BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8098

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363519.1|  PREDICTED: kinesin-1-like                          208   6e-59   Solanum tuberosum [potatoes]
ref|XP_009630428.1|  PREDICTED: kinesin-3-like                          206   5e-58   Nicotiana tomentosiformis
ref|XP_004251479.1|  PREDICTED: kinesin-3-like                          203   4e-57   Solanum lycopersicum
ref|XP_009787399.1|  PREDICTED: kinesin-3-like                          202   6e-57   Nicotiana sylvestris
ref|XP_006360099.1|  PREDICTED: kinesin-1-like                          202   7e-57   Solanum tuberosum [potatoes]
ref|XP_004244160.1|  PREDICTED: kinesin-3                               202   8e-57   Solanum lycopersicum
ref|XP_011095312.1|  PREDICTED: kinesin-3-like                          198   3e-55   Sesamum indicum [beniseed]
ref|XP_011097929.1|  PREDICTED: kinesin-3                               190   2e-52   Sesamum indicum [beniseed]
ref|XP_009794105.1|  PREDICTED: kinesin-3-like                          187   2e-51   Nicotiana sylvestris
gb|EYU33594.1|  hypothetical protein MIMGU_mgv1a004905mg                182   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_002282749.2|  PREDICTED: kinesin-3 isoform X1                    182   1e-49   Vitis vinifera
emb|CAN78128.1|  hypothetical protein VITISV_028758                     182   1e-49   Vitis vinifera
ref|XP_009624731.1|  PREDICTED: kinesin-3-like                          182   2e-49   Nicotiana tomentosiformis
emb|CDP05808.1|  unnamed protein product                                177   9e-48   Coffea canephora [robusta coffee]
gb|KDO46380.1|  hypothetical protein CISIN_1g003711mg                   166   7e-45   Citrus sinensis [apfelsine]
ref|XP_010267812.1|  PREDICTED: kinesin-1 isoform X1                    168   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006475301.1|  PREDICTED: kinesin-3-like isoform X2               167   4e-44   Citrus sinensis [apfelsine]
gb|KDO46379.1|  hypothetical protein CISIN_1g003711mg                   165   2e-43   Citrus sinensis [apfelsine]
ref|XP_006475300.1|  PREDICTED: kinesin-3-like isoform X1               165   2e-43   Citrus sinensis [apfelsine]
ref|XP_007021094.1|  Kinesin-1 isoform 5                                162   3e-43   
ref|XP_007021092.1|  Kinesin 3 isoform 3                                163   9e-43   
ref|XP_007021090.1|  Kinesin 3 isoform 1                                163   1e-42   
ref|XP_007021091.1|  Kinesin 3 isoform 2                                163   1e-42   
ref|XP_010247011.1|  PREDICTED: kinesin-5-like                          162   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_012070721.1|  PREDICTED: kinesin-3 isoform X1                    159   2e-41   Jatropha curcas
ref|XP_012070722.1|  PREDICTED: kinesin-3 isoform X2                    155   5e-40   Jatropha curcas
gb|KJB13566.1|  hypothetical protein B456_002G081700                    155   8e-40   Gossypium raimondii
gb|KHG03491.1|  Kinesin-3 -like protein                                 154   2e-39   Gossypium arboreum [tree cotton]
gb|KJB62642.1|  hypothetical protein B456_009G427400                    149   1e-37   Gossypium raimondii
gb|KJB62640.1|  hypothetical protein B456_009G427400                    149   2e-37   Gossypium raimondii
emb|CBI33223.3|  unnamed protein product                                147   7e-37   Vitis vinifera
ref|XP_002265300.1|  PREDICTED: kinesin-1-like                          147   8e-37   Vitis vinifera
gb|KJB62644.1|  hypothetical protein B456_009G427400                    142   3e-35   Gossