLLKDDSIQIREVWHDNLESEMALIRDIVDDFPFVAMDTEFPGIVCRPVGTFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSI  638
            HY+TL+ NV++LK+IQLGLTFSDE+GNLPTCG D  KYCIWQFNFREFD + D+FA DSI
Sbjct  61   HYETLRTNVNLLKMIQLGLTFSDERGNLPTCGPDDKKYCIWQFNFREFDLSSDIFAHDSI  120

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            ELLRQ GIDF+ N  +G+++RRF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+
Sbjct  121  ELLRQSGIDFDNNKRNGVDSRRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQD  180

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LPETQ GFF +I +YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLL
Sbjct  181  LPETQVGFFEMIRVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLL  240

Query  277  TACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            T+CTFRKL++NFF GS+E+YSGVLYGLGVEN Q+
Sbjct  241  TSCTFRKLQENFFIGSMEKYSGVLYGLGVENVQS  274



>gb|ACJ84891.1| unknown [Medicago truncatula]
Length=275

 Score =   450 bits (1157),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 214/265 (81%), Positives = 241/265 (91%), Gaps = 0/265 (0%)
 Frame = -1

Query  982  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  803
            L K DSIQIREVW+ NLEEEF LIRE+VD Y ++AMDTEFPG+VLRPVGNFK+ +D++YQ
Sbjct  8    LQKGDSIQIREVWNDNLEEEFVLIREIVDKYNYVAMDTEFPGVVLRPVGNFKHINDFNYQ  67

Query  802  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  623
            TLKDNV MLKLIQLGLTFSDE GNLPTCGTD  CIWQFNFREF+ +ED+FA+DSIELLRQ
Sbjct  68   TLKDNVYMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQ  127

Query  622  CGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQ  443
            CGIDF+KN+E GI+  RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ
Sbjct  128  CGIDFKKNSEQGIDVNRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQ  187

Query  442  QGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTF  263
             GFF LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVGVCHQAGSDSLLTACTF
Sbjct  188  AGFFDLIGIYFPIVYDIKHLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTF  247

Query  262  RKLKDNFFSGSLEEYSGVLYGLGVE  188
            RKL+  FF+G  E+YSGVLYGLGVE
Sbjct  248  RKLRGTFFNGETEKYSGVLYGLGVE  272



>gb|ACN40154.1| unknown [Picea sitchensis]
Length=274

 Score =   450 bits (1157),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 245/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LP+SDS+ IREVW  NL EEF LIRE+VDDYP+IAMDTEFPGIV+RPVGNFK + ++
Sbjct  1    MSILPQSDSLIIREVWADNLVEEFALIREIVDDYPYIAMDTEFPGIVVRPVGNFKTASEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+ ++D++ASDSIEL
Sbjct  61   HYYTLKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF+KN E GI+A+ F ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP
Sbjct  121  LQQSGIDFKKNNEKGIDAQVFAELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQQLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             T+ GFF LINMYFP V+DIKHLM+FCNSL+GGLNKLAELL+V+R+GVCHQAGSDSLLT+
Sbjct  181  PTRAGFFKLINMYFPTVYDIKHLMKFCNSLYGGLNKLAELLDVKRIGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            C FRKL++ FF+GS E+Y+GVLYGL +E+GQ 
Sbjct  241  CAFRKLREGFFNGSTEKYAGVLYGLALEHGQT  272



>ref|XP_004138706.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
sativus]
 gb|KGN62986.1| Ccr4-associated factor [Cucumis sativus]
Length=274

 Score =   449 bits (1156),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 209/271 (77%), Positives = 245/271 (90%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK +SI IREVW+ NLEEEF LIR++VD + +IAMDTEFPG+V+RPVG+FKN ++Y
Sbjct  1    MSILPKGESINIREVWNDNLEEEFALIRDIVDQFNYIAMDTEFPGVVVRPVGSFKNINEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TL++NVD LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIEL
Sbjct  61   NYRTLRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR+CGIDF+K  E GI+  RFGELLMSSGIVLND++ WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRECGIDFQKTHEEGIDVNRFGELLMSSGIVLNDNIFWVTFHSGYDFGYLLKLLTCRNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ  FF LI+MYFP V+DIKHLMRFCNS HGGLNKLAELLEVER+GVCHQAGSDSLLTA
Sbjct  181  ETQAEFFDLIHMYFPMVYDIKHLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            CTFRKL+D FF+GS ++Y+GVLYGLGVE GQ
Sbjct  241  CTFRKLRDTFFNGSTQKYAGVLYGLGVETGQ  271



>gb|ABK24400.1| unknown [Picea sitchensis]
Length=274

 Score =   449 bits (1155),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 244/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LP+SDS+ IREVW  NL EEF LIRE+VDDYP+IAMDTEFPGIV+RPVGNFK + ++
Sbjct  1    MSILPQSDSLIIREVWADNLMEEFALIREIVDDYPYIAMDTEFPGIVVRPVGNFKTASEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCIWQFNFREF+ ++D++A DSIEL
Sbjct  61   HYYTLKSNVDILNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYAIDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF+KN E GI+A+ FGELLMSSGIVLND+VHWVTFHSGYDFGY+LK+LTCQ+LP
Sbjct  121  LQQSGIDFKKNNEDGIDAQVFGELLMSSGIVLNDTVHWVTFHSGYDFGYMLKLLTCQQLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             T  GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELL+V+R+GVCHQAGSDSLLT+
Sbjct  181  PTPAGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVKRIGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            C FRKL++ FF+GS E+Y+GVLYGL  +NGQ+
Sbjct  241  CAFRKLREGFFNGSTEKYAGVLYGLAFDNGQS  272



>ref|XP_011073532.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=271

 Score =   449 bits (1155),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 210/268 (78%), Positives = 242/268 (90%), Gaps = 0/268 (0%)
 Frame = -1

Query  982  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ  803
            LPK+D IQIREVW+ NLE+EF LIR++VD YP++AMDTEFPG+VLRPVGNF + + Y+YQ
Sbjct  4    LPKNDQIQIREVWNDNLEQEFALIRDIVDGYPYVAMDTEFPGVVLRPVGNFNHINQYNYQ  63

Query  802  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  623
            TLKDNVDMLKLIQLGLTFSDE GNLPTCGT+  CIWQFNFREF+ +ED+FA+DSIELLRQ
Sbjct  64   TLKDNVDMLKLIQLGLTFSDENGNLPTCGTNTCCIWQFNFREFNVSEDIFANDSIELLRQ  123

Query  622  CGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQ  443
             GIDF+KN E GI+A RF ELLMSSGIVLND + WVTFHSGYDFGYLLK+LTC+ LPET 
Sbjct  124  SGIDFKKNNELGIDAGRFAELLMSSGIVLNDGMCWVTFHSGYDFGYLLKLLTCRSLPETP  183

Query  442  QGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTF  263
             GFF L+N+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+C F
Sbjct  184  AGFFLLLNIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCAF  243

Query  262  RKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +KLKDNFF+GS E+Y+GVLYGLG+ENG 
Sbjct  244  KKLKDNFFNGSTEKYAGVLYGLGIENGS  271



>ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
 gb|EMJ03585.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
Length=295

 Score =   446 bits (1147),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 247/273 (90%), Gaps = 0/273 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  21   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  80

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIE
Sbjct  81   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIE  140

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF+KN E G++A RF +LLM+SG+VLN++V WVTFHSGYDFGYLLK+L  + L
Sbjct  141  LLSQSGMDFKKNNEKGVDAVRFSQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETL  200

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF +I +YFP ++DIKHLMRFCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT
Sbjct  201  PDTQMGFFDMIKVYFPTIYDIKHLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLT  260

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            +CTF KLK+ FFSG+ ++Y+GVLYGLGVENG N
Sbjct  261  SCTFMKLKETFFSGNPDKYAGVLYGLGVENGYN  293



>ref|XP_008377668.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=273

 Score =   444 bits (1143),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 245/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSI+IREVW+ NL+EEF LIR++V  YP++AMDTEFPG+VLRPVG+FKN +++
Sbjct  1    MSILPKGDSIEIREVWNDNLDEEFALIRDIVLKYPYVAMDTEFPGVVLRPVGDFKNINEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLKDNVDMLKLIQLGLTF DE GNLPT  T+   IWQFNFREF+ +ED++ASDSIEL
Sbjct  61   NYKTLKDNVDMLKLIQLGLTFFDENGNLPTLSTENQYIWQFNFREFNVSEDIYASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLM+SG+VL+D+V+WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LRQCGIDFKKNNEKGIDVNRFGELLMASGLVLSDNVYWVTFHSGYDFGYLLKLLTCRSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            + Q  FF LI +YFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DAQTEFFNLIKIYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+D FFSGS E+YSGVLYGLGVENGQ+
Sbjct  241  CTFRKLRDTFFSGSAEKYSGVLYGLGVENGQS  272



>ref|XP_008242960.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Prunus mume]
Length=295

 Score =   444 bits (1142),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 205/273 (75%), Positives = 246/273 (90%), Gaps = 0/273 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  21   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  80

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIE
Sbjct  81   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIE  140

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF+KN E G++A RF +LLM+SG+VLN++V WVTFHSGYDFGYLLK+L  + L
Sbjct  141  LLSQSGMDFKKNNEKGVDAVRFSQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETL  200

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF +I +YFP ++DIKHLMRFCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT
Sbjct  201  PDTQMGFFDMIKVYFPTIYDIKHLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLT  260

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            +C F KLK+ FFSG+ ++Y+GVLYGLGVENG N
Sbjct  261  SCAFMKLKETFFSGNPDKYAGVLYGLGVENGYN  293



>ref|XP_008220692.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Prunus 
mume]
Length=274

 Score =   442 bits (1137),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 238/272 (88%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSIQIREVW  NL+EEF +IRE+V+ Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSILPKGDSIQIREVWSDNLDEEFAIIREIVEKYNYVAMDTEFPGVVLRPVGAFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSD+ G LP   T    IWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+ +RFGELL+SSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP
Sbjct  121  LRQCGIDFKKNNEKGIDVKRFGELLVSSGVVLNAEVHWVTFHSGYDFGYLLKLLTGVSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LI  +FP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DSQAGFFELIKAFFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+D FF G+ E+Y+GVLYGLGVENGQ+
Sbjct  241  CTFRKLRDTFFGGTAEKYAGVLYGLGVENGQS  272



>ref|XP_008242959.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Prunus mume]
Length=307

 Score =   443 bits (1139),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 205/273 (75%), Positives = 246/273 (90%), Gaps = 0/273 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMSLL KSDSI IREVW+ NLE+EF+LIR++VDDYP+IAMDTEFPGIVLRP+G FKNS D
Sbjct  33   KMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPGIVLRPIGTFKNSFD  92

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            Y+YQTLK NVD+LKLIQLGLTF+DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIE
Sbjct  93   YNYQTLKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIE  152

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF+KN E G++A RF +LLM+SG+VLN++V WVTFHSGYDFGYLLK+L  + L
Sbjct  153  LLSQSGMDFKKNNEKGVDAVRFSQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETL  212

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF +I +YFP ++DIKHLMRFCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT
Sbjct  213  PDTQMGFFDMIKVYFPTIYDIKHLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLT  272

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            +C F KLK+ FFSG+ ++Y+GVLYGLGVENG N
Sbjct  273  SCAFMKLKETFFSGNPDKYAGVLYGLGVENGYN  305



>ref|XP_008336906.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   442 bits (1136),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/271 (77%), Positives = 239/271 (88%), Gaps = 0/271 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMS  PKSDSI IREVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSXFPKSDSIHIREVWSDNLEEEFKLIRSVVEEYQYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF KN E G++A +F ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q L
Sbjct  141  LLSQSGMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSL  200

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P TQ GFF +I +YFP V+DIKHLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT
Sbjct  201  PNTQVGFFKMIKVYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLT  260

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
              TF KLK+ FF GS+++Y+GVLYGLGVENG
Sbjct  261  CSTFMKLKETFFDGSIDKYAGVLYGLGVENG  291



>ref|XP_006410344.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
 gb|ESQ51797.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
Length=276

 Score =   441 bits (1134),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 205/273 (75%), Positives = 238/273 (87%), Gaps = 2/273 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+L P+ DSIQIREVW+ NLE E  LIREVVDD+PF+AMDTEFPGIV RP+G FK + +Y
Sbjct  1    MTLFPEDDSIQIREVWNENLESEMALIREVVDDFPFVAMDTEFPGIVCRPIGTFKTNTEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSI  638
            HY+TLK NV++LK+IQLGLTFSD+KGNLPTCG    K+CIWQFNFR+FD N D+FA DSI
Sbjct  61   HYETLKTNVNLLKMIQLGLTFSDDKGNLPTCGGSDKKHCIWQFNFRDFDLNSDIFAHDSI  120

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            ELLRQ GIDF KN + G+++RRF EL MSSGIVLN+SVHWVTFHSGYDFGYLLK+LTCQ 
Sbjct  121  ELLRQSGIDFVKNNQIGVDSRRFAELFMSSGIVLNESVHWVTFHSGYDFGYLLKLLTCQN  180

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LPETQ GFF +I++YFP V+D+KHLM+FCNSLHGGLN LA  LEV RVGV HQAGSDSLL
Sbjct  181  LPETQTGFFEMISVYFPRVYDVKHLMKFCNSLHGGLNNLAAQLEVARVGVSHQAGSDSLL  240

Query  277  TACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            T+CTFRKL++NFF GS+E+YSGVLYGLGVENG 
Sbjct  241  TSCTFRKLQENFFVGSMEKYSGVLYGLGVENGH  273



>ref|XP_009358471.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   440 bits (1132),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/271 (76%), Positives = 238/271 (88%), Gaps = 0/271 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMS  PKSDSI IREVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSTFPKSDSIHIREVWSDNLEEEFKLIRNVVEEYRYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF KN E G++A +F ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+L  Q L
Sbjct  141  LLSQSGMDFVKNNEKGVDASKFAELLMASGVVLSDNVVWVTFHSGYDFGYLLKLLKGQSL  200

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P TQ GFF +I +YFP V+DIKHLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT
Sbjct  201  PNTQVGFFKMIKVYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLT  260

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
              TF KLK+ FF GS+++Y+GVLYGLGVENG
Sbjct  261  CSTFMKLKETFFDGSIDKYAGVLYGLGVENG  291



>ref|XP_010556071.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Tarenaya 
hassleriana]
Length=276

 Score =   437 bits (1125),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/272 (79%), Positives = 245/272 (90%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+L K DSI IREVW+ NLEEEF LIREVVD Y ++AMDTEFPG+VLRP+G FKN  DY
Sbjct  1    MSVLLKDDSILIREVWNDNLEEEFTLIREVVDTYNYVAMDTEFPGVVLRPLGTFKNIADY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+ ++DV+AS+SI+L
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEHGNLPTCGTDKFCIWQFNFREFNLSQDVYASESIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L QCGIDF KN E GI+ +RFGELLMSSGIVLND+V WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  121  LHQCGIDFNKNNEKGIDVKRFGELLMSSGIVLNDAVSWVTFHSGYDFGYLLKLLTCKTLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            + Q  FF  +N+YFP ++DIKH+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+
Sbjct  181  QLQAEFFNHLNIYFPVIYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLKD+FF+GS E+Y+GVLYGLGVENG N
Sbjct  241  CTFRKLKDSFFNGSTEKYAGVLYGLGVENGHN  272



>ref|XP_008344039.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   437 bits (1123),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 205/270 (76%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS  P  DSI IREVW  NLEEEF LIR+VV++Y ++AMDTEFPGIVLRPVG FK+S DY
Sbjct  1    MSSFPNRDSIHIREVWSDNLEEEFKLIRKVVEEYRYVAMDTEFPGIVLRPVGTFKDSYDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIEL
Sbjct  61   HYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q G+DF KN E G++A +F ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP
Sbjct  121  LSQSGMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             TQ GFF +I MYFP V+DIKHLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT 
Sbjct  181  NTQAGFFKMIKMYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
             TF KLK+ +F GS ++Y+GVLYGLGVENG
Sbjct  241  STFMKLKETYFDGSPDKYAGVLYGLGVENG  270



>ref|XP_008354337.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   437 bits (1125),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 206/271 (76%), Positives = 237/271 (87%), Gaps = 0/271 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMS  P  DSI IREVW  NLEEEF LIR+VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSSFPNRDSIHIREVWSDNLEEEFKLIRKVVEEYRYVAMDTEFPGIVLRPVGTFKDSYD  80

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF KN E G++A +F ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q L
Sbjct  141  LLSQSGMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSL  200

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P TQ GFF +I MYFP V+DIKHLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT
Sbjct  201  PNTQAGFFKMIKMYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLT  260

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
              TF KLK+ +F GS ++Y+GVLYGLGVENG
Sbjct  261  CSTFMKLKETYFDGSPDKYAGVLYGLGVENG  291



>ref|XP_009366159.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   437 bits (1124),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 237/273 (87%), Gaps = 0/273 (0%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            KMS  P  DSI I+EVW  NLEEEF LIR VV++Y ++AMDTEFPGIVLRPVG FK+S D
Sbjct  21   KMSSFPNRDSIHIKEVWSDNLEEEFKLIRSVVEEYRYVAMDTEFPGIVLRPVGTFKDSFD  80

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
            YHYQTLK NVD+LKLIQLGLTFSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIE
Sbjct  81   YHYQTLKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIE  140

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL Q G+DF KN E G++A +F ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q L
Sbjct  141  LLSQSGMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSL  200

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P TQ GFF +I MYFP V+DIKHLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT
Sbjct  201  PNTQAGFFKMIKMYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLT  260

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
              TF KLK+ +F GS ++Y+GVLYGLGVENG N
Sbjct  261  CSTFMKLKETYFDGSPDKYAGVLYGLGVENGPN  293



>ref|XP_010537879.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=277

 Score =   433 bits (1114),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 206/271 (76%), Positives = 239/271 (88%), Gaps = 1/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPK DS+QI EVW+ NLEEEF LIR++VDD+P+++MDTEFPGIV R VG FK S+DY
Sbjct  1    MSLLPKDDSVQICEVWNDNLEEEFALIRQIVDDFPYVSMDTEFPGIVCRSVGIFKTSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TLK NV+MLKLIQ+GLTFSDE GNLPTCGTDK+CIWQFN REFDPN D+++ DSIEL
Sbjct  61   HYETLKLNVNMLKLIQIGLTFSDENGNLPTCGTDKHCIWQFNLREFDPNSDIYSQDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF KN E+GI++ RF ELL+SSG+VLN+ + WVTFHSGYDFG LLK+LT + LP
Sbjct  121  LRQSGIDFTKNNENGIDSGRFAELLISSGLVLNEDIQWVTFHSGYDFG-LLKLLTNRNLP  179

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E Q GFF LINMYFP ++DIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT 
Sbjct  180  EMQSGFFKLINMYFPILYDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTL  239

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
             ++RKLK+NFF G L++YSGVLYGLGV+NG 
Sbjct  240  RSYRKLKENFFIGCLKKYSGVLYGLGVDNGH  270



>ref|XP_010541576.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X1 [Tarenaya hassleriana]
Length=275

 Score =   433 bits (1113),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/272 (75%), Positives = 243/272 (89%), Gaps = 1/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSI IREVW+ NLEEEF LIR+VV    ++AMDTEFPG+VLRP+G FKN  +Y
Sbjct  1    MSLL-KDDSILIREVWNDNLEEEFALIRDVVVTCSYVAMDTEFPGVVLRPLGPFKNISEY  59

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+P+ED++ ++SI+L
Sbjct  60   NYKTLKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNPSEDIYVNESIDL  119

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L QCGIDF+KN E GI+ +RFGELLMSSG+VLND++ WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  120  LHQCGIDFKKNNEKGIDVKRFGELLMSSGVVLNDAMRWVTFHSGYDFGYLLKLLTCKALP  179

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+N+YFP ++DIKH+M+FCN+LHGGL+KLAELLEVERVGV HQAGSDSLLT 
Sbjct  180  VNQIEFFTLLNIYFPVIYDIKHMMKFCNNLHGGLSKLAELLEVERVGVSHQAGSDSLLTW  239

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK++FF GS+++Y+GVLYGLGVENGQN
Sbjct  240  CTFRKLKESFFKGSMKKYAGVLYGLGVENGQN  271



>ref|XP_002279241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=270

 Score =   432 bits (1112),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 204/270 (76%), Positives = 239/270 (89%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS +  +D+  IR+VWD NLE+E  LIR ++DDYP+IAMDTEFPG+VLR VGNFKN+++Y
Sbjct  1    MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            ++QTLK NVD+LKLIQLGLTFSDE GN PTCGT++YC+WQFNFREF+ NEDVFA DSIEL
Sbjct  61   NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF+KN E G++ARRF ELLMSSGIVLN+SVHWVTFHSGYDFGYLLK+LT Q LP
Sbjct  121  LKQSGIDFKKNNEKGVDARRFSELLMSSGIVLNESVHWVTFHSGYDFGYLLKLLTSQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LI +YFP ++DIKHLM+FCNSLHGGLNKLAELL VER+G CHQAGSDSLLT 
Sbjct  181  ETQAGFFELIRIYFPILYDIKHLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTF KLK +FF+GS E+Y+GVLYGLGVE+G
Sbjct  241  CTFMKLKKDFFNGSPEKYAGVLYGLGVESG  270



>gb|EYU32376.1| hypothetical protein MIMGU_mgv1a026872mg [Erythranthe guttata]
Length=272

 Score =   432 bits (1112),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 201/270 (74%), Positives = 242/270 (90%), Gaps = 1/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS LPK+DS+ IREVW+ NLE+EF LIR++VD+YP++AMDTEFPG+VLRP+G+F +  +Y
Sbjct  1    MSELPKNDSVTIREVWNDNLEQEFALIRDIVDNYPYVAMDTEFPGVVLRPLGSFNHIHEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE GNLPTC  +  CIWQFNFREF+ +ED+FA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDENGNLPTC-DNTCCIWQFNFREFNVSEDIFANDSIEL  119

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR+ GIDF+KN E+GI+A  F ELLMSSGIVLND+V WVTFHSGYDFGYLLK+LTC+ LP
Sbjct  120  LRESGIDFKKNNEAGIDASHFAELLMSSGIVLNDNVRWVTFHSGYDFGYLLKLLTCRSLP  179

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E+  GFF ++N+YFP V+DIKHLM+FCNSLHGGLNKLAELLE+ER+G+CHQAGSDSLLT+
Sbjct  180  ESAVGFFNMLNLYFPVVYDIKHLMKFCNSLHGGLNKLAELLEIERIGICHQAGSDSLLTS  239

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
              F+KLKDNFF+G  E+Y+GVLYGLGVENG
Sbjct  240  SAFKKLKDNFFNGFTEKYAGVLYGLGVENG  269



>emb|CAN68032.1| hypothetical protein VITISV_022019 [Vitis vinifera]
Length=270

 Score =   430 bits (1106),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 204/270 (76%), Positives = 238/270 (88%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS +  +D+  IR+VWD NLE+E  LIR ++DDYP+IAMDTEFPG+VLR VGNFKN+++Y
Sbjct  1    MSDVLVNDTFHIRDVWDDNLEDEIRLIRGLLDDYPYIAMDTEFPGVVLRSVGNFKNNNEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            ++QTLK NVD+LKLIQLGLTFSDE GN PTCGT++YC+WQFNFREF+ NEDVFA DSIEL
Sbjct  61   NFQTLKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF+KN E G++ARRF ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LT Q LP
Sbjct  121  LKQSGIDFKKNNEKGVDARRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTSQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ETQ GFF LI +YFP ++DIKHLM+FCNSLHGGLNKLAELL VER+G CHQAGSDSLLT 
Sbjct  181  ETQAGFFELIRIYFPILYDIKHLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTC  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            CTF KLK +FF+GS E+ +GVLYGLGVE+G
Sbjct  241  CTFMKLKKDFFNGSPEKCAGVLYGLGVESG  270



>ref|XP_002862886.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39145.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   428 bits (1100),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 199/247 (81%), Positives = 228/247 (92%), Gaps = 1/247 (0%)
 Frame = -1

Query  916  LIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEK  737
            LIREVVDD+PF+AMDTEFPGIV RPVG FK + +YHY+TLK NV++LK+IQLGLTFSDEK
Sbjct  3    LIREVVDDFPFVAMDTEFPGIVCRPVGTFKTNTEYHYETLKTNVNILKMIQLGLTFSDEK  62

Query  736  GNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGEL  560
            GNLPTCGTD KYCIWQFNFREFD   D++A+DSIELLRQ GIDF KN + GI+++RF EL
Sbjct  63   GNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFAKNNQFGIDSKRFAEL  122

Query  559  LMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLM  380
            LMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF +I++YFP V+DIKHLM
Sbjct  123  LMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMISVYFPRVYDIKHLM  182

Query  379  RFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYG  200
            +FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSGVLYG
Sbjct  183  KFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSGVLYG  242

Query  199  LGVENGQ  179
            LGVENGQ
Sbjct  243  LGVENGQ  249



>ref|XP_006368924.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
 gb|ERP65493.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
Length=242

 Score =   427 bits (1098),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 211/272 (78%), Positives = 229/272 (84%), Gaps = 32/272 (12%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLL K DSI IREVW+ NLEEEF  IRE+VDD+P+IAMDTEFPGIVLRPVGNFKNS+DY
Sbjct  1    MSLLLKGDSILIREVWNDNLEEEFAHIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NED         
Sbjct  61   HYQTLKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNED---------  111

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
                                   LLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP
Sbjct  112  -----------------------LLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLP  148

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ GFF LINMYFP ++DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA
Sbjct  149  DTQAGFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTA  208

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKLK+NFFSGSLE+Y+GVLYGLGVENGQN
Sbjct  209  CTFRKLKENFFSGSLEKYAGVLYGLGVENGQN  240



>gb|EPS59819.1| hypothetical protein M569_14984, partial [Genlisea aurea]
Length=275

 Score =   428 bits (1101),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 199/273 (73%), Positives = 237/273 (87%), Gaps = 2/273 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS  P SDSIQIREVWD NLEEE  LIRE+VD YP+IAMDTEFPG+V+RPVGNFKN+DDY
Sbjct  1    MSNFPDSDSIQIREVWDANLEEEMALIREIVDQYPYIAMDTEFPGVVIRPVGNFKNTDDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+P+ED FA+DS++L
Sbjct  61   NYQTLKDNVDLLKLIQLGLTFSDEHGNLPTCGTDKHCIWQFNFREFNPSEDAFAADSVQL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF  N++ G+ A RFGEL+M+SG+VLN+ V WVTFHSGYDFGYLLK+LT + +P
Sbjct  121  LRQSGIDFAANSQKGVSAARFGELIMTSGVVLNEDVSWVTFHSGYDFGYLLKVLTRRRMP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVER-VGVCHQAGSDSLLT  275
            ETQ GF+ LI ++FP V+D+KHLM+F NSL+GGLNKLAE L +ER VG+ HQAGSDSLLT
Sbjct  181  ETQAGFYGLIRVFFPVVYDVKHLMKFSNSLYGGLNKLAEQLGIERVVGISHQAGSDSLLT  240

Query  274  ACTFRKLKD-NFFSGSLEEYSGVLYGLGVENGQ  179
             CTFR L++  +F GSLE+Y+GVLYGL  E+ Q
Sbjct  241  CCTFRMLREKKYFRGSLEKYAGVLYGLDDEDAQ  273



>gb|ABK22659.1| unknown [Picea sitchensis]
Length=284

 Score =   428 bits (1100),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 197/268 (74%), Positives = 237/268 (88%), Gaps = 0/268 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPKSDSI IREVW  NLEEEF+LI E+VDDYP +AMDTEFPGIV+RP+G FK   D+
Sbjct  1    MSILPKSDSIHIREVWADNLEEEFNLINEIVDDYPLVAMDTEFPGIVVRPLGKFKTVQDF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TL+ NVD+LKLIQLGLTFSDE GNLP+CGTD+YC+WQFNFREF+  ED +ASDSIEL
Sbjct  61   NYETLRSNVDVLKLIQLGLTFSDEDGNLPSCGTDRYCVWQFNFREFNIWEDAYASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN+E G+++ RF ELLMSSGIVLN++V W+TFHSGYDFGYLLK++  + LP
Sbjct  121  LRQSGIDFKKNSELGVDSHRFAELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRRLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             TQ GFF LI MYFP ++DIKHLM+FCNSLHGGLN+LAELLEVER G CHQAGSDSLLT+
Sbjct  181  LTQAGFFYLIRMYFPNLYDIKHLMKFCNSLHGGLNRLAELLEVERFGACHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            CTFRKL+++FF+G+ ++Y+GVLYGLG E
Sbjct  241  CTFRKLRESFFNGAADKYAGVLYGLGEE  268



>ref|XP_007222518.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
 gb|EMJ23717.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
Length=274

 Score =   427 bits (1098),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 208/272 (76%), Positives = 237/272 (87%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+LPK DSIQIREVW  NL+EEF +IRE+V  Y ++AMDTEFPG+VLRPVG FKN +DY
Sbjct  1    MSILPKGDSIQIREVWSDNLDEEFAIIREIVGTYNYVAMDTEFPGVVLRPVGAFKNINDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSD+ G LP   T    IWQFNFREF+ +ED+FASDSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+ +RFGELL+SSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP
Sbjct  121  LRQCGIDFKKNNEKGIDVKRFGELLVSSGVVLNAEVHWVTFHSGYDFGYLLKLLTGLSLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q GFF LI  +FP V+DIKHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA
Sbjct  181  DSQAGFFELIKAFFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            CTFRKL+D FF G+ E+Y+GVLYGLGVENGQ+
Sbjct  241  CTFRKLRDTFFGGTAEKYAGVLYGLGVENGQS  272



>ref|XP_007023404.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY26026.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
Length=236

 Score =   422 bits (1085),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/234 (86%), Positives = 222/234 (95%), Gaps = 0/234 (0%)
 Frame = -1

Query  877  MDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  698
            MDTEFPG+VLRP+GNFK   DY+YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCI
Sbjct  1    MDTEFPGVVLRPLGNFKYICDYNYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCI  60

Query  697  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHW  518
            WQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHW
Sbjct  61   WQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHW  120

Query  517  VTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLA  338
            VTFHSGYDFGYLLK+LTCQ LP+TQ GFF+LIN+YFP ++DIKHLM+FCNSL+GGLNKLA
Sbjct  121  VTFHSGYDFGYLLKLLTCQNLPDTQVGFFSLINIYFPTLYDIKHLMKFCNSLYGGLNKLA  180

Query  337  ELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            ELLEVERVG+CHQAGSDSLLT+CTF KLK+NFFSGSLE+YSGVLYGLGVENGQ+
Sbjct  181  ELLEVERVGICHQAGSDSLLTSCTFMKLKENFFSGSLEKYSGVLYGLGVENGQS  234



>ref|XP_004287117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   422 bits (1084),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 197/271 (73%), Positives = 238/271 (88%), Gaps = 0/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS + KSD + IREVW+ N++ EF+LIR +VD+YP+IAMDTEFPGIV R +G FKNS DY
Sbjct  1    MSFVMKSDDVLIREVWNDNVDAEFELIRNIVDEYPYIAMDTEFPGIVSRALGTFKNSFDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLTFSDE GNLPTCGTDKYC+WQFNF  F+ NED++A +SIEL
Sbjct  61   NYQTLKLNVDLLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFCNFNLNEDMYAPESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L   G+DF+KN E GI+ARRF ELLM+SGIVLN++V WVTFHSGYDFGYLLK+LTC++LP
Sbjct  121  LTHSGMDFKKNNEKGIDARRFSELLMTSGIVLNENVVWVTFHSGYDFGYLLKLLTCKDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            ++Q  FF LIN+YFP+++D+KHLMRFCNSLHGGLNKLAELL+VERVG+ HQAGSDSLLT+
Sbjct  181  DSQTKFFELINLYFPKIYDVKHLMRFCNSLHGGLNKLAELLDVERVGISHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
             TF KLK+NFFSGS ++Y+GVLYGLG+E G 
Sbjct  241  FTFMKLKNNFFSGSPKKYAGVLYGLGIEYGH  271



>ref|NP_196657.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LEU4.1|CAF1J_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 10 [Arabidopsis 
thaliana]
 emb|CAB96851.1| CCR4-ASSOCIATED FACTOR-like protein [Arabidopsis thaliana]
 gb|AAN13040.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AED91615.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=277

 Score =   419 bits (1076),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 232/272 (85%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             +FRKLK+ +F GS E+Y+GVLYGLGVE+G  
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVEDGTT  272



>ref|XP_002871445.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47704.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   418 bits (1075),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 232/272 (85%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             +FRKLK+ +F GS E+Y+GVLYGLGVE+G  
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVEDGTT  272



>ref|XP_002309331.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
 gb|EEE92854.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
Length=269

 Score =   417 bits (1072),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 197/269 (73%), Positives = 229/269 (85%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS++   D + IR+VW YNLE+EF LI  +VDD+P+IAMDTEFPGIVLRPVG+ K   DY
Sbjct  1    MSVVHNKDLVVIRDVWKYNLEKEFKLILNIVDDFPYIAMDTEFPGIVLRPVGSVKTGSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLT SDEKGNLPTCGTDKYC+WQFNF +F+PNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF KN E G +A RF ELLM+SGIVLND VHWVTFHSGYDFGYLLK+LT ++LP
Sbjct  121  LSQSGIDFVKNAEVGADATRFTELLMTSGIVLNDDVHWVTFHSGYDFGYLLKMLTGKKLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF LI +YFP ++DIKHLM+FCN LHGGLNKLAE L V+R+G+ HQAGSDSLLT+
Sbjct  181  DTQVDFFKLIKIYFPVLYDIKHLMKFCNGLHGGLNKLAEQLGVKRIGISHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             TF KLK+ FFSGS E Y+GVLYGLGVEN
Sbjct  241  STFMKLKEIFFSGSPERYAGVLYGLGVEN  269



>ref|XP_010419649.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010419650.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=277

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 230/272 (85%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLP CGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPKCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSGIV+ND + WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNVEKGIDVVRFGELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT 
Sbjct  181  LKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             +FRKLK+ +F GS E+Y+GVLYGLGVE+G  
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVEDGTT  272



>ref|XP_006286536.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
 gb|EOA19434.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
Length=282

 Score =   416 bits (1070),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 194/270 (72%), Positives = 232/270 (86%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLNDS+ WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNIEKGIDVVRFGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIK+LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LKQADFFKLLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
             +FRKLK+ +F GS E+Y+GVLYGLGVE+G
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVEDG  270



>gb|AAK92792.1| putative CCR4-associated factor [Arabidopsis thaliana]
Length=277

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/272 (71%), Positives = 231/272 (85%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             +FRK K+ +F GS E+Y+GVLYGLGVE+G  
Sbjct  241  GSFRKPKERYFPGSTEKYTGVLYGLGVEDGTT  272



>ref|XP_011033459.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=269

 Score =   415 bits (1067),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 195/269 (72%), Positives = 231/269 (86%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+    D + IR+VW+YNLE+EF+LI  +VDD+P+IAMDTEFPGIVLRPVG+ K   DY
Sbjct  1    MSVQDNKDLVVIRDVWNYNLEKEFELILNIVDDFPYIAMDTEFPGIVLRPVGSVKTGSDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLK NVD+LKLIQLGLT SDEKGNLPTCGTDKYC+WQFNF +F+PNEDV+A+DSIEL
Sbjct  61   NYQTLKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L Q GIDF KN E G +A RF ELLM+SGIVLND+VHWVTFHSGYDFGYLLK+LT ++LP
Sbjct  121  LSQSGIDFVKNAEDGADATRFTELLMTSGIVLNDNVHWVTFHSGYDFGYLLKMLTGKKLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            +TQ  FF LI +YFP ++DIKHLM+FCN LHGGLNKLAE L V+R+G+ HQAGSDSLLT+
Sbjct  181  DTQADFFNLIKIYFPVLYDIKHLMKFCNGLHGGLNKLAEQLGVKRIGISHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             TF +LK+ FFSGS E Y+GVLYGLGV+N
Sbjct  241  STFMRLKEIFFSGSPERYAGVLYGLGVDN  269



>ref|XP_006399590.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 ref|XP_006399591.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41043.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41044.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
Length=277

 Score =   416 bits (1068),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 192/272 (71%), Positives = 230/272 (85%), Gaps = 0/272 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVW  NL EEF LIRE+VD Y +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWSENLVEEFALIREIVDKYSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ LP
Sbjct  121  LRQCGIDFKKNVEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKALP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  VKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
             +FRKLK+ +F+GS E+Y+GVLYGLGVE+G  
Sbjct  241  GSFRKLKERYFTGSTEKYTGVLYGLGVEDGTT  272



>ref|XP_010453129.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010453130.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=278

 Score =   415 bits (1066),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 230/270 (85%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSGIV+ND + WVTFH GYDFGYL+K+L C+ELP
Sbjct  121  LRQCGIDFKKNVEKGIDVVRFGELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLICKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
             +FRKLK+ +F GS E+Y+GVLYGLGVE+G
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVEDG  270



>ref|XP_010491786.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=279

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/269 (72%), Positives = 229/269 (85%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVWDYNL EEF LIRE+VD + +IAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWDYNLVEEFALIREIVDKFSYIAMDTEFPGVVLKPVATFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED+FAS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIFASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGELLMSSGIV+ND + WVTFH GYDFGYL+K+L C+ELP
Sbjct  121  LRQCGIDFKKNVEKGIDVVRFGELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLICKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT 
Sbjct  181  LKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             +FRKLK+ +F GS E+Y+GVLYGLGVE+
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVED  269



>ref|XP_004954218.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=287

 Score =   414 bits (1064),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/279 (70%), Positives = 231/279 (83%), Gaps = 6/279 (2%)
 Frame = -1

Query  1000 DWKMSLLPKSD-----SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  836
            D   +++PK D     S++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG
Sbjct  5    DPTAAVIPKPDGGDDESVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVG  64

Query  835  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNED  659
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G D+  C+WQFNFREFD   D
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGADRRRCVWQFNFREFDDARD  124

Query  658  VFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLL  479
            +FASDSIELLR+ GIDF +N E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLL
Sbjct  125  IFASDSIELLRRSGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLL  184

Query  478  KILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQ  299
            KILTC  LP+TQ GFF L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQ
Sbjct  185  KILTCNSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQ  244

Query  298  AGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            AGSDSL+T+C F KLKD+FF+GS E+Y+GVLYGL  ENG
Sbjct  245  AGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENG  283



>emb|CDX70376.1| BnaC03g04600D [Brassica napus]
Length=276

 Score =   413 bits (1062),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 232/270 (86%), Gaps = 0/270 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVW+ NL EEF LIRE+VD + ++AMDTEFPG+VL+PV  FK+++D 
Sbjct  1    MAETLKEDSITIREVWNDNLLEEFALIREIVDKFTYVAMDTEFPGVVLKPVETFKHNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCGTDK+C+WQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN ESGI+  RFGEL+MSSGIVLNDS+ WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNVESGIDVARFGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT 
Sbjct  181  VKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
             +FRKLK+ +F GS E Y+GVLYGLGVE+G
Sbjct  241  GSFRKLKERYFPGSTERYTGVLYGLGVEDG  270



>emb|CDX69796.1| BnaA10g21450D [Brassica napus]
Length=278

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/269 (72%), Positives = 231/269 (86%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVW+ NL EEF LIRE+VD YPFIAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWNNNLLEEFALIREIVDKYPFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLNDS+ W+TFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNVEKGIDVVRFGELMMSSGIVLNDSISWITFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF ++ +YFP V+DIK+LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LRQADFFKMLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             +FRKLK+ +F GS E+Y+GVLYGLGVE+
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVED  269



>ref|XP_009122009.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 ref|XP_009122010.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
Length=280

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 193/269 (72%), Positives = 231/269 (86%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVW+ NL EEF LIRE+VD YPFIAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWNNNLVEEFALIREIVDKYPFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSGIVLNDS+ W+TFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNVERGIDVVRFGELMMSSGIVLNDSISWITFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF ++ +YFP V+DIK+LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LRQADFFKMLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             +FRKLK+ +F GS E+Y+GVLYGLGVE+
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVED  269



>gb|ACL53982.1| unknown [Zea mays]
 gb|AFW73867.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=287

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 195/279 (70%), Positives = 230/279 (82%), Gaps = 6/279 (2%)
 Frame = -1

Query  1000 DWKMSLLPKSD-----SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  836
            D   +++PK D     S++IREVW  NLEEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  5    DLTATVIPKPDGADDESVEIREVWADNLEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  64

Query  835  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNED  659
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G  +  C+WQFNFREFD   D
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDARD  124

Query  658  VFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLL  479
            +FASDSIELLR+ GIDF +N E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLL
Sbjct  125  IFASDSIELLRRSGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLL  184

Query  478  KILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQ  299
            KILTC  LP+TQ GFF L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQ
Sbjct  185  KILTCNSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQ  244

Query  298  AGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            AGSDSL+T+C F KLKD+FF+GS E+Y+GVLYGL  ENG
Sbjct  245  AGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENG  283



>ref|XP_002452981.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
 gb|EES05957.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
Length=288

 Score =   412 bits (1059),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 194/280 (69%), Positives = 230/280 (82%), Gaps = 7/280 (3%)
 Frame = -1

Query  1000 DWKMSLLPKSD------SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPV  839
            D   +++PK D      S++IREVW  NLEEEF LIR++VD++PF+AMDTEFPGIV RPV
Sbjct  5    DLTATMIPKPDEADDDESVEIREVWADNLEEEFALIRDIVDEFPFVAMDTEFPGIVCRPV  64

Query  838  GNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNE  662
            G F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G  +  C+WQFNFREFD   
Sbjct  65   GAFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDAR  124

Query  661  DVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYL  482
            D+FASDSIELLR+ GIDF +N E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYL
Sbjct  125  DIFASDSIELLRRSGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYL  184

Query  481  LKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCH  302
            LKILTC  LP+TQ GFF L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  H
Sbjct  185  LKILTCSSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESH  244

Query  301  QAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            QAGSDSL+T+C F KLKD+FF+GS E+Y+GVLYGL  ENG
Sbjct  245  QAGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENG  284



>ref|XP_001766532.1| predicted protein [Physcomitrella patens]
 gb|EDQ68597.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   410 bits (1054),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 234/269 (87%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS++    S++IREVW  NLE+EF+LIR++VD+YP++AMDTEFPG+V+RPVG FKNS +Y
Sbjct  1    MSIVANGGSLRIREVWADNLEDEFELIRDIVDEYPYVAMDTEFPGVVVRPVGTFKNSAEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTL+ NVDMLKLIQLGLTFSDE G LP CG+   C+WQFNFREF+  EDV+A DSIEL
Sbjct  61   HYQTLRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF++N E GI+++RFGELLMSSGIVLN++VHW+TFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDFQRNEERGIDSQRFGELLMSSGIVLNENVHWITFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             ++  FF L+  YFP ++DIK+LM+FC++LHGGLN+LAE L+VER+G CHQAGSDSLLT+
Sbjct  181  TSEDEFFNLMRTYFPTLYDIKYLMKFCDNLHGGLNRLAETLDVERIGPCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             TFRKLKD FF+GS E+Y+GVL+GLG +N
Sbjct  241  RTFRKLKDGFFNGSTEKYAGVLFGLGSDN  269



>ref|XP_001755261.1| predicted protein [Physcomitrella patens]
 gb|EDQ79741.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   410 bits (1053),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 187/269 (70%), Positives = 234/269 (87%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS++    S++IREVW  NLE+EF+LIR++VD+YP++AMDTEFPG+V+RPVG FKNS +Y
Sbjct  1    MSIVANGGSLRIREVWADNLEDEFELIRDIVDEYPYVAMDTEFPGVVVRPVGTFKNSAEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HYQTL+ NVDMLKLIQLGLTFSDE G LP CG+   C+WQFNFREF+  EDV+A DSIEL
Sbjct  61   HYQTLRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L+Q GIDF++N E GI+++RFGELLMSSGIVLN++VHW+TFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LKQSGIDFQQNEERGIDSQRFGELLMSSGIVLNENVHWITFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
             ++  FF L+  YFP ++DIK+LM+FC++LHGGLN+LAE L+VER+G CHQAGSDSLLT+
Sbjct  181  TSEDEFFNLLRTYFPTLYDIKYLMKFCDNLHGGLNRLAETLDVERIGPCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             TFRKLKD FF+GS E+Y+GVL+GLG +N
Sbjct  241  RTFRKLKDGFFNGSTEKYAGVLFGLGSDN  269



>emb|CDX97069.1| BnaC09g45560D [Brassica napus]
Length=280

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/269 (71%), Positives = 230/269 (86%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVW+ NL EEF LIRE+VD Y FIAMDTEFPG+VL+PV  FK ++D 
Sbjct  1    MAETLKEDSIMIREVWNDNLLEEFALIREIVDKYTFIAMDTEFPGVVLKPVETFKYNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +Y+TLK+NVD+LKLIQLGLTFSDE GNLPTCGTDK+C+WQFNFREF+  ED++AS+SIEL
Sbjct  61   NYRTLKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQCGIDF+KN E GI+  RFGEL+MSSG+VLNDS+ WVTFH GYDFGYL+K+LTC+ELP
Sbjct  121  LRQCGIDFKKNVERGIDVVRFGELMMSSGVVLNDSISWVTFHGGYDFGYLVKLLTCKELP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              Q  FF ++ +YFP V+DIK+LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT 
Sbjct  181  LKQADFFKMLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTL  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
             +FRKLK+ +F GS E+Y+GVLYGLGVE+
Sbjct  241  GSFRKLKERYFPGSTEKYTGVLYGLGVED  269



>gb|EEC74173.1| hypothetical protein OsI_09281 [Oryza sativa Indica Group]
Length=295

 Score =   406 bits (1043),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 223/263 (85%), Gaps = 1/263 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  28   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  87

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GI
Sbjct  88   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGI  147

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF +N+E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GF
Sbjct  148  DFRRNSERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGF  207

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KL
Sbjct  208  FKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKL  267

Query  253  KDNFFSGSLEEYSGVLYGLGVEN  185
            KD+FF+GS E+Y+GVLYGL  EN
Sbjct  268  KDSFFAGSTEKYAGVLYGLNAEN  290



>dbj|BAD19081.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19282.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
Length=293

 Score =   406 bits (1043),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 223/263 (85%), Gaps = 1/263 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  26   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  85

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GI
Sbjct  86   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGI  145

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF +N+E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GF
Sbjct  146  DFRRNSERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGF  205

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KL
Sbjct  206  FKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKL  265

Query  253  KDNFFSGSLEEYSGVLYGLGVEN  185
            KD+FF+GS E+Y+GVLYGL  EN
Sbjct  266  KDSFFAGSTEKYAGVLYGLNAEN  288



>ref|NP_001048387.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAF10301.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAG88128.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99633.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57976.1| hypothetical protein OsJ_08719 [Oryza sativa Japonica Group]
Length=295

 Score =   405 bits (1042),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 223/263 (85%), Gaps = 1/263 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLEEEF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  28   EPVEIREVWADNLEEEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  87

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GI
Sbjct  88   NVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGI  147

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF +N+E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GF
Sbjct  148  DFRRNSERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGF  207

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KL
Sbjct  208  FKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKL  267

Query  253  KDNFFSGSLEEYSGVLYGLGVEN  185
            KD+FF+GS E+Y+GVLYGL  EN
Sbjct  268  KDSFFAGSTEKYAGVLYGLNAEN  290



>ref|XP_009131188.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 emb|CDX78405.1| BnaA03g03170D [Brassica napus]
Length=278

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 192/271 (71%), Positives = 230/271 (85%), Gaps = 1/271 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   K DSI IREVW+ NL EEF LIRE+VD + ++AMDTEFPG+VL+PV  FK+++D 
Sbjct  1    MAETLKEDSITIREVWNDNLLEEFALIREIVDKFTYVAMDTEFPGVVLKPVETFKHNNDL  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            +Y+TLK+NVD+LKLIQ+GLTFSDE GNLPTCG D K+C+WQFNFREF+  ED++AS+SIE
Sbjct  61   NYRTLKENVDLLKLIQVGLTFSDEDGNLPTCGADDKFCVWQFNFREFNIGEDIYASESIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQCGIDF+KN E GI+  RFGEL+MSSGIVLNDS+ WVTFH GYDFGYL+K+LTC+EL
Sbjct  121  LLRQCGIDFKKNLERGIDVARFGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKEL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P  Q  FF L+ +YFP V+DIKHLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT
Sbjct  181  PIKQADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
              +FRKLK+ +F GS E YSGVLYGLGVE+G
Sbjct  241  LGSFRKLKERYFPGSTERYSGVLYGLGVEDG  271



>dbj|BAJ92910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   402 bits (1033),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 187/264 (71%), Positives = 219/264 (83%), Gaps = 1/264 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLE EF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK 
Sbjct  22   EPVEIREVWADNLEAEFALIRDVVDEFPFVAMDTEFPGIVCRPVGAFRSPADYNYATLKA  81

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NVDML LIQLGLTFS   G LP  G  +  C+WQFNFREFD   D+FA+DSIELLR  GI
Sbjct  82   NVDMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGI  141

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF +N E G++ARRF ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GF
Sbjct  142  DFRRNAERGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGF  201

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T C F KL
Sbjct  202  FKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTPCAFWKL  261

Query  253  KDNFFSGSLEEYSGVLYGLGVENG  182
            KD+FF+GS E+Y+GVLYGL  ENG
Sbjct  262  KDSFFAGSTEKYAGVLYGLNAENG  285



>ref|NP_001136747.1| uncharacterized protein LOC100216888 [Zea mays]
 gb|ACF82526.1| unknown [Zea mays]
 gb|AFW64146.1| hypothetical protein ZEAMMB73_273082 [Zea mays]
Length=287

 Score =   400 bits (1028),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 190/277 (69%), Positives = 226/277 (82%), Gaps = 6/277 (2%)
 Frame = -1

Query  1000 DWKMSLLPK-----SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  836
            D   +++PK      +S++IREVW  N+EEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  5    DLTATVIPKLGEADDESVEIREVWADNMEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  64

Query  835  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNED  659
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G  +  C+WQFNFREFD   D
Sbjct  65   AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFDDARD  124

Query  658  VFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLL  479
            +FASDSIELLR+ GID   N E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLL
Sbjct  125  IFASDSIELLRRSGIDLRLNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLL  184

Query  478  KILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQ  299
            KILTC  LP+TQ GFF L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQ
Sbjct  185  KILTCNCLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQ  244

Query  298  AGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            AGSDSL+T+C F KLKD+FF+GS E+Y+GVLYGL  E
Sbjct  245  AGSDSLVTSCAFWKLKDSFFTGSTEKYAGVLYGLNAE  281



>dbj|BAK01540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   399 bits (1026),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 183/268 (68%), Positives = 222/268 (83%), Gaps = 1/268 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K D ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWAENLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTFKSNADFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLTFSDE+G LP  G D + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF ++   G ++RRF ELLMSSG+VLN  +HWVTFHSGYDFGYLLK+LT   LP+T  
Sbjct  128  GIDFARHAAEGADSRRFAELLMSSGVVLNAEIHWVTFHSGYDFGYLLKLLTGSNLPDTSS  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP ++DIKHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F 
Sbjct  188  GFFDLIRIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFN  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLK+++F G  E+Y+GVLYGLG E G+ 
Sbjct  248  KLKESYFGGLTEKYAGVLYGLGTEGGET  275



>ref|XP_003570299.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=295

 Score =   399 bits (1026),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 186/262 (71%), Positives = 218/262 (83%), Gaps = 1/262 (0%)
 Frame = -1

Query  964  IQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNV  785
            ++IREVW  NLE EF LIR+VVD++PF+AMDTEFPGIV RPVG F++  DY+Y TLK NV
Sbjct  30   VEIREVWADNLEAEFALIRDVVDEFPFVAMDTEFPGIVCRPVGVFRSPADYNYATLKANV  89

Query  784  DMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDF  608
            DML LIQLGLTFS   G LP  G  +  C+WQFNFREFD   D+FA+DSIELLR  GI+F
Sbjct  90   DMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDARDIFATDSIELLRHSGINF  149

Query  607  EKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFA  428
              N E G++ARRF ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GFF 
Sbjct  150  RLNAERGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFK  209

Query  427  LINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKD  248
            L+ +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD
Sbjct  210  LMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKD  269

Query  247  NFFSGSLEEYSGVLYGLGVENG  182
            +FF+GS E+Y+GVLYGL  ENG
Sbjct  270  SFFAGSTEKYAGVLYGLNAENG  291



>ref|XP_002460215.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
 gb|EER96736.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
Length=279

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/268 (68%), Positives = 220/268 (82%), Gaps = 1/268 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K + ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K + +++Y TL
Sbjct  8    KPEDVEIREVWADNLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKTAAEFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLTFSDE G LP  G D + C+WQFNFR FDP  DV ASDSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDEHGGLPALGADGRPCVWQFNFRGFDPRTDVAASDSIDLLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF ++   G +ARRF ELLMSSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP+T  
Sbjct  128  GIDFSRHAADGADARRFAELLMSSGVVLNSDVHWVTFHSGYDFGYLLKLLTGTNLPDTMS  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP ++DIKHLMRFCNSLHGGLNKLAELL+V RVG+CHQAGSDSLLTA +F+
Sbjct  188  GFFDLIKIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLK+ +F+G  E+Y+GVLYGLG E G+ 
Sbjct  248  KLKEAYFNGLTEKYAGVLYGLGFEGGET  275



>ref|NP_001063181.1| Os09g0416800 [Oryza sativa Japonica Group]
 dbj|BAD28924.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD29264.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAF25095.1| Os09g0416800 [Oryza sativa Japonica Group]
 gb|EAZ09108.1| hypothetical protein OsI_31373 [Oryza sativa Indica Group]
 gb|EAZ44741.1| hypothetical protein OsJ_29372 [Oryza sativa Japonica Group]
 dbj|BAG89495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94386.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   394 bits (1012),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 182/268 (68%), Positives = 224/268 (84%), Gaps = 1/268 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K D ++IREVW+ NLE EF +IRE+VDD+P++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWEDNLEAEFAVIREIVDDFPYVAMDTEFPGVVCRPLGTFKSNADFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLTFS+E G LP+ G + + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSNEHGGLPSLGPEGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF +++  G +ARRF ELLMSSG+V+N  V WVTFHSGYDFGYLLK+LT   LP+T  
Sbjct  128  GIDFTRHSADGADARRFAELLMSSGVVMNSEVRWVTFHSGYDFGYLLKLLTGTYLPDTIT  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP V+DIKHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F+
Sbjct  188  GFFDLIRIYFPVVYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLK+ +F+G  E+Y+GVLYGLG E G+ 
Sbjct  248  KLKEAYFNGLTEKYAGVLYGLGTEGGET  275



>gb|ABK21469.1| unknown [Picea sitchensis]
Length=236

 Score =   391 bits (1005),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 212/234 (91%), Gaps = 0/234 (0%)
 Frame = -1

Query  877  MDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  698
            MDTEFPGIV+RPVGNFK + ++HY TLK NVD+L LIQLGLTFSDE GNLP CGTDKYCI
Sbjct  1    MDTEFPGIVVRPVGNFKTASEFHYYTLKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCI  60

Query  697  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHW  518
            WQFNFREF+ ++D++ASDSIELL+Q GIDF+KN E GI+A+ F ELLMSSGIVLND+VHW
Sbjct  61   WQFNFREFNLDKDMYASDSIELLQQSGIDFKKNNEKGIDAQVFAELLMSSGIVLNDTVHW  120

Query  517  VTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLA  338
            VTFHSGYDFGYLLK+LTCQ+LP T+ GFF LINMYFP V+DIKHLM+FCNSL+GGLNKLA
Sbjct  121  VTFHSGYDFGYLLKLLTCQQLPPTRAGFFKLINMYFPTVYDIKHLMKFCNSLYGGLNKLA  180

Query  337  ELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            ELL+V+R+GVCHQAGSDSLLT+C FRKL++ FF+GS E+Y+GVLYGL +E+GQ 
Sbjct  181  ELLDVKRIGVCHQAGSDSLLTSCAFRKLREGFFNGSTEKYAGVLYGLALEHGQT  234



>ref|XP_010541577.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X2 [Tarenaya hassleriana]
Length=238

 Score =   390 bits (1003),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -1

Query  877  MDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  698
            MDTEFPG+VLRP+G FKN  +Y+Y+TLK+NVDMLKLIQLGLTFSDE GNLPTCGTDK+CI
Sbjct  1    MDTEFPGVVLRPLGPFKNISEYNYKTLKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCI  60

Query  697  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHW  518
            WQFNFREF+P+ED++ ++SI+LL QCGIDF+KN E GI+ +RFGELLMSSG+VLND++ W
Sbjct  61   WQFNFREFNPSEDIYVNESIDLLHQCGIDFKKNNEKGIDVKRFGELLMSSGVVLNDAMRW  120

Query  517  VTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLA  338
            VTFHSGYDFGYLLK+LTC+ LP  Q  FF L+N+YFP ++DIKH+M+FCN+LHGGL+KLA
Sbjct  121  VTFHSGYDFGYLLKLLTCKALPVNQIEFFTLLNIYFPVIYDIKHMMKFCNNLHGGLSKLA  180

Query  337  ELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            ELLEVERVGV HQAGSDSLLT CTFRKLK++FF GS+++Y+GVLYGLGVENGQN
Sbjct  181  ELLEVERVGVSHQAGSDSLLTWCTFRKLKESFFKGSMKKYAGVLYGLGVENGQN  234



>ref|XP_006660627.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=280

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/268 (68%), Positives = 222/268 (83%), Gaps = 1/268 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K D ++IREVW  NLE EF +IR++VD +P++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDGVEIREVWADNLEAEFLVIRDIVDRFPYVAMDTEFPGVVCRPLGTFKSAADFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLTFSDE+G LP  G + + C+WQFNFR FDP  DV ASDSIELLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPEGRPCVWQFNFRGFDPRNDVAASDSIELLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF +++  G +A RF ELLMSSG+VLN  V WVTFHSGYDFGYLLK++T   LP+T  
Sbjct  128  GIDFARHSADGADACRFAELLMSSGVVLNSEVRWVTFHSGYDFGYLLKLITGTNLPDTIS  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP V+DIKHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F+
Sbjct  188  GFFDLIRIYFPVVYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLK+++F+G  E+Y+GVLYGLG E G+ 
Sbjct  248  KLKESYFNGLTEKYAGVLYGLGTEGGET  275



>ref|XP_006648046.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=297

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 213/256 (83%), Gaps = 1/256 (0%)
 Frame = -1

Query  946  WDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLI  767
            W  NLE+EF LIR+VVD +PF+AMDTEFPGIV RPVG F++S DY+Y TLK NVDML LI
Sbjct  38   WADNLEKEFALIRDVVDKFPFVAMDTEFPGIVCRPVGAFRSSADYNYATLKANVDMLHLI  97

Query  766  QLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTES  590
            QLGLTFS  +G LP  G  +  C+WQFNFREFD   D+FASDSIELLR+ GIDF +N E 
Sbjct  98   QLGLTFSGPRGELPVMGDGRRRCVWQFNFREFDDAHDIFASDSIELLRRSGIDFRRNAER  157

Query  589  GIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYF  410
            G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ  FF L+ +YF
Sbjct  158  GVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQASFFKLMKIYF  217

Query  409  PEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGS  230
            P V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDS +T+C F KLKD+FF GS
Sbjct  218  PTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSFVTSCAFWKLKDSFFGGS  277

Query  229  LEEYSGVLYGLGVENG  182
             E+Y+GVLYGL  +NG
Sbjct  278  TEKYAGVLYGLNADNG  293



>gb|KJB06631.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=235

 Score =   385 bits (989),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = -1

Query  859  GIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFR  680
            G+VLRPVG FKN  DY+YQTLK NVDMLKLIQLGLTFSD  GNLPTCGTD +CIWQFNFR
Sbjct  7    GVVLRPVGTFKNVSDYNYQTLKGNVDMLKLIQLGLTFSDANGNLPTCGTDNFCIWQFNFR  66

Query  679  EFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSG  500
            EF+ +ED+F SDSIELL QCGIDF+KN E GI+ +RFGELLMSSGIVLND VHWVTFHSG
Sbjct  67   EFNISEDIFVSDSIELLLQCGIDFKKNNEKGIDVKRFGELLMSSGIVLNDDVHWVTFHSG  126

Query  499  YDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVE  320
            YDFGYLLK+LTC+ LP++Q GFF LI +YFP V+DIKH+M+FCN LHGGLNKLAELLEVE
Sbjct  127  YDFGYLLKLLTCRSLPDSQTGFFKLIKLYFPMVYDIKHMMKFCNGLHGGLNKLAELLEVE  186

Query  319  RVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            RVGVCHQAGSDSLLT+CTFRKL+DNFF  S+++Y+GVLYGL VE GQN
Sbjct  187  RVGVCHQAGSDSLLTSCTFRKLRDNFFK-SVQKYAGVLYGLEVEGGQN  233



>ref|XP_003578122.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=279

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/268 (68%), Positives = 221/268 (82%), Gaps = 1/268 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K D ++IREVW  NLE EF +IRE+VDDYP++AMDTEFPG+V RP+G FK++ D++Y TL
Sbjct  8    KPDDVEIREVWAENLEAEFAVIREIVDDYPYVAMDTEFPGVVCRPLGTFKSAADFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLTFSDE+G LP  G   + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDERGGLPALGPGGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF ++   G ++RRF ELLMSSG+V+N  +HWVTFHSGYDFGYLLK+LT   LP+T  
Sbjct  128  GIDFARHAADGADSRRFAELLMSSGVVMNAEIHWVTFHSGYDFGYLLKLLTGTNLPDTNS  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP ++DIKHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F 
Sbjct  188  GFFDLIRIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFN  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLK+++F G  E+Y+GVLYGLG E G+ 
Sbjct  248  KLKESYFGGLTEKYAGVLYGLGTEGGET  275



>ref|XP_002965900.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
 ref|XP_002983145.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ15954.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ33320.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
Length=274

 Score =   384 bits (986),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/270 (67%), Positives = 225/270 (83%), Gaps = 5/270 (2%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS + K  +++IREVW  NLEEEF LIRE+VDD+P++AMDTEFPG+V+RP+G FK     
Sbjct  1    MSAVSKGTTLRIREVWAENLEEEFKLIREIVDDFPYLAMDTEFPGVVVRPIG-FKAGT--  57

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYC-IWQFNFREFDPNEDVFASDSIE  635
             YQ L+ NVD+LKLIQLGLTFSDE GNLPT G+ +   +WQFNFREF+  EDV+A DSIE
Sbjct  58   -YQMLRANVDLLKLIQLGLTFSDEDGNLPTFGSTRESYLWQFNFREFNIKEDVYAHDSIE  116

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL+Q GIDF+KN E GI+A RFGELLMSSG++LN+SVHW+TFHSGYDFGYLLK+LTCQ L
Sbjct  117  LLKQSGIDFQKNQEHGIDAERFGELLMSSGVILNESVHWITFHSGYDFGYLLKLLTCQNL  176

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P ++  FF L+ +YFP ++D+K+LM+FC++LHGGLN+LAE+LEVERVG CHQAGSDSLLT
Sbjct  177  PPSEADFFVLLRIYFPTIYDVKYLMKFCDNLHGGLNRLAEVLEVERVGPCHQAGSDSLLT  236

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
            +C F+KLK     GS E+Y+GVL+GLG +N
Sbjct  237  SCAFQKLKKGALKGSTEKYAGVLFGLGADN  266



>ref|XP_006665053.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=300

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/256 (70%), Positives = 212/256 (83%), Gaps = 1/256 (0%)
 Frame = -1

Query  946  WDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLI  767
            W  NLE+EF LIR+VVD +PF+AMDTEFP IV RP+G F++S DY+Y TLK NVDML LI
Sbjct  41   WADNLEKEFVLIRDVVDGFPFVAMDTEFPSIVCRPIGAFRSSADYNYATLKANVDMLHLI  100

Query  766  QLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTES  590
            QLGLTFS  +G LP  G D+  C+WQFNF EFD   D+FASDSIELLR+ G+DF +N E 
Sbjct  101  QLGLTFSGPRGELPALGDDRRRCVWQFNFCEFDDARDIFASDSIELLRRSGLDFRRNAEC  160

Query  589  GIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYF  410
            G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YF
Sbjct  161  GVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQVGFFKLMKIYF  220

Query  409  PEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGS  230
            P  +DIKHL++FCNSLHGGLNKLAELL+VERVG  HQAGSDS +T+C F KLKD+FF GS
Sbjct  221  PTFYDIKHLIKFCNSLHGGLNKLAELLDVERVGESHQAGSDSFVTSCAFWKLKDSFFGGS  280

Query  229  LEEYSGVLYGLGVENG  182
             E+Y+GVLYGL  ENG
Sbjct  281  TEKYAGVLYGLNAENG  296



>ref|NP_001132298.1| CCR4-NOT transcription complex subunit 7 isoform 1 [Zea mays]
 gb|ACF81091.1| unknown [Zea mays]
 gb|ACG42346.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 tpg|DAA61464.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 1 [Zea 
mays]
 tpg|DAA61465.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 2 [Zea 
mays]
Length=279

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/265 (66%), Positives = 217/265 (82%), Gaps = 1/265 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K + ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K++ +++Y TL
Sbjct  8    KPEDVEIREVWADNLETEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKSAAEFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLT SDE G LP  G D + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTLSDEHGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF ++   G+++R F ELLMSSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP+T  
Sbjct  128  GIDFSRHAADGVDSRCFAELLMSSGVVLNSDVHWVTFHSGYDFGYLLKLLTGTNLPDTLP  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP ++DIKHLMRF NSLHGGLNKLAELL+V RVG+CHQAGSDSLLTA +F+
Sbjct  188  GFFDLIKIYFPVIYDIKHLMRFSNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVEN  185
            KLK+ +F+G  E+Y+GVLYGLG E 
Sbjct  248  KLKEAYFNGLTEKYAGVLYGLGFEG  272



>ref|XP_004956826.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=279

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/268 (67%), Positives = 219/268 (82%), Gaps = 1/268 (0%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K D ++IREVW  NLE EF +IR++VDDYP++AMDTEFPG+V RP+G +K++ +++Y TL
Sbjct  8    KPDDVEIREVWADNLEAEFAVIRDIVDDYPYVAMDTEFPGVVCRPLGTYKSAAEFNYATL  67

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            K NVDMLKLIQLGLTFSDE G LP  G   + C+WQFNFR FDP  DV A+DSI+LLR+ 
Sbjct  68   KANVDMLKLIQLGLTFSDEHGGLPALGPGGRPCVWQFNFRGFDPRTDVAAADSIDLLRRS  127

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF ++   G +ARRF ELLMSSG+V+N  V WVTFHSGYDFGYLLK+LT   LP+T  
Sbjct  128  GIDFARHGADGADARRFAELLMSSGVVMNSDVRWVTFHSGYDFGYLLKLLTGTNLPDTMS  187

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            GFF LI +YFP ++DIKHLMRFCNSLHGGLNKLAELL+V RVG+CHQAGSDSLLTA +F+
Sbjct  188  GFFDLIKIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSFK  247

Query  259  KLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            KLK+ +F+G  E+Y+GVLYGLG E G+ 
Sbjct  248  KLKEAYFNGLTEKYAGVLYGLGFEGGET  275



>gb|KHN38030.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=272

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 217/272 (80%), Gaps = 9/272 (3%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            +L KSDSIQIREVW+ NLEEEF LIRE+VD+YP+IAMDTE              S     
Sbjct  4    ILAKSDSIQIREVWNDNLEEEFALIREIVDNYPYIAMDTETTSTCSNSSNWASPSPTSTA  63

Query  805  QTLKDNVDMLKLIQLGLTFS---DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIE  635
               +   +  +      TF+   DE+ +  TC     CIWQFNFREF+ NEDVFA+DSIE
Sbjct  64   TFPRAATNPARAASGNSTFANSTDEESD--TC----CCIWQFNFREFNVNEDVFANDSIE  117

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ GIDF++N E+GI+A RFGELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTCQ+L
Sbjct  118  LLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQDL  177

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDSLLT
Sbjct  178  PDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLLT  237

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            +CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  238  SCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  269



>ref|XP_010048148.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80311.1| hypothetical protein EUGRSUZ_C01670 [Eucalyptus grandis]
Length=281

 Score =   374 bits (961),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/273 (65%), Positives = 220/273 (81%), Gaps = 2/273 (1%)
 Frame = -1

Query  994  KMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLR--PVGNFKNS  821
            KM +    +S+ IREVW++NLEEEF LI E+VD + ++A+D EFPG+V R   + N KN 
Sbjct  5    KMPMPLTDESLVIREVWNHNLEEEFALIGEIVDKFNYVAVDAEFPGVVFRLPSLENIKNM  64

Query  820  DDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDS  641
             DY+YQT+K+NVD LKLIQLGLTF D++GNLPTCGTDKYCIWQFNFR FD  +D F   S
Sbjct  65   RDYNYQTMKNNVDKLKLIQLGLTFLDDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGS  124

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            IE L + GIDF+KN E G+EA RFGELLMSSGI LND V+WVTFH  Y+FG+LLK+LTC+
Sbjct  125  IEWLHERGIDFKKNNEKGVEAERFGELLMSSGIALNDGVNWVTFHGKYNFGFLLKLLTCR  184

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
             LP+T  GF+ LI MYFP V+D+KH+M+FC+ LH  LNKLAELL+VER+GVCHQAGSDSL
Sbjct  185  SLPDTLVGFYDLIKMYFPLVYDVKHMMKFCDGLHCNLNKLAELLDVERLGVCHQAGSDSL  244

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            L AC F+KLKD FF+GS  +Y+G LYGLG+++G
Sbjct  245  LVACAFQKLKDCFFNGSAVKYAGALYGLGIQDG  277



>ref|XP_002981023.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
 gb|EFJ17724.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
Length=285

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/269 (64%), Positives = 218/269 (81%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS  PK  S++IR+VW  NLEEE   IR +VD++P +AMDTEFPG+V+RPVGNF++  +Y
Sbjct  1    MSKFPKGGSLRIRDVWASNLEEEISFIRSIVDEFPLLAMDTEFPGVVVRPVGNFRSCAEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTL++NV+MLKLIQLGLTF D  GNLP C T +YC+WQFNFREF+  EDV A DSI+L
Sbjct  61   NYQTLRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L   GIDF KN E G+++R FGELLMSSG+VLND + W+TFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LCHSGIDFAKNEEQGVDSRLFGELLMSSGVVLNDDIQWITFHSGYDFGYLLKLLTCQPLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              +  FF L+ +YFP  FDIK++M+F +SLHGGLN+LAEL++V R+G CHQAGSDSLLT+
Sbjct  181  ACEADFFNLMRLYFPVFFDIKYMMKFHDSLHGGLNRLAELVDVARIGPCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
              +R+LKD +F  S+ +++GVLYGLG +N
Sbjct  241  EVYRRLKDRYFLESMAKFTGVLYGLGSDN  269



>ref|XP_002982500.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
 gb|EFJ16253.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
Length=287

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/269 (64%), Positives = 218/269 (81%), Gaps = 0/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS  PK  S++IR+VW  NLEEE   IR +VD++P +AMDTEFPG+V+RPVGNF++  +Y
Sbjct  1    MSKFPKGGSLRIRDVWASNLEEEISFIRSIVDEFPLLAMDTEFPGVVVRPVGNFRSCAEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTL++NV+MLKLIQLGLTF D  GNLP C T +YC+WQFNFREF+  EDV A DSI+L
Sbjct  61   NYQTLRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L   GIDF KN E G+++R FGELLMSSG+VLND + W+TFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LCHSGIDFAKNEEQGVDSRLFGELLMSSGVVLNDDIQWITFHSGYDFGYLLKLLTCQPLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
              +  FF L+ +YFP  FDIK++M+F +SLHGGLN+LAEL++V R+G CHQAGSDSLLT+
Sbjct  181  ACEADFFNLMRLYFPVFFDIKYMMKFHDSLHGGLNRLAELVDVARIGPCHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
              +R+LKD +F  S+ +++GVLYGLG +N
Sbjct  241  EVYRRLKDRYFLESMAKFTGVLYGLGSDN  269



>ref|XP_009396102.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   366 bits (939),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 212/269 (79%), Gaps = 1/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M+   ++ +++IR+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MAKTAEAAAVEIRDVWAENLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC-GTDKYCIWQFNFREFDPNEDVFASDSIE  635
            +Y  L+ NVD+L LIQLGLTFSD  GN P    + +  +WQFNFREFD + D+   DSI+
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDADGNFPASPDSARPIVWQFNFREFDVDGDISNPDSID  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LL++ GIDF +N E G++A  F ELLMSSG+VLNDSV WVTFH  YDFGYLLKILTC+ L
Sbjct  121  LLQKSGIDFARNREHGVDANHFAELLMSSGVVLNDSVRWVTFHCAYDFGYLLKILTCRRL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            P+ ++GFF L   +FP V+DIKHLMRF NSLHGGLNK+AE LEV+RVG+CHQAGSDSLLT
Sbjct  181  PDNREGFFELARTFFPVVYDIKHLMRFSNSLHGGLNKVAEQLEVDRVGICHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            A TFRKL D +F GS+E Y+GV+YGL +E
Sbjct  241  AQTFRKLTDKYFDGSIERYAGVMYGLDIE  269



>ref|XP_010932239.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/268 (65%), Positives = 211/268 (79%), Gaps = 3/268 (1%)
 Frame = -1

Query  991  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            MS+  KSD S++IREVW  NLE EF +IRE+VD+YPFIAMDTEFPG+ + PV  FKN  D
Sbjct  1    MSIPAKSDESVEIREVWADNLEVEFAVIREIVDEYPFIAMDTEFPGVAITPVRAFKNISD  60

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDS  641
             HYQTL+ NVD+L LIQ+G+TFSD  G LP    G    C+WQFNFREFDP+ DV   DS
Sbjct  61   QHYQTLRANVDLLHLIQVGITFSDASGCLPPSPSGGGLRCVWQFNFREFDPDRDVSNPDS  120

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            I+LLR+ GIDF KN E GI+A RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+
Sbjct  121  IDLLRRSGIDFVKNREQGIDALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCR  180

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
             LPE+ + FF L+  +FP V+DIKHLMRFCN+L+GGLNK+AE ++ ER+GVCHQAGSDSL
Sbjct  181  RLPESLEEFFELVGAFFPIVYDIKHLMRFCNNLYGGLNKVAEQVDAERIGVCHQAGSDSL  240

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGL  197
            LTA  F +LK+N+F GS+E Y+G LYGL
Sbjct  241  LTARVFWRLKENYFDGSIERYAGCLYGL  268



>ref|NP_001148663.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 gb|ACG32425.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=237

 Score =   362 bits (930),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 196/233 (84%), Gaps = 1/233 (0%)
 Frame = -1

Query  877  MDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-C  701
            MDTEFPGIV RPVG F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G  +  C
Sbjct  1    MDTEFPGIVCRPVGAFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPALGAGRRRC  60

Query  700  IWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVH  521
            +WQFNFREFD   D+FASDSIELLR+ GIDF +N E G++ARRF ELLMSSG+VLNDSV+
Sbjct  61   VWQFNFREFDDARDIFASDSIELLRRSGIDFRRNAERGVDARRFAELLMSSGVVLNDSVY  120

Query  520  WVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKL  341
            WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DIKHLM+FCNSLHGGLNKL
Sbjct  121  WVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKL  180

Query  340  AELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
            AELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+GVLYGL  ENG
Sbjct  181  AELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENG  233



>ref|XP_009418496.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   363 bits (933),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 214/274 (78%), Gaps = 2/274 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS    + +++IR+VW  NLE EF +IRE+VDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKGDDASTVEIRDVWANNLEAEFAVIREIVDDFPFVAMDTEFPGVAVRPLGDFKTVADQ  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGT--DKYCIWQFNFREFDPNEDVFASDSI  638
            +Y  L+ NVD+L LIQLGLTFSD  GNLPT         +WQFNFREFD + DV   DSI
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDADGNLPTSSAAGGHPVVWQFNFREFDVDRDVSNPDSI  120

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            +LL + GID  +N E G++A RF ELLMSSG+VLNDSV WVTFH  YDFGYLLK+LTC+ 
Sbjct  121  DLLIRSGIDLVRNREFGVDAIRFAELLMSSGVVLNDSVSWVTFHCAYDFGYLLKLLTCRR  180

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LP+T++GFF L+  +FP V+DIKHL++F NSLHGGLNK+AE LEVERVG+CHQAGSDSLL
Sbjct  181  LPDTREGFFELVRTFFPVVYDIKHLLKFSNSLHGGLNKVAEQLEVERVGICHQAGSDSLL  240

Query  277  TACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            TA  FRKL  ++F GS+E Y+GV+YGL +E+G N
Sbjct  241  TARAFRKLMGSYFDGSIERYAGVMYGLDIEHGIN  274



>ref|XP_009395282.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 210/269 (78%), Gaps = 1/269 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS    +  ++ R+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKSDDAAGVEFRDVWADNLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            +Y  L+ NVD+L LIQLGLTFSD +GNLP   T  +  +WQFNFREFD + D+   DSI+
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDAEGNLPASATGGRPIVWQFNFREFDVDRDISNPDSID  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLR+  IDF++N E G++A RF ELLM+SG+VLNDSV WVTFH  YDFGYLLKILTC+ L
Sbjct  121  LLRKSDIDFKRNREHGVDANRFAELLMASGVVLNDSVRWVTFHCAYDFGYLLKILTCRRL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PET++GF  LI  +FP ++DIKHLMRF NSLHGGLNKLAE LEV+RVG CHQAGSDSLLT
Sbjct  181  PETREGFSELIRTFFPVMYDIKHLMRFSNSLHGGLNKLAEQLEVDRVGTCHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            A  FRKL +  F GS++ Y+GV+YGL +E
Sbjct  241  ARAFRKLMEKHFDGSIDRYAGVMYGLDIE  269



>ref|XP_005649974.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
 gb|EIE25430.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
Length=284

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 211/270 (78%), Gaps = 6/270 (2%)
 Frame = -1

Query  997  WKMSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD  818
            WK       + +++REVW  NL+EE ++IR VVDDYPF+AMDTEFPG+V RPVG FKNS 
Sbjct  7    WKTK---SGEDLRVREVWQENLDEELEIIRNVVDDYPFLAMDTEFPGVVARPVGPFKNSG  63

Query  817  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSI  638
            +YHYQTL+ NVDMLKLIQLGLTFSD KG LP     + C+WQFNFREF  +ED+FA DSI
Sbjct  64   EYHYQTLRCNVDMLKLIQLGLTFSDAKGELPRW-KGELCVWQFNFREFKQSEDMFAQDSI  122

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            ELL+  GIDF +N   GIE  RFGE+LMSSGIVLN+ + WVTFHSGYDFGYLLK+LTCQ 
Sbjct  123  ELLKDSGIDFARNEARGIEVHRFGEVLMSSGIVLNEEIQWVTFHSGYDFGYLLKVLTCQP  182

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LP  +  FF L+ +YFP V+DIK+LM+FC +LHGGLNKLAE L+VER+G  HQAGSDSLL
Sbjct  183  LPAVEAEFFELLQIYFPNVYDIKYLMKFCGNLHGGLNKLAETLDVERIGPQHQAGSDSLL  242

Query  277  TACTFRKLKDNFFSG--SLEEYSGVLYGLG  194
            T+ TF KL D  F+G   + ++ GVLYGLG
Sbjct  243  TSKTFHKLIDTLFNGIDGVLKHRGVLYGLG  272



>ref|XP_009395283.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   361 bits (927),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 211/269 (78%), Gaps = 4/269 (1%)
 Frame = -1

Query  982  LPKSD---SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            + KSD    ++IR+VW  NLE EF +IREVVDD+PF+AMDTEFPG+ +RP+G+FK   D 
Sbjct  1    MSKSDDDAGVEIRDVWADNLEAEFAVIREVVDDFPFVAMDTEFPGVAIRPLGDFKTVADS  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
            +Y  L+ NVD+L LIQLGLTFSD +GNLP   T  +  +WQFNFREFD + D+   DSI+
Sbjct  61   NYHILRANVDLLHLIQLGLTFSDAEGNLPATATGGRPIVWQFNFREFDVDRDISNPDSID  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLR+  IDF++N E G++A RF EL M+SG+VLNDSV WVTFH  YDFGYLLKILTC+ L
Sbjct  121  LLRKSDIDFKRNREHGVDANRFAELFMASGVVLNDSVRWVTFHCAYDFGYLLKILTCRRL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PET++GF  LI  +FP ++DIKHLMRF NSLHGGLNK+AE LEV+RVG CHQAGSDSLLT
Sbjct  181  PETREGFSELIRTFFPVMYDIKHLMRFSNSLHGGLNKVAEQLEVDRVGTCHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            A  FRKL +  F GS++ Y+GV+YGL +E
Sbjct  241  ARAFRKLMEKHFDGSIDRYAGVMYGLDIE  269



>gb|KCW53891.1| hypothetical protein EUGRSUZ_J03104, partial [Eucalyptus grandis]
Length=240

 Score =   358 bits (920),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 212/271 (78%), Gaps = 34/271 (13%)
 Frame = -1

Query  988  SLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYH  809
            SLLPKSDSI IR+V + NLE+EF+LIR +V+DY ++AMDTEFPG+VLRPVG+F++ +DYH
Sbjct  2    SLLPKSDSIHIRKVCNDNLEQEFELIRAIVNDYLYVAMDTEFPGVVLRPVGSFQSPNDYH  61

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            YQTLKDNV++LKLI+LGLT  DEK NLPTC TD                    +DSIELL
Sbjct  62   YQTLKDNVNLLKLIRLGLTLFDEKENLPTCRTD--------------------NDSIELL  101

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            +QCGIDF KN E G++A +FGELLMSSGIVLNDSV+W              +LTCQ+LP 
Sbjct  102  KQCGIDFRKNNEKGVDAAQFGELLMSSGIVLNDSVYW--------------LLTCQDLPN  147

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            TQ  FF L +MYF  ++DIKHLM+FCNSLHGGLNKLAELLEVERVG CHQAGSDS+LT+C
Sbjct  148  TQSEFFKLTDMYFLMLYDIKHLMKFCNSLHGGLNKLAELLEVERVGNCHQAGSDSVLTSC  207

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            TFRKLKDNFF GSLE+Y+GVLY LG ENGQN
Sbjct  208  TFRKLKDNFFRGSLEKYTGVLYDLGFENGQN  238



>ref|XP_001697447.1| CCR4-associated factor [Chlamydomonas reinhardtii]
 gb|EDP00109.1| CCR4-associated factor [Chlamydomonas reinhardtii]
Length=300

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 213/270 (79%), Gaps = 2/270 (1%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            + P  D++++REVW  N+E EF L+R++V+DYP+IAMDTEFPG+V +P+G FK+S +Y Y
Sbjct  21   ITPAGDTLRVREVWADNMEVEFALLRDIVEDYPYIAMDTEFPGVVAKPIGTFKSSREYLY  80

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLR  626
            + LK NVDMLKLIQLGLT +D KG LP     + C+WQFNF+ F  ++DV+A DSIELL+
Sbjct  81   KALKMNVDMLKLIQLGLTLTDAKGTLPRAANGELCVWQFNFKGFKLSDDVYAQDSIELLK  140

Query  625  QCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPET  446
            Q GIDF  +   GI+  RFGELLM+SGIVLND V W+TFHS YDFGYLLKILTCQ LP T
Sbjct  141  QSGIDFALHEARGIDVHRFGELLMTSGIVLNDDVRWITFHSNYDFGYLLKILTCQPLPGT  200

Query  445  QQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACT  266
            +Q FF L+N+YFP +FDIK+LMR+C++LHGGLNKLAE+L+V+R+G  HQAGSDSLLT+ T
Sbjct  201  EQEFFELLNIYFPNIFDIKYLMRYCDNLHGGLNKLAEMLDVQRIGPQHQAGSDSLLTSAT  260

Query  265  FRKLKDNFFSG--SLEEYSGVLYGLGVENG  182
            F KL + +F G     ++ GVL+GLGV+  
Sbjct  261  FIKLANKYFHGIDGASKHMGVLFGLGVDGA  290



>ref|XP_005843563.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
 gb|EFN51461.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
Length=290

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/269 (62%), Positives = 214/269 (80%), Gaps = 4/269 (1%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            P  D++++REVW  NLE+E  LIR+VVDDYPF+AMDTEFPG+V RPVG+FKNS +YHYQT
Sbjct  14   PGGDTLRVREVWQDNLEQEMKLIRDVVDDYPFLAMDTEFPGVVARPVGSFKNSGEYHYQT  73

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            L+ NVDMLKLIQLGLTF+D +GNLP     + C+WQFNF+EF  ++D++A DSIELL+Q 
Sbjct  74   LRLNVDMLKLIQLGLTFTDAEGNLPRI-NGELCVWQFNFKEFRLSDDMYAQDSIELLKQS  132

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF +N   GI+ R FGELL  SG+VLN+ V W+TFHSGYDFGYLLK+LTC  LP  + 
Sbjct  133  GIDFAQNETRGIDVRHFGELLTVSGVVLNEDVRWITFHSGYDFGYLLKLLTCSSLPTNEG  192

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
             FF L+ ++FP++FDIK+LM+FC++LHGGLNKLAE L+V R+G  HQAGSDSLLT+ TF 
Sbjct  193  EFFQLLKLFFPQIFDIKYLMKFCDNLHGGLNKLAETLDVARIGPQHQAGSDSLLTSATFL  252

Query  259  KLKDNFFSG--SLEEYSGVLYGLGVENGQ  179
            KL    F G   + ++ G+LYGLG E+G+
Sbjct  253  KLAQQRFQGMDGVGQHRGILYGLG-EDGR  280



>gb|EMS59499.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=294

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 209/266 (79%), Gaps = 1/266 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLE EF +IR+VVDDYP+IAMDTEFPGIV RP+G+F+++D+Y+Y TLK 
Sbjct  20   EGVEIREVWANNLEAEFAVIRDVVDDYPYIAMDTEFPGIVCRPLGSFRSNDEYNYATLKA  79

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NVDML LIQLGLT SDE G LP  GT  + C WQFNFR FDP  D   +DSI+LLR  GI
Sbjct  80   NVDMLSLIQLGLTLSDENGALPARGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRNSGI  139

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF++ T  G +   F ELLMSSG++LN  + WVTFHSGYDFGYLLK+LT + LP+T  GF
Sbjct  140  DFDRFTTEGADTGHFAELLMSSGVLLNAELQWVTFHSGYDFGYLLKLLTGRNLPDTMPGF  199

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F LI +YFP ++DIKHLM++C SLHGGL+KL ELL V+RVG+CHQAGSDSLLT   F+KL
Sbjct  200  FDLIRIYFPVLYDIKHLMKYCGSLHGGLSKLGELLGVQRVGICHQAGSDSLLTLQCFQKL  259

Query  253  KDNFFSGSLEEYSGVLYGLGVENGQN  176
            K+ +F GS E Y+GVLYGL  + G+N
Sbjct  260  KEAYFRGSTENYAGVLYGLISDGGEN  285



>ref|XP_003574542.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=294

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 206/265 (78%), Gaps = 2/265 (1%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG-NFKNSDDYHYQTLK  794
            D ++IREVW  N++ EF +IRE++DDY ++AMDTEFPG+V RPVG N++ +D+Y+Y TLK
Sbjct  20   DGVEIREVWADNVDAEFAVIREIIDDYRYVAMDTEFPGVVCRPVGGNYRTNDEYNYVTLK  79

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCG  617
             NVDML LIQLGLT  DE G LP  GT  + C WQFNFR FDP  D   +DSI+LLR+ G
Sbjct  80   ANVDMLSLIQLGLTLCDESGALPPRGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRKSG  139

Query  616  IDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQG  437
            IDF++    G++  RF ELLMSSG+VLND + WVTFHSGYDFGYLLK LT Q +P+T  G
Sbjct  140  IDFDRFLAEGVDTARFAELLMSSGVVLNDDLQWVTFHSGYDFGYLLKALTAQNMPDTMSG  199

Query  436  FFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRK  257
            FF LI +YFP V+DIKHLMRFC SLHGGL++L ELL VERVG CHQAGSDSLLT   F K
Sbjct  200  FFDLIRVYFPVVYDIKHLMRFCGSLHGGLSRLGELLAVERVGTCHQAGSDSLLTLQCFNK  259

Query  256  LKDNFFSGSLEEYSGVLYGLGVENG  182
            LKD +F GS+E Y+GVLYGL  ++G
Sbjct  260  LKDAYFRGSVENYAGVLYGLVSDSG  284



>emb|CDY12236.1| BnaC04g12660D [Brassica napus]
Length=412

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 209/265 (79%), Gaps = 0/265 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M++  + DSIQIREVW  NLE E DLIREVVDD+P+++MDTEFPGIV RP+ N K   +Y
Sbjct  1    MTMFLQGDSIQIREVWSDNLEAEMDLIREVVDDFPYVSMDTEFPGIVFRPLENIKTITEY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            HY+TL+ NV+++K+IQLGLTFS+E GNLPTCG+DKYCIWQFNF +FDP   +   +SI+L
Sbjct  61   HYKTLRTNVNLMKMIQLGLTFSNESGNLPTCGSDKYCIWQFNFCDFDPVCSISNPESIKL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR  GIDF+KN E G+ ++RF ELL++SG+VLN++VHWVTFH  YD  YLLK+L  Q+LP
Sbjct  121  LRDSGIDFKKNYEKGVHSKRFAELLLTSGVVLNENVHWVTFHGVYDLAYLLKVLIIQDLP  180

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E  +GF  LI +YFP   DIKHLM+FCN L GGLNKLAELL VER+G+ HQAGSDSLLT+
Sbjct  181  EKPKGFDELIRLYFPRFCDIKHLMKFCNGLSGGLNKLAELLGVERLGISHQAGSDSLLTS  240

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGL  197
              F  L+D+FF+GS+E++      L
Sbjct  241  RIFMILQDSFFNGSVEKFKRTFASL  265



>ref|XP_008796886.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=270

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -1

Query  991  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            MS+  K+D +++IREVW  NLE E  +IR++VD YPF+AMDTEFPG+ + PV  FK+  D
Sbjct  1    MSIPAKTDDAVEIREVWADNLEAEITVIRDIVDQYPFVAMDTEFPGVAITPVRAFKDIAD  60

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLP--TCGTDKYCIWQFNFREFDPNEDVFASDS  641
             +YQTL+ NVD+L LIQ+G TFSD  G LP    G  + C+WQFNFREFD + DV   DS
Sbjct  61   KNYQTLRANVDLLHLIQIGFTFSDAAGRLPLSPSGGGRRCVWQFNFREFDVDHDVANPDS  120

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            I+LLR+ GIDF+KN E G++A RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+
Sbjct  121  IDLLRRSGIDFKKNRECGVDALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCR  180

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
             LPET + F  L++ +FP V+DIKHLMRFCN+L+GGLNK+AE L+ ER+G CHQAGSDSL
Sbjct  181  RLPETSEAFSDLVSTFFPTVYDIKHLMRFCNNLYGGLNKVAEQLDAERIGFCHQAGSDSL  240

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGL  197
            LT   F +LK+ +F GS+E Y+G+LYGL
Sbjct  241  LTVRVFWRLKEKYFDGSIESYAGLLYGL  268



>ref|XP_002950174.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
 gb|EFJ48842.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
Length=320

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/266 (63%), Positives = 211/266 (79%), Gaps = 3/266 (1%)
 Frame = -1

Query  985  LLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHY  806
            L    +++++REVW+ NLE EF LIR+ VD YP++AMDTEFPG+V +P+G FK+S +Y Y
Sbjct  6    LTATGETLRVREVWEDNLEAEFTLIRDFVDQYPYVAMDTEFPGVVAKPLGPFKSSREYLY  65

Query  805  QTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLR  626
            + LK NVDMLKLIQLGLTF+D KGNLP    +  C+WQFNF+ F   +DV+A DSIELL+
Sbjct  66   RALKMNVDMLKLIQLGLTFTDAKGNLPRANGE-LCVWQFNFKGFRLADDVYAQDSIELLK  124

Query  625  QCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPET  446
            Q GIDF  +   GI+  RFGELLM+SGIVLND V W+TFHS YDFGYLLKILTCQ LP++
Sbjct  125  QSGIDFATHEAKGIDVHRFGELLMTSGIVLNDDVRWITFHSNYDFGYLLKILTCQPLPQS  184

Query  445  QQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACT  266
            +Q FF L+N+YFP +FDIK+LMR+C++LHGGLNKLAE+LEV+R+G  HQAGSDSLLT+ T
Sbjct  185  EQEFFELLNIYFPNIFDIKYLMRYCDNLHGGLNKLAEMLEVQRIGPQHQAGSDSLLTSFT  244

Query  265  FRKLKDNFFSG--SLEEYSGVLYGLG  194
            F KL + FF G     ++ GVL+GLG
Sbjct  245  FIKLANKFFQGIEGASKHMGVLFGLG  270



>ref|XP_003056015.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59391.1| predicted protein [Micromonas pusilla CCMP1545]
Length=279

 Score =   352 bits (902),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 212/261 (81%), Gaps = 2/261 (1%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  794
            SD++  REVW+ NL+EE  +IRE++DD+PF+AMDTEFPG+V RPVGN+K   ++ YQTL+
Sbjct  5    SDNLLTREVWEGNLDEELAVIREIIDDFPFVAMDTEFPGVVARPVGNYKLQSEHQYQTLR  64

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
             NVDMLK+IQLGLT +D +GNLP  G + YC+WQFNFREF+  ED++A DSIELL+  GI
Sbjct  65   CNVDMLKIIQLGLTLTDARGNLPLIG-NFYCLWQFNFREFNLKEDLYAQDSIELLKHSGI  123

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            +F+ N E GI+  RFGE+LM SG+VL+D V W+TFHSG+DFGYLLKILTCQ LPE +  F
Sbjct  124  NFQANHERGIDVHRFGEMLMVSGVVLSDKVKWLTFHSGHDFGYLLKILTCQPLPEAESDF  183

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F ++++YFP +FDIK+LM+F ++LHGGL+KLAE L+V R+G  HQAGSDSLLTAC F KL
Sbjct  184  FYVLSIYFPCIFDIKYLMKFTDNLHGGLSKLAEQLDVARIGPQHQAGSDSLLTACAFFKL  243

Query  253  KDNFFSGS-LEEYSGVLYGLG  194
            K  +F  S LE+Y GVLYGLG
Sbjct  244  KQTYFIESGLEQYIGVLYGLG  264



>ref|XP_007023405.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY26027.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=194

 Score =   348 bits (893),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MSLLPKSDSIQIREVW+ NLEEEF LIRE+VDDYP++AMDTEFPG+VLRP+GNFK   DY
Sbjct  1    MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFKYICDY  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
            +YQTLKDNVDMLKLIQLGLTFSDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIEL
Sbjct  61   NYQTLKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIEL  120

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LRQ GIDF+KN E GI+A RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP
Sbjct  121  LRQSGIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLP  180

Query  451  ETQQGFFALINMYF  410
            +TQ GFF+LIN+YF
Sbjct  181  DTQVGFFSLINIYF  194



>gb|KCW62735.1| hypothetical protein EUGRSUZ_G00324 [Eucalyptus grandis]
Length=213

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 195/230 (85%), Gaps = 19/230 (8%)
 Frame = -1

Query  877  MDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCI  698
            MDTEFPGIV+RPVGNFKNS ++HYQTLK+NVD+LKLIQLGLTFSDE+ NLPTCG+DK CI
Sbjct  1    MDTEFPGIVVRPVGNFKNSSEFHYQTLKENVDILKLIQLGLTFSDERRNLPTCGSDKCCI  60

Query  697  WQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHW  518
             QFNFR+                   GI+F+KN + GI A RFGELLM SGIVLND+VHW
Sbjct  61   NQFNFRD-------------------GINFKKNRDRGINAVRFGELLMLSGIVLNDNVHW  101

Query  517  VTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLA  338
            VTFHSGYD GYLLK+LTCQ LP+TQ GFF LI+MYFP ++DIKHLM+FC+SLHGGLNK+A
Sbjct  102  VTFHSGYDLGYLLKVLTCQTLPDTQAGFFKLIHMYFPTLYDIKHLMKFCDSLHGGLNKVA  161

Query  337  ELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            ELL+VERVGVCHQAGSDSLLT+ TF+KLK++FFSGSLE+YSGVLYGL VE
Sbjct  162  ELLKVERVGVCHQAGSDSLLTSSTFKKLKESFFSGSLEKYSGVLYGLCVE  211



>ref|XP_002890137.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66396.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   348 bits (894),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 208/262 (79%), Gaps = 4/262 (2%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ----  803
            D+I+IREVW++NLEEE  LI + +DD+P++AMDTEFPG+V + V    + +  HY+    
Sbjct  12   DTIEIREVWNHNLEEEMALIEQAIDDFPYVAMDTEFPGVVCKTVTANPSPNPKHYEFNYE  71

Query  802  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQ  623
            TLK NV+MLKLIQLGLT SDEKGNLPTCGT+K CIWQFNFREF+   D+FA DSI+LLR+
Sbjct  72   TLKTNVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNLKSDMFAMDSIQLLRE  131

Query  622  CGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQ  443
              ID EKNTE G+++RRF ELLMSSG+VLND + WVTFH GYDFGYLLK+L+ +ELP   
Sbjct  132  SYIDLEKNTECGVDSRRFAELLMSSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKELPAEA  191

Query  442  QGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTF  263
              FF  +  +FP V+D+K+LM FC  L+GGL ++A+LL V+RVG+CHQAGSDSLLT   F
Sbjct  192  SKFFDQVERFFPVVYDMKYLMGFCAPLYGGLGRVAKLLGVKRVGICHQAGSDSLLTLRAF  251

Query  262  RKLKDNFFSGSLEEYSGVLYGL  197
             K+K+ FF+GSL++YSG LYGL
Sbjct  252  NKMKEIFFTGSLDKYSGFLYGL  273



>ref|NP_173044.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 ref|NP_973838.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9S9P2.1|CAF1B_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAF18489.1|AC010924_2 Similar to gi|Q60809 CCR4-associated factor 1 (CAF1) from Mus 
musculus. EST gb|Z26822 comes from this gene [Arabidopsis thaliana]
 gb|AAL86000.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 gb|AAM45088.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 dbj|BAH19897.1| AT1G15920 [Arabidopsis thaliana]
 gb|AEE29383.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AEE29384.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=286

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/264 (64%), Positives = 209/264 (79%), Gaps = 6/264 (2%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD------DYH  809
            D+I+IREVW++NLE+E  LI + +DD+P++AMDTEFPGIV + V    N +      +Y+
Sbjct  12   DTIEIREVWNHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPYSIHYEYN  71

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELL  629
            Y TLK NV+MLKLIQLGLT SDEKGNLPTCGT+K CIWQFNFREF+   D+FA DSIELL
Sbjct  72   YDTLKANVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNVISDMFALDSIELL  131

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            R+  ID EKN E G++A+RF ELLM SG+VLND +HWVTFH GYDFGYLLK+L+ +ELPE
Sbjct  132  RKSAIDLEKNNECGVDAKRFAELLMGSGVVLNDKIHWVTFHCGYDFGYLLKLLSGKELPE  191

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
                FF  +  +FP V+DIK+LM FC +L+GGL K+AELL V+RVG+ HQAGSDSLLT  
Sbjct  192  EISDFFDQMEKFFPVVYDIKYLMGFCTNLYGGLEKIAELLGVKRVGISHQAGSDSLLTLR  251

Query  268  TFRKLKDNFFSGSLEEYSGVLYGL  197
            TF K+K+ FF+GSL +YSG L+GL
Sbjct  252  TFIKMKEFFFTGSLLKYSGFLFGL  275



>ref|XP_006304066.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
 gb|EOA36964.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
Length=289

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/274 (62%), Positives = 212/274 (77%), Gaps = 9/274 (3%)
 Frame = -1

Query  991  MSLLP----KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN  824
            MS +P    + DSI+IREVW++NLEEE  LI + +DD+PF+AMDTEFPGIV + V    +
Sbjct  1    MSQVPNPKDEDDSIEIREVWNHNLEEEMALIEQAIDDFPFVAMDTEFPGIVCKTVTANPS  60

Query  823  SD----DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNED  659
             +    +Y+Y+TLK NV+MLKLIQLGLT SDE+GNLPTCGT+ K CIWQFNFREF+   D
Sbjct  61   PNPKHYEYNYETLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSD  120

Query  658  VFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLL  479
            +FA DSI+LLR   IDFEKN E G+++ RF ELLM SG+VLND + WVTFH GYDFGYLL
Sbjct  121  MFAMDSIQLLRDSNIDFEKNNECGVDSARFAELLMGSGVVLNDKIQWVTFHCGYDFGYLL  180

Query  478  KILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQ  299
            K+L+ ++LPE +  FF  +  YFP V+DIK+LM FC SL+GGL ++AE+L V+RVG+ HQ
Sbjct  181  KLLSGKDLPEEKTDFFEQVTSYFPVVYDIKYLMGFCASLYGGLERVAEILGVKRVGISHQ  240

Query  298  AGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGL  197
            AGSDSLLT   F K+KD FF GSL+ YSG LYGL
Sbjct  241  AGSDSLLTLRAFNKMKDIFFPGSLDRYSGFLYGL  274



>ref|XP_006416864.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
 gb|ESQ35217.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
Length=284

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 210/269 (78%), Gaps = 5/269 (2%)
 Frame = -1

Query  985  LLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG---NFKNSD  818
            ++PK D SI+IREVW+ NL  E  LI + ++ +P++AMDTEFPGIV + V    N K ++
Sbjct  1    MVPKEDDSIEIREVWNENLGAEMSLISQAINHFPYVAMDTEFPGIVCKTVTTDENPKRNE  60

Query  817  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDS  641
               Y++L+ NV+ML LIQLGLT SDE+GNLPTCGT+ K C+WQFNFREF+   DVFA DS
Sbjct  61   FNCYESLRTNVNMLNLIQLGLTLSDEQGNLPTCGTNNKQCVWQFNFREFNLKTDVFAMDS  120

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            IELLRQ GIDF KN   GIE+RRF  LLM SG+VLND V WVTFH GYDFGYLLK+LT +
Sbjct  121  IELLRQSGIDFAKNNHLGIESRRFAALLMCSGVVLNDKVQWVTFHCGYDFGYLLKLLTGK  180

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
            +LPE Q  FF L+  +FP V+DIK+LM FCN L GGL+K+AELL V+RVG+ HQAGSDSL
Sbjct  181  DLPEDQSDFFLLVKTFFPTVYDIKYLMDFCNGLWGGLSKVAELLLVKRVGISHQAGSDSL  240

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGLG  194
            LT+  FRK+K+  F+GS+ +YSGVLYGLG
Sbjct  241  LTSRVFRKMKEKHFTGSMAKYSGVLYGLG  269



>dbj|BAD09890.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD09904.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 gb|EAZ42877.1| hypothetical protein OsJ_27470 [Oryza sativa Japonica Group]
 dbj|BAG96259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98767.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/266 (61%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLE E   IR+ VD YP++AMDTEFPGIV RPVGNF+ +D+++Y  L+ 
Sbjct  14   EGVEIREVWAGNLEAEIAAIRDEVDRYPYVAMDTEFPGIVCRPVGNFRTTDEFNYANLEA  73

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NV+MLKLIQLGLT SDE G+LP  GT  + CIWQFNFR FDP  D   +DSI++LR CGI
Sbjct  74   NVNMLKLIQLGLTLSDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPSNADSIQMLRTCGI  133

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF++    G +  RF ELLMSSG+VLN  V W+TFHSGYDFGYLL++LT + LP+    F
Sbjct  134  DFDRFAAEGADPIRFAELLMSSGVVLNADVQWITFHSGYDFGYLLRLLTGRNLPDNMPAF  193

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F LI +YFP ++DIKHLMRFC++LHGGL++L ELL+V+RVG CHQAGSDSLLT   + K+
Sbjct  194  FDLIRIYFPVLYDIKHLMRFCSNLHGGLSRLGELLDVKRVGTCHQAGSDSLLTLGCYNKI  253

Query  253  KDNFFSGSLEEYSGVLYGLGVENGQN  176
            K+ +F GS E+++GVLYGL +E+G N
Sbjct  254  KEVYFKGSTEKHAGVLYGLVIEDGVN  279



>gb|AEN81307.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81308.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81309.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81310.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81311.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81312.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81313.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81314.1| AT1G80780-like protein, partial [Capsella rubella]
Length=200

 Score =   342 bits (877),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -1

Query  838  GNFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNED  659
            G FK++ DYHY+TLK NV++LK+IQLGLTFS+E+GNLPTCGTDKYCIWQFNF EFD + D
Sbjct  1    GTFKSNADYHYETLKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFGEFDLDSD  60

Query  658  VFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLL  479
            +FA DSIELL+Q GID  KNT+ GI+++RF ELLMSSGIVLN++VHWVTFHSGYDFGYLL
Sbjct  61   IFAVDSIELLKQSGIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLL  120

Query  478  KILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQ  299
            K+LTCQ LP++Q  FF LIN+YFP V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+CHQ
Sbjct  121  KLLTCQNLPDSQTDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQ  180

Query  298  AGSDSLLTACTFRKLKDNFF  239
            AGSDSLLT+CTFRKLK+NFF
Sbjct  181  AGSDSLLTSCTFRKLKENFF  200



>ref|XP_011395961.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
 gb|KFM23091.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
Length=293

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 206/266 (77%), Gaps = 3/266 (1%)
 Frame = -1

Query  979  PKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQT  800
            P  D++++REVW +NLEEE  LIRE++ D+P++AMDTEFPG+V +PVGNFK S ++HYQ 
Sbjct  19   PDGDTLRVREVWQHNLEEEMQLIRELISDFPYLAMDTEFPGVVAKPVGNFKKSREFHYQM  78

Query  799  LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQC  620
            L+ NV+MLK+IQLGLTFSD  GNLP    ++ C+WQFNFREF  N+D++A DSIELL+Q 
Sbjct  79   LRLNVNMLKMIQLGLTFSDHLGNLPRI-NNELCVWQFNFREFRLNDDIYAQDSIELLKQS  137

Query  619  GIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQ  440
            GIDF +N   GI+   FG LLM SG+VLN+ V W+TFHS YDFGYLL+ +TC  LP T+ 
Sbjct  138  GIDFAQNEARGIDIHDFGALLMVSGVVLNEDVRWLTFHSSYDFGYLLRTVTCAPLPNTES  197

Query  439  GFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
             FF L+ ++FP V+DIK+LM+FC++LHGGLNKLAE L+V R+G  HQAGSDSLLT+ TF 
Sbjct  198  DFFELLKIFFPSVYDIKYLMKFCDNLHGGLNKLAETLDVARIGPQHQAGSDSLLTSATFM  257

Query  259  KLKDNFFSG--SLEEYSGVLYGLGVE  188
            +L +  F G    +++  VLYGLG +
Sbjct  258  RLAEKHFKGLAGTQKHENVLYGLGAD  283



>gb|KFK43832.1| hypothetical protein AALP_AA1G179300 [Arabis alpina]
Length=272

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 209/267 (78%), Gaps = 1/267 (0%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS+  +  SI+IR+VWD N+E+E  LI + VDD+P++AMDTEFPGIV + V    +    
Sbjct  1    MSVDDEDSSIEIRQVWDKNVEQELSLISQYVDDFPYVAMDTEFPGIVCKSVTVDPSPRRN  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIE  635
             Y++LK NV+ML LIQLGLT SD++GNLPTCGT+ K C+WQFNFREF+   D+FA DSIE
Sbjct  61   CYESLKTNVNMLNLIQLGLTLSDDQGNLPTCGTNNKQCVWQFNFREFNLKTDMFAIDSIE  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLRQ G+DF KN + GIEA+RF +LLM SG+VLND + W+TFH GYD GYLLK+LT + L
Sbjct  121  LLRQSGMDFAKNRQFGIEAKRFAQLLMGSGVVLNDKIQWITFHCGYDLGYLLKLLTGKNL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PE Q  FF+ +  +FP ++DIKHLM FC++++GGL+K A+LLEV+RVG+ HQAGSDSLLT
Sbjct  181  PEKQSEFFSRVQTFFPVLYDIKHLMDFCSAVYGGLSKAADLLEVKRVGISHQAGSDSLLT  240

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLG  194
               FRK+K+  F+G +++YSGVLYGL 
Sbjct  241  LRVFRKMKETMFTGPMDKYSGVLYGLA  267



>gb|EYU24605.1| hypothetical protein MIMGU_mgv1a011876mg [Erythranthe guttata]
Length=268

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 215/268 (80%), Gaps = 2/268 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            M L P +DSI  REVW  NL++EF++IR ++DDY  +AMDTEFPG++L+P+  F N+++ 
Sbjct  1    MYLQPPADSIDFREVWAENLDKEFEIIRSIIDDYYCVAMDTEFPGVILKPLRIFPNTNEE  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIE  635
            +YQ LK+NV+ +KLIQLGLT ++EKG+LPTCG T  + +WQFNFR+F+P+ED++ SDSI 
Sbjct  61   NYQCLKENVNTMKLIQLGLTLTNEKGDLPTCGETGLFIVWQFNFRDFNPSEDIYNSDSIH  120

Query  634  LLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQEL  455
            LLR CGIDFEK+   G++A RF ELLMSSG+VLN+SV+WVTF  G+DFGYLLK+LT +EL
Sbjct  121  LLRGCGIDFEKHVAEGVDATRFAELLMSSGVVLNESVYWVTFQCGHDFGYLLKLLTGREL  180

Query  454  PETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  275
            PET++ FF  I +YFP ++DIKH+++F   L+GGLNK+A  L+V+RVG  HQAGSDSLLT
Sbjct  181  PETREEFFKFIKLYFPVIYDIKHMIQFV-ELYGGLNKVARTLKVDRVGTSHQAGSDSLLT  239

Query  274  ACTFRKLKDNFFSGSLEEYSGVLYGLGV  191
            +  FR L+D     S+E Y+GV++GLG+
Sbjct  240  SSVFRTLRDTRLQESIETYAGVMHGLGI  267



>ref|XP_010927524.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   340 bits (873),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 163/268 (61%), Positives = 206/268 (77%), Gaps = 3/268 (1%)
 Frame = -1

Query  991  MSLLPKSDS-IQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            MS+  K+D  I+IREVW  NLE E  +IRE+VD+YPF+AMDTEFPG+ ++   + KN+ D
Sbjct  1    MSIPEKTDDVIEIREVWADNLEAEIAVIREIVDEYPFVAMDTEFPGVAMQVAYDIKNNAD  60

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDS  641
             +YQ L+ NVD+L LIQ+GL+FSD  G LP    G  + CIWQFNFREFD + DV   DS
Sbjct  61   RNYQNLRANVDVLHLIQVGLSFSDAAGILPPSPSGGGRGCIWQFNFREFDVDRDVCNPDS  120

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            +ELLR+ GIDF+KN E G++A RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+
Sbjct  121  VELLRRSGIDFKKNRERGVDALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCR  180

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
             LPET  GF  L+ ++FP V+DIK+L+R+C+ L+GGLN +AE L+V R+GVCHQAGSDSL
Sbjct  181  RLPETMGGFLELVRIFFPVVYDIKYLLRYCDHLYGGLNNVAEQLDVVRIGVCHQAGSDSL  240

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGL  197
            LTA  F +LK+  F GS+E YSG+LYGL
Sbjct  241  LTARVFWRLKEKHFDGSIERYSGLLYGL  268



>ref|XP_006659446.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like, 
partial [Oryza brachyantha]
Length=280

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 202/266 (76%), Gaps = 1/266 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            + ++IREVW  NLE E   IR+ VD Y F+AMDTEFPG+V RP+GNF+ +D+Y+Y  L+ 
Sbjct  7    EGVEIREVWAGNLEAEMAAIRDEVDRYRFVAMDTEFPGVVCRPLGNFRTADEYNYANLRA  66

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NV+MLKLIQLGLT SDE G LP  GT  + CIWQFNFR FDP  D    +SI+LL   GI
Sbjct  67   NVNMLKLIQLGLTLSDENGELPRRGTGGRPCIWQFNFRGFDPRSDPSNGESIQLLLNSGI  126

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            +F++    G +  RF ELLMSSG+VLN  V W+TFHSGYDFGYLL++LT Q LP T   F
Sbjct  127  NFDRFAAEGADPIRFAELLMSSGVVLNSDVQWITFHSGYDFGYLLRLLTGQNLPGTMTAF  186

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F LI ++FP V+DIKHLM+FC SLHGGL+KL ELLE++RVG+CHQAGSDSLLT   + K+
Sbjct  187  FDLIRIFFPVVYDIKHLMKFCGSLHGGLSKLGELLEIKRVGICHQAGSDSLLTLGCYNKI  246

Query  253  KDNFFSGSLEEYSGVLYGLGVENGQN  176
            K+ +F GS E+++GVLYGL +E+G N
Sbjct  247  KEVYFKGSTEKHAGVLYGLVIEDGVN  272



>ref|XP_009385031.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 213/266 (80%), Gaps = 1/266 (0%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            D+++IR+VW  NLE EF +IR++VDD+P++AMDTEFPG+V+R +G+FK   D +Y +L  
Sbjct  7    DAVEIRDVWAGNLESEFAVIRDIVDDFPYVAMDTEFPGVVIRHLGDFKQPADANYHSLSA  66

Query  790  NVDMLKLIQLGLTFSDEKGNLPTC-GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
            NVD+L L+QLGLTFSD  GNLPT   + +  +WQFNFREFD + DVF  DSI+LLR+ GI
Sbjct  67   NVDLLHLLQLGLTFSDAAGNLPTSPSSGRPVVWQFNFREFDVDSDVFVPDSIDLLRKSGI  126

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF+KN E G++ARRF EL MSSG+VLNDS+HWV FH  YDFGYL+KILTC++LPET++ F
Sbjct  127  DFKKNREDGVDARRFAELFMSSGVVLNDSIHWVAFHGAYDFGYLIKILTCRKLPETRKEF  186

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
              L++++FP V+DIK ++   N+L+GGLNK+AE LEVERVG CHQAGSDSLLTA  F K+
Sbjct  187  LDLLHVFFPVVYDIKRVIHLNNNLYGGLNKVAEKLEVERVGTCHQAGSDSLLTARAFMKM  246

Query  253  KDNFFSGSLEEYSGVLYGLGVENGQN  176
            + + F GS+E+Y G+L+GL +E+  N
Sbjct  247  RGHRFVGSMEKYVGLLFGLDIESAHN  272



>gb|KJB06633.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=206

 Score =   334 bits (856),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  766  QLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESG  587
            QLGLTFSD  GNLPTCGTD +CIWQFNFREF+ +ED+F SDSIELL QCGIDF+KN E G
Sbjct  9    QLGLTFSDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQCGIDFKKNNEKG  68

Query  586  IEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFP  407
            I+ +RFGELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP++Q GFF LI +YFP
Sbjct  69   IDVKRFGELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQTGFFKLIKLYFP  128

Query  406  EVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSL  227
             V+DIKH+M+FCN LHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF  S+
Sbjct  129  MVYDIKHMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFK-SV  187

Query  226  EEYSGVLYGLGVENGQN  176
            ++Y+GVLYGL VE GQN
Sbjct  188  QKYAGVLYGLEVEGGQN  204



>ref|XP_010497514.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=287

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 204/263 (78%), Gaps = 5/263 (2%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ----  803
            ++I+IREVW +NLE+E  LI + +DD+P++AMDTEFPGIV + V    N +  HY+    
Sbjct  14   NTIEIREVWSHNLEQEMALIEQSIDDFPYVAMDTEFPGIVCKTVTANPNPNPKHYEYNYG  73

Query  802  TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLR  626
            TLK NV+MLKLIQLGLT SDE+GNLPTCGT+K  CIWQFNFREF+   D+FA DSI LLR
Sbjct  74   TLKTNVNMLKLIQLGLTLSDERGNLPTCGTNKRQCIWQFNFREFNLKSDMFAMDSINLLR  133

Query  625  QCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPET  446
               IDFEKN E G++++RF ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LPE 
Sbjct  134  GSNIDFEKNKECGVDSKRFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEE  193

Query  445  QQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACT  266
            +  FF  +  YFP V+DIK+LM FC  L+GGL ++A++L V+RVG+ HQAGSDSLLT   
Sbjct  194  KSEFFDQVTSYFPVVYDIKYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRA  253

Query  265  FRKLKDNFFSGSLEEYSGVLYGL  197
            F K+K+ FF+GSL+ YSG LYGL
Sbjct  254  FNKMKEMFFTGSLDRYSGFLYGL  276



>ref|XP_010476692.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   336 bits (861),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 204/264 (77%), Gaps = 5/264 (2%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQ---  803
            +++I+IREVW +NLE E  LI + +DD+P++AMDTEFPGIV + V    N +  HY+   
Sbjct  14   NNTIEIREVWSHNLEAEMALIEKSIDDFPYVAMDTEFPGIVCKTVTTNPNPNPKHYEYNY  73

Query  802  -TLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELL  629
             TLK NV+MLKLIQLGLT SDE+GNLPTCGT+ K CIWQFNFREF+   D+FA DSI LL
Sbjct  74   GTLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINLL  133

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            R   IDFEKN E G++++RF ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LPE
Sbjct  134  RGSNIDFEKNNECGVDSKRFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPE  193

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
             +  FF  +  YFP V+DIK+LM FC  L+GGL ++A++L V+RVG+ HQAGSDSLLT  
Sbjct  194  EKSEFFDQVTSYFPVVYDIKYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLR  253

Query  268  TFRKLKDNFFSGSLEEYSGVLYGL  197
             F K+K+ FF+GSL+ YSG LYGL
Sbjct  254  AFNKMKEMFFTGSLDRYSGFLYGL  277



>ref|XP_008779663.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=268

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/268 (58%), Positives = 200/268 (75%), Gaps = 3/268 (1%)
 Frame = -1

Query  991  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDD  815
            MS+  K+D  ++IREVW +NLE E  +IRE+VD+YPF+A+DTEFPG+V+ PV +FKN+ D
Sbjct  1    MSIPAKNDDPVEIREVWAHNLEAEMAVIREIVDEYPFVALDTEFPGVVITPVRDFKNNAD  60

Query  814  YHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDS  641
             +YQ  + NVD+L +IQ+G TFSD  G LP    G  + C+WQFNFREFD +       S
Sbjct  61   ENYQKARANVDLLHVIQIGFTFSDASGCLPPSPSGVGRPCVWQFNFREFDADRHFCNPAS  120

Query  640  IELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQ  461
            I+LLR+ GIDF++N E G+ A RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+
Sbjct  121  IDLLRRSGIDFQRNREWGVHALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCR  180

Query  460  ELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSL  281
             LPET  GF  L+  +FP V+DIKHLM+FCN+L+GGL  +AE L+ ER+G  HQAGSDSL
Sbjct  181  RLPETTAGFMELVRTFFPTVYDIKHLMKFCNNLYGGLANVAEQLDAERIGASHQAGSDSL  240

Query  280  LTACTFRKLKDNFFSGSLEEYSGVLYGL  197
            LTA  F +LK+ +F  S+E Y+G LYGL
Sbjct  241  LTAHVFWRLKEKYFGWSIERYAGPLYGL  268



>ref|XP_010459127.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 204/265 (77%), Gaps = 7/265 (3%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSD------DYH  809
            ++I+IREVW +NLE E   I + +DD+P++AMDTEFPGIV + V    N +      +Y+
Sbjct  14   NTIEIREVWHHNLEAEMARIEQYIDDFPYVAMDTEFPGIVCKTVTTNPNPNPNPKHYEYN  73

Query  808  YQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIEL  632
            Y+TLK NV+MLKLIQLGLT SDE+GNLPTCGT+ K CIWQFNFREF+   D+FA DSI L
Sbjct  74   YETLKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINL  133

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            LR   IDFEKN E G++++RF ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LP
Sbjct  134  LRGSNIDFEKNNECGVDSKRFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLP  193

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            E +  FF  +  YFP V+DIK+LM FC  L+GGL ++A++L V+RVG+ HQAGSDSLLT 
Sbjct  194  EEKSDFFDQVTSYFPVVYDIKYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTL  253

Query  271  CTFRKLKDNFFSGSLEEYSGVLYGL  197
              F K+K+ FF+GSL+ YSG LYGL
Sbjct  254  RAFNKMKERFFTGSLDRYSGFLYGL  278



>ref|XP_002507260.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68518.1| predicted protein [Micromonas sp. RCC299]
Length=273

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 204/262 (78%), Gaps = 5/262 (2%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  794
            +D++  REVW  NL+EE  +IR ++D+YP+IAMDTEFPG+V RPVG +++  DY YQTL+
Sbjct  8    NDNLLTREVWGSNLDEELAIIRNLIDEYPYIAMDTEFPGVVARPVGTYRS--DYQYQTLR  65

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
             NVD+LKLIQLG+T +D  GNLP      YC+WQFNFREFD  ED++A DSIELL+  GI
Sbjct  66   CNVDLLKLIQLGITLTDGDGNLPLIA-GHYCVWQFNFREFDLKEDMYAQDSIELLKHSGI  124

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSV-HWVTFHSGYDFGYLLKILTCQELPETQQG  437
            DF+ N   GI+  RFGELLM SG+VLN  V  W+TFHSGYDFGYLLK+LTC  LP+ +  
Sbjct  125  DFDANRNRGIDVHRFGELLMVSGVVLNQKVVKWITFHSGYDFGYLLKLLTCTALPQNEAE  184

Query  436  FFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRK  257
            FF ++ ++FP +FD+K+LMRF ++LHGGL+KLAE L+VER+G  HQAGSDSLLTACTF K
Sbjct  185  FFGILGLHFPCIFDMKYLMRFTDNLHGGLSKLAEQLDVERIGPQHQAGSDSLLTACTFFK  244

Query  256  LKDNFFSGS-LEEYSGVLYGLG  194
            L+   F    +++++GVLYGLG
Sbjct  245  LRQTHFGHDCVDKHAGVLYGLG  266



>ref|XP_007509231.1| Caf1 CCR4-associated (transcription) factor 1 [Bathycoccus prasinos]
 emb|CCO19688.1| Caf1 CCR4-associated (transcription) factor 1 [Bathycoccus prasinos]
Length=273

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/261 (59%), Positives = 198/261 (76%), Gaps = 2/261 (1%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  794
            S ++  REVW  NL+EE  +IR++V  +P+IAMDTEFPG+V RPVG FK   ++HYQTLK
Sbjct  5    SYNLLTREVWSDNLDEEVAIIRKLVQAFPYIAMDTEFPGVVARPVGAFKQQSEFHYQTLK  64

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGI  614
             NVDMLKLIQLGLT +D  GNLP     +YC+WQFNF EF+  +D++A DSIELL+Q GI
Sbjct  65   CNVDMLKLIQLGLTLTDANGNLPII-DGRYCLWQFNFGEFNLKDDMYARDSIELLKQSGI  123

Query  613  DFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGF  434
            DF    E GI+  RFGEL M SG+VL+  V W+TFHSGYDFGYL+K+LTC  LPE +  F
Sbjct  124  DFLILNERGIDVTRFGELFMVSGVVLSRDVKWLTFHSGYDFGYLIKLLTCVSLPENEADF  183

Query  433  FALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL  254
            F ++  YFP  +D+K LM+F  +LHGGL+KLAE L+VER+G  HQAGSDSLLTACTF K+
Sbjct  184  FKILETYFPCFYDMKFLMKFTENLHGGLSKLAEHLDVERIGPQHQAGSDSLLTACTFFKM  243

Query  253  KDNFFSG-SLEEYSGVLYGLG  194
            ++ +F    L++Y+ +LYGLG
Sbjct  244  RERYFEKIKLDKYACILYGLG  264



>ref|XP_001416204.1| polyA tail-shortening ribonuclease, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94497.1| polyA tail-shortening ribonuclease, probable [Ostreococcus lucimarinus 
CCE9901]
Length=276

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/270 (58%), Positives = 204/270 (76%), Gaps = 2/270 (1%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY  812
            MS      ++  R+VW +NL+EE  LIREVV +YP++AMDTEFPG+V RPVG+FK+  ++
Sbjct  1    MSSALTPSTLHTRDVWAHNLDEECALIREVVCNYPYVAMDTEFPGVVARPVGSFKHQAEF  60

Query  811  HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIEL  632
             YQTL+ NVD+LKLIQLGLTFSD  GNLP     ++CIWQFNF+EF+  ++++A DSIEL
Sbjct  61   QYQTLRCNVDLLKLIQLGLTFSDGAGNLPVV-DGRFCIWQFNFKEFNVKDELYAQDSIEL  119

Query  631  LRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELP  452
            L++ GIDF    E GI+  +FGE LM SG+VLND + W+TFHS YDFGYLLK+LT   LP
Sbjct  120  LKESGIDFNLLEERGIDIVQFGEKLMVSGVVLNDDIRWLTFHSSYDFGYLLKLLTNAPLP  179

Query  451  ETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTA  272
            + +  FF L+  YFP ++DIKHLM+F  ++HGGLNKLAE L V R+G  HQAGSDSLLTA
Sbjct  180  DKEADFFTLLQCYFPCIYDIKHLMQFVGNMHGGLNKLAEYLHVARIGPQHQAGSDSLLTA  239

Query  271  CTFRKLKDNFFSG-SLEEYSGVLYGLGVEN  185
             TF KL+ + FS  ++ +++G LYGLG E+
Sbjct  240  HTFFKLQKSHFSNVNMHQFAGSLYGLGQES  269



>ref|XP_009149028.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Brassica 
rapa]
Length=276

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 205/274 (75%), Gaps = 8/274 (3%)
 Frame = -1

Query  991  MSLLPKSD---SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG---NF  830
            M+++ K D    I+IR VW+ NL  E  LI + ++ +P++AMDTEFPG V + V    N 
Sbjct  1    MTMVTKQDDAIEIEIRNVWNENLHHEMSLISQAINYFPYVAMDTEFPGTVCKKVTTDTNP  60

Query  829  KNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVF  653
            +  D   Y++LK NV+ML +IQLGLT SD++GNLPT GT+K  C+WQFNFREF+   D++
Sbjct  61   RRDDSTCYESLKTNVNMLNMIQLGLTLSDDQGNLPTFGTNKRQCVWQFNFREFNLRTDMY  120

Query  652  ASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKI  473
            A DSIELLR+ GIDF++N+  GIE++RF +LLM SG+VLN+ + WVTFH GYDFGYLL++
Sbjct  121  APDSIELLRRSGIDFDRNSRVGIESKRFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRL  180

Query  472  LTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAG  293
            LT + LPE Q  F  L+ M+FP VFDIKH++ FC  L GGL+ +AE LEVERVG+ HQAG
Sbjct  181  LTGRNLPEKQSEFLYLVKMFFPRVFDIKHMIGFCYDLFGGLSSVAERLEVERVGISHQAG  240

Query  292  SDSLLTACTFRKLKDNFFSG-SLEEYSGVLYGLG  194
            SDSLLTA  FR++K+  F+G SL+ Y GVLYGLG
Sbjct  241  SDSLLTARVFRRMKETRFAGRSLDMYCGVLYGLG  274



>emb|CDY35049.1| BnaA06g10590D [Brassica napus]
Length=276

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 205/274 (75%), Gaps = 8/274 (3%)
 Frame = -1

Query  991  MSLLPKSD---SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG---NF  830
            M+++ K D    I+IR VW+ NL  E  LI + ++ +P++AMDTEFPG V + V    N 
Sbjct  1    MTMVTKQDDAIEIEIRNVWNENLHHEMSLISQAINYFPYVAMDTEFPGTVCKKVTTDTNP  60

Query  829  KNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVF  653
            +  D   Y++LK NV+ML +IQLGLT SD++GNLPT GT+K  C+WQFNFREF+   D++
Sbjct  61   RRDDSTCYESLKTNVNMLNMIQLGLTLSDDQGNLPTFGTNKRQCVWQFNFREFNLRTDMY  120

Query  652  ASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKI  473
            A DSIELLR+ GIDF++N+  GIE++RF +LLM SG+VLN+ + WVTFH GYDFGYLL++
Sbjct  121  APDSIELLRRSGIDFDRNSRVGIESKRFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRL  180

Query  472  LTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAG  293
            LT + LPE Q  F  L+ M+FP VFDIKH++ FC  L GGL+ +AE LEVERVG+ HQAG
Sbjct  181  LTGRNLPEKQLEFLYLVKMFFPRVFDIKHMIGFCYDLFGGLSSVAERLEVERVGISHQAG  240

Query  292  SDSLLTACTFRKLKDNFFSG-SLEEYSGVLYGLG  194
            SDSLLTA  FR++K+  F+G SL+ Y GVLYGLG
Sbjct  241  SDSLLTARVFRRMKETRFAGRSLDMYCGVLYGLG  274



>ref|XP_005707256.1| CCR4-NOT transcription complex subunit 7/8 [Galdieria sulphuraria]
 gb|EME30736.1| CCR4-NOT transcription complex subunit 7/8 [Galdieria sulphuraria]
Length=305

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 202/263 (77%), Gaps = 7/263 (3%)
 Frame = -1

Query  976  KSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTL  797
            K  S+ I+EVW  NLE+E   I  ++D Y F+AMDTEFPG+V RP+G+F+++ DYHYQTL
Sbjct  5    KEPSLVIKEVWAENLEKELANISSILDKYNFVAMDTEFPGVVARPIGSFRSNTDYHYQTL  64

Query  796  KDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCG  617
            + NVD+LK+IQLGL+FSD +GN+P    +    WQFNFR F  NED++A DSI+LL + G
Sbjct  65   RCNVDLLKIIQLGLSFSDSEGNIP----EGCACWQFNFR-FSLNEDIYAQDSIDLLTRSG  119

Query  616  IDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQG  437
            IDF+++   GI+  RFGELL+SSGIVLN+ + W++FHSGYDFGYLLKILTC E+P  +  
Sbjct  120  IDFDEHERHGIDVERFGELLISSGIVLNEDICWISFHSGYDFGYLLKILTCSEMPAEESE  179

Query  436  FFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRK  257
            FF L+N YFP  +D+K+LM   + L+GGLNKLAE+LEVERVG  HQAGSDSLLT   F K
Sbjct  180  FFELLNTYFPRFYDMKYLMMASDRLYGGLNKLAEILEVERVGQMHQAGSDSLLTMKVFFK  239

Query  256  LKDNFFSGSLEE--YSGVLYGLG  194
            +K++ FSG ++E  Y GVLYGLG
Sbjct  240  MKESIFSGQIDERRYCGVLYGLG  262



>emb|CDY33367.1| BnaC05g12160D [Brassica napus]
Length=454

 Score =   324 bits (830),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 206/274 (75%), Gaps = 7/274 (3%)
 Frame = -1

Query  991  MSLLPKSD-SIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPV---GNFKN  824
            MS++ K D +I+IR VW+ NL+ E  LI + ++ +P++AMDTEFPG V + V    N + 
Sbjct  1    MSMVTKQDDAIEIRNVWNENLDHEMSLISQAINYFPYVAMDTEFPGTVCKKVTTEANPRR  60

Query  823  SDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKY--CIWQFNFREFDPNEDVFA  650
             D   Y++LK NV+ML +IQLGLT SD++GNLPT GT+K   C+WQFNFREF+   D++A
Sbjct  61   DDSTCYESLKTNVNMLNMIQLGLTLSDDQGNLPTLGTNKRRQCVWQFNFREFNLRTDMYA  120

Query  649  SDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKIL  470
             DSIELLR+ GIDF+ N   G+E++RF +LLM SG+VLN+ + WVTFH GYDFGYLL++L
Sbjct  121  PDSIELLRRSGIDFDWNNRLGVESKRFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLL  180

Query  469  TCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGS  290
            T + LP+ Q  F  L+NM+FP VFDIKH++ FC+ L GGL+ LAE LEVERVGV HQAGS
Sbjct  181  TGRNLPDKQSEFLYLVNMFFPRVFDIKHMIGFCHDLFGGLSSLAERLEVERVGVSHQAGS  240

Query  289  DSLLTACTFRKLKDNFFSG-SLEEYSGVLYGLGV  191
            DSLLTA  FR +K+  F+G SL+ Y GVLYGLG 
Sbjct  241  DSLLTARVFRTMKETRFAGRSLDMYCGVLYGLGT  274



>gb|KCW80614.1| hypothetical protein EUGRSUZ_C01981 [Eucalyptus grandis]
Length=218

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -1

Query  817  DYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSI  638
            DY+YQT+K+NVD LKLIQLGLTF D++GNLPTCGTDKYCIWQFNFR FD  +D F   SI
Sbjct  3    DYNYQTMKNNVDKLKLIQLGLTFLDDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGSI  62

Query  637  ELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQE  458
            E L + GIDF+KN E G++A RFGELLMSSGI LND V+WVTFH  Y+FG+LLK+LTC+ 
Sbjct  63   EWLHERGIDFKKNNEKGVDAERFGELLMSSGIALNDGVNWVTFHGKYNFGFLLKLLTCRS  122

Query  457  LPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLL  278
            LP+T  GF+ LI MYFP V+D+KH+M+FC+ LH  LNKLAELL+VER+GVCHQAGSDSLL
Sbjct  123  LPDTLAGFYDLIKMYFPLVYDVKHMMKFCDGLHCNLNKLAELLDVERLGVCHQAGSDSLL  182

Query  277  TACTFRKLKDNFFSGSLEEYSGVLYGLGVENG  182
             AC F+KLKD FF+GS  +Y+G LYGLG+++G
Sbjct  183  VACAFQKLKDCFFNGSAVKYAGALYGLGIQDG  214



>ref|XP_008352217.1| PREDICTED: probable CCR4-associated factor 1 homolog 7, partial 
[Malus domestica]
Length=194

 Score =   313 bits (802),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  751  FSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            FSDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +
Sbjct  1    FSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASK  60

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP TQ GFF +I +YFP V+DI
Sbjct  61   FTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQVGFFKMIKVYFPTVYDI  120

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ FF GS+++Y+G
Sbjct  121  KHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETFFDGSIDKYAG  180

Query  211  VLYGLGVENG  182
            VLYGLGVENG
Sbjct  181  VLYGLGVENG  190



>ref|XP_004354599.1| CAF1 family protein [Dictyostelium fasciculatum]
 gb|EGG16215.1| CAF1 family protein [Dictyostelium fasciculatum]
Length=405

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 205/267 (77%), Gaps = 7/267 (3%)
 Frame = -1

Query  970  DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKD  791
            D+ +IREVW +NLEEE  LIRE+VDDY +IAMDTEFPGIV RPVG+F+   DYHYQTL+ 
Sbjct  10   DTDEIREVWAHNLEEEMALIRELVDDYNYIAMDTEFPGIVTRPVGSFRTPSDYHYQTLRL  69

Query  790  NVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGID  611
            NVD+LK+IQLGLTFSD  GNL +      C WQFNF+ F+ NED++A DSI+LL + GI+
Sbjct  70   NVDLLKIIQLGLTFSDSDGNLAS----NTCTWQFNFK-FNLNEDMYAQDSIDLLSRSGIE  124

Query  610  FEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFF  431
            F+KN E+GI+   FG+LLMSSGIVLN+ + W++FHSGYDFGYL+K+LTC  LP+ +  FF
Sbjct  125  FKKNEENGIDVLDFGDLLMSSGIVLNEKIKWISFHSGYDFGYLIKVLTCTALPQEEPEFF  184

Query  430  ALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK  251
             L+  YFP ++DIK+LM+ C +L GGL++LAE L+++R+G  HQAGSDSLLT  TF KL+
Sbjct  185  DLVRTYFPCIYDIKYLMKSCKNLKGGLSELAEDLDIKRIGPQHQAGSDSLLTCTTFFKLR  244

Query  250  DNFFSGSLEE--YSGVLYGLGVENGQN  176
              +F   +++  Y G+LYGL     Q+
Sbjct  245  KMYFENQIDDSKYQGILYGLTSSFSQD  271



>ref|NP_001140241.1| uncharacterized protein LOC100272282 [Zea mays]
 gb|ACF83416.1| unknown [Zea mays]
 gb|ACG35731.1| CCR4-NOT transcription complex subunit 8 [Zea mays]
 tpg|DAA48917.1| TPA: CCR4-NOT transcription complex subunit 8 [Zea mays]
Length=286

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 200/271 (74%), Gaps = 6/271 (2%)
 Frame = -1

Query  991  MSLLPKS----DSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKN  824
            M+ LP +    D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V+ P   ++ 
Sbjct  1    MAALPPAAEDPDAVEIREVWASNLEEEFAVIRAVVDVYPYVAMDTEFPGFVVTPSAEYRF  60

Query  823  SDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFAS  647
            + D +Y  L+ NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FDP+ D  +S
Sbjct  61   TCDRNYAALEGNVNVLKLIQLGLTLSNGAGALPPCGTGGRRCIWQFNFRGFDPHTDPSSS  120

Query  646  DSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILT  467
            DSI+LLR+ GIDF+     G+++ RF EL+MSSG+VLND V WVTFHSG+DFGYLLK+LT
Sbjct  121  DSIDLLRRSGIDFDLFAAEGVDSTRFAELMMSSGVVLNDDVQWVTFHSGHDFGYLLKLLT  180

Query  466  CQELPETQQGFFALINMYFPEVFDIKHLMRFC-NSLHGGLNKLAELLEVERVGVCHQAGS  290
             +E+P T   F  L   +FP ++DIKHLM+FC   L+GGL+KL ELL++ERVG+ HQAGS
Sbjct  181  GREMPNTLDEFLKLTKTFFPVMYDIKHLMKFCGGGLYGGLSKLGELLKIERVGISHQAGS  240

Query  289  DSLLTACTFRKLKDNFFSGSLEEYSGVLYGL  197
            DSLLT   F KLK  +   S++ Y GVL+GL
Sbjct  241  DSLLTLQCFMKLKQLYLKESVKLYDGVLFGL  271



>ref|XP_004337732.1| ccr4associated factor, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR15719.1| ccr4associated factor, putative [Acanthamoeba castellanii str. 
Neff]
Length=275

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 199/258 (77%), Gaps = 7/258 (3%)
 Frame = -1

Query  961  QIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNVD  782
            +IREVW  NLEEE   IR++V+DYP+IAMDTEFPGIV RP+GNFK+  +YHYQTL+ NVD
Sbjct  11   EIREVWAENLEEEMAHIRDIVEDYPYIAMDTEFPGIVARPIGNFKSPSEYHYQTLRCNVD  70

Query  781  MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEK  602
            +LK+IQLGLTF+D +G LP         WQFNF+ F   ED++A DSI+LL + GI+F++
Sbjct  71   LLKIIQLGLTFTDGEGRLPP----GVATWQFNFK-FSLTEDMYAQDSIDLLTRSGINFKR  125

Query  601  NTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALI  422
            + E G++   FGELL SSGIVL+D + W++FHSGYDFGYLLKILTC+ LP  ++ FF L+
Sbjct  126  HEEHGVDVSHFGELLTSSGIVLDDRIKWISFHSGYDFGYLLKILTCKPLPAQEEEFFELL  185

Query  421  NMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNF  242
              YFP ++DIK+LM+ C SL GGLN+LA  LEVER+G  HQAGSDSLLT+ TF K+K  F
Sbjct  186  LAYFPCIYDIKYLMKSCKSLKGGLNELANDLEVERIGPQHQAGSDSLLTSATFFKMKRMF  245

Query  241  FSGSLEE--YSGVLYGLG  194
            F  +L++  + GVLYGLG
Sbjct  246  FENNLDDSKFLGVLYGLG  263



>ref|XP_011006693.1| PREDICTED: probable CCR4-associated factor 1 homolog 11 [Populus 
euphratica]
Length=277

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 204/275 (74%), Gaps = 11/275 (4%)
 Frame = -1

Query  982  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY---  812
            + +S  I IREVW +NLE EF+LIR+++D++PFI+MDTEFPG+V RP  +  N+ +Y   
Sbjct  1    MEESKEIVIREVWSWNLESEFELIRDLIDEFPFISMDTEFPGVVFRPPVDPTNNRNYFRQ  60

Query  811  -----HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFAS  647
                 HY+ LK NVD L LIQ+GLT SD KGNLP  GT+   IW+FNFR+FD   D  A 
Sbjct  61   LKPSDHYKILKSNVDALNLIQVGLTLSDAKGNLPDLGTENRFIWEFNFRDFDVERDSHAP  120

Query  646  DSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILT  467
            DS+ELLR+ GIDFE+N E G+++ +F EL+MSSG+V N+SV WVTFHS YDFGYL+KILT
Sbjct  121  DSVELLRRQGIDFERNREEGVDSAKFAELMMSSGLVCNESVSWVTFHSAYDFGYLVKILT  180

Query  466  CQELPETQQGFFALINMYF-PEVFDIKHLMRFCNSLHGGLNKLAELLEVER-VGVCHQAG  293
             QELP    GF +L+ ++F   ++D+KH+MRFC SL+GGL+++A  LEV R VG CHQAG
Sbjct  181  RQELPSRLVGFLSLLRVFFGNNIYDVKHMMRFCKSLYGGLDRVARTLEVNREVGKCHQAG  240

Query  292  SDSLLTACTFRKLKDNFF-SGSLEEYSGVLYGLGV  191
            SDSLLT   F+K++D FF     E+++GVLYGL V
Sbjct  241  SDSLLTWHAFQKMRDVFFVKDGPEQHAGVLYGLEV  275



>ref|XP_002444415.1| hypothetical protein SORBIDRAFT_07g021610 [Sorghum bicolor]
 gb|EES13910.1| hypothetical protein SORBIDRAFT_07g021610 [Sorghum bicolor]
Length=286

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 198/261 (76%), Gaps = 2/261 (1%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  794
             D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V++P   ++ + D +Y  L+
Sbjct  11   PDAVEIREVWAGNLEEEFAVIRAVVDAYPYVAMDTEFPGFVVKPSAEYRFTCDRNYAALE  70

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCG  617
             NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FDP+ D  ++DSI+LLR+ G
Sbjct  71   GNVNVLKLIQLGLTLSNGAGALPPCGTGGRGCIWQFNFRGFDPHTDPSSNDSIDLLRRSG  130

Query  616  IDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQG  437
            IDF++    G+++ RF EL+MSSGIVLND V WVTFHSG+DFGYLL++LT +E+P T   
Sbjct  131  IDFDRFAAEGVDSTRFAELMMSSGIVLNDDVQWVTFHSGHDFGYLLRLLTGREMPNTLDE  190

Query  436  FFALINMYFPEVFDIKHLMRFC-NSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            F  L   +FP ++DIKHLM+FC   L+GGL+KL ELL+VERVG+ HQAGSDSLLT   F 
Sbjct  191  FLKLTKTFFPVLYDIKHLMKFCGGGLYGGLSKLGELLKVERVGIGHQAGSDSLLTLQCFM  250

Query  259  KLKDNFFSGSLEEYSGVLYGL  197
            KLK  + + S++ Y GVL+GL
Sbjct  251  KLKQLYLNESVKLYDGVLFGL  271



>ref|XP_006854720.2| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Amborella 
trichopoda]
Length=300

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 195/260 (75%), Gaps = 1/260 (0%)
 Frame = -1

Query  964  IQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLKDNV  785
            I+IREVW  NLEEEF LI ++VD +P++AMDTEFPG+V +P   ++   D+ YQTLK NV
Sbjct  10   IEIREVWAENLEEEFALITDLVDRFPYVAMDTEFPGVVFKPSTTYETYSDFLYQTLKVNV  69

Query  784  DMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFE  605
            D L LIQ+GLTF+D  GNLP  GTD   IWQFNF++FD ++ +++  SI LL + GIDF+
Sbjct  70   DALNLIQVGLTFADSTGNLPDLGTDSQFIWQFNFKDFDLSKHLYSPASISLLEKHGIDFK  129

Query  604  KNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFAL  425
            KN  +GI++++F +LLM SG++ N  V WVTFHS YDFGYLLK+LTC E+P   + F A+
Sbjct  130  KNLTAGIDSKQFTDLLMRSGVMCNHRVTWVTFHSAYDFGYLLKLLTCAEMPGELELFLAM  189

Query  424  INMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVER-VGVCHQAGSDSLLTACTFRKLKD  248
            +  YF E++D+K++M++C  L+GGL +LAE L V+R VG CHQAGSDSLLT   F  L+D
Sbjct  190  VKAYFGEIYDLKYMMKYCGGLYGGLARLAEALNVDRAVGSCHQAGSDSLLTWHAFVALRD  249

Query  247  NFFSGSLEEYSGVLYGLGVE  188
             FF G  E Y+GVLYGLGV+
Sbjct  250  RFFGGVTEPYAGVLYGLGVD  269



>ref|XP_008676671.1| PREDICTED: uncharacterized protein LOC100216888 isoform X1 [Zea 
mays]
Length=308

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 191/277 (69%), Gaps = 47/277 (17%)
 Frame = -1

Query  1000 DWKMSLLPK-----SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVG  836
            D   +++PK      +S++IREVW  N+EEEF LIR++VD+YPF+AMDTEFPGIV RPVG
Sbjct  67   DLTATVIPKLGEADDESVEIREVWADNMEEEFALIRDIVDEYPFVAMDTEFPGIVCRPVG  126

Query  835  NFKNSDDYHYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNED  659
             F++  DY+Y TLK NVDML LIQLGLTFS  +G LP  G   + C+WQFNFREFD   D
Sbjct  127  AFRSPADYNYATLKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFDDARD  186

Query  658  VFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLL  479
            +FASDSIELLR+ GID   N E G++ARRF ELLMSSG+VLNDSV+WVTFH+GYDFG   
Sbjct  187  IFASDSIELLRRSGIDLRLNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFG---  243

Query  478  KILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQ  299
                                                  LHGGLNKLAELL+VERVG  HQ
Sbjct  244  --------------------------------------LHGGLNKLAELLDVERVGESHQ  265

Query  298  AGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVE  188
            AGSDSL+T+C F KLKD+FF+GS E+Y+GVLYGL  E
Sbjct  266  AGSDSLVTSCAFWKLKDSFFTGSTEKYAGVLYGLNAE  302



>gb|EMT24915.1| Putative CCR4-associated factor 1-7-like protein [Aegilops tauschii]
Length=205

 Score =   310 bits (794),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 168/201 (84%), Gaps = 1/201 (0%)
 Frame = -1

Query  781  MLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFE  605
            ML LIQLGLTFS   G LP  G  +  C+WQFNFREFD   D+FA+DSIELLR  GIDF 
Sbjct  1    MLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGIDFR  60

Query  604  KNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFAL  425
            +N E G++ARRF ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L
Sbjct  61   RNAERGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKL  120

Query  424  INMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDN  245
            + +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+
Sbjct  121  MKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDS  180

Query  244  FFSGSLEEYSGVLYGLGVENG  182
            FF+GS E+Y+GVLYGL  ENG
Sbjct  181  FFAGSTEKYAGVLYGLNAENG  201



>gb|AGT16865.1| transcription complex [Saccharum hybrid cultivar R570]
Length=286

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/261 (58%), Positives = 196/261 (75%), Gaps = 2/261 (1%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  794
             D+++IREVW  NLEEEF +IR VVD YP++AMDTEFPG V++P   ++ + D +Y  L+
Sbjct  11   PDAVEIREVWAGNLEEEFAVIRAVVDAYPYVAMDTEFPGFVVKPSAEYRFTCDRNYAALE  70

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCG  617
             NV++LKLIQLGLT S+  G LP CGT  + CIWQFNFR FDP+ D  ++DSI+LLR+ G
Sbjct  71   GNVNVLKLIQLGLTLSNGAGALPPCGTGGRGCIWQFNFRGFDPHTDPSSNDSIDLLRRSG  130

Query  616  IDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQG  437
            IDF++    G+++ RF EL+MSSGIVLND V WVTFHSG+DFGYLL++LT +E+P T   
Sbjct  131  IDFDRFAAEGVDSTRFAELMMSSGIVLNDDVQWVTFHSGHDFGYLLRLLTGREMPNTLDE  190

Query  436  FFALINMYFPEVFDIKHLMRFC-NSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  260
            F  L   +FP ++DIKHLM+FC   L+GGL+KL ELL++ERVG+ HQAGSDSLLT   F 
Sbjct  191  FLKLTKTFFPVLYDIKHLMKFCGGGLYGGLSKLGELLKIERVGIGHQAGSDSLLTLQCFM  250

Query  259  KLKDNFFSGSLEEYSGVLYGL  197
            KLK  +   S+  Y GVL+GL
Sbjct  251  KLKQLYLKESVNLYDGVLFGL  271



>ref|XP_011006712.1| PREDICTED: probable CCR4-associated factor 1 homolog 11 [Populus 
euphratica]
Length=277

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 204/275 (74%), Gaps = 11/275 (4%)
 Frame = -1

Query  982  LPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDY---  812
            + +S  I IREVW +NLE EF+LIR+++D++PFI+MDTEFPG+V RP  +  N+ +Y   
Sbjct  1    MEESKEIVIREVWSWNLESEFELIRDLIDEFPFISMDTEFPGVVFRPPVDPTNNRNYFRQ  60

Query  811  -----HYQTLKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFAS  647
                 HY+ LK NVD L LIQ+GLT SD KGNLP  GT+   IW+FNFR+FD   D  A 
Sbjct  61   LKPSDHYKILKSNVDALNLIQVGLTLSDAKGNLPDLGTENRFIWEFNFRDFDVERDSHAP  120

Query  646  DSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILT  467
            DS+ELLR+ GIDFE+N E G+++ +F EL+MSSG+V N+SV WVTFHS YDFGYL+KI+T
Sbjct  121  DSVELLRRQGIDFERNREEGVDSAKFAELMMSSGLVCNESVSWVTFHSAYDFGYLVKIIT  180

Query  466  CQELPETQQGFFALINMYF-PEVFDIKHLMRFCNSLHGGLNKLAELLEVER-VGVCHQAG  293
             +ELP    GF +L+ ++F   ++D+KH+MRFC SL+GGL+++A  LEV R VG CHQAG
Sbjct  181  RRELPSGLVGFLSLLRVFFGNNIYDVKHMMRFCKSLYGGLDRVARTLEVNREVGKCHQAG  240

Query  292  SDSLLTACTFRKLKDNFF-SGSLEEYSGVLYGLGV  191
            SDSLLT   F+K++D FF     E+++GVLYGL V
Sbjct  241  SDSLLTWHAFQKMRDVFFVKDGPEQHAGVLYGLEV  275



>ref|XP_010469633.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=252

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 194/273 (71%), Gaps = 31/273 (11%)
 Frame = -1

Query  991  MSLLPKSDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMD-----TEFPGIVLRPVGNFK  827
            MSL  K DSIQIREV   NLE E  LIR  VDD+PF+ M      ++FP IVL   G F 
Sbjct  1    MSLFAKEDSIQIREVCRENLESEMCLIRAAVDDFPFVGMVCRPVVSDFPEIVL---GTFN  57

Query  826  NSDDYHYQTLKDNVD-MLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFA  650
               +Y+Y+TLK NV+ +++++QLGLT SDE GNLPTC TDKYC WQFN R          
Sbjct  58   TLTEYNYETLKTNVNNIVEMLQLGLTLSDENGNLPTCETDKYCTWQFNIR----------  107

Query  649  SDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKIL  470
                        +  +N ++GI+   F  L+MSSG VLN+SVHWVTFH GYD GYLLK+L
Sbjct  108  ------------NVAENNQTGIDPEEFANLMMSSGTVLNESVHWVTFHGGYDVGYLLKLL  155

Query  469  TCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGS  290
            T Q LPETQ GFF +I++YFP V+D+KHLM+FCN  +G LN LAELL+VERVG+ HQAGS
Sbjct  156  TNQNLPETQSGFFEMISLYFPRVYDVKHLMKFCNDAYGDLNYLAELLDVERVGISHQAGS  215

Query  289  DSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGV  191
            DSLLT+CTFRKL++ FF GS+E+YSGVL+GLGV
Sbjct  216  DSLLTSCTFRKLQEVFFIGSIEKYSGVLFGLGV  248



>ref|XP_003074753.1| Caf1 CCR4-associated (transcription) factor, putative (IC) [Ostreococcus 
tauri]
Length=275

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 195/262 (74%), Gaps = 4/262 (2%)
 Frame = -1

Query  973  SDSIQIREVWDYNLEEEFDLIREVVDDYPFIAMDTEFPGIVLRPVGNFKNSDDYHYQTLK  794
            + +++ R+VW +NL+EE  LIRE+V  YPF+AMDTEFPGIV RPVG+FK+  ++ YQTL+
Sbjct  5    ASNLRTRDVWAHNLDEECTLIREIVSAYPFVAMDTEFPGIVARPVGSFKHQSEFQYQTLR  64

Query  793  DNVDMLKLIQLGLTFSDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCG  617
             NVDMLKLIQLGLTF+D  GNLP    D Y CIWQFNFREF   ++++A DSIELL+  G
Sbjct  65   CNVDMLKLIQLGLTFTDADGNLPL--IDGYHCIWQFNFREFSLKDELYAQDSIELLKHSG  122

Query  616  IDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQG  437
            IDF    E GI+  +FGE LM SG+VLN+ + W+TFHSGYDFGYLLK+L    LPE +  
Sbjct  123  IDFNTLEERGIDVVQFGESLMVSGVVLNEDIRWLTFHSGYDFGYLLKLLVNAPLPENETE  182

Query  436  FFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRK  257
            FF L+  YFP + DIKHL++   ++HGGL+KLAE L V R+G  HQAGSDSLLTA TF K
Sbjct  183  FFELLRCYFPYIIDIKHLVQCVGNMHGGLSKLAEHLSVARIGPQHQAGSDSLLTAHTFFK  242

Query  256  L-KDNFFSGSLEEYSGVLYGLG  194
            L K +F +  L ++ G LYGLG
Sbjct  243  LQKTHFMNVDLNQFVGTLYGLG  264



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3246351156509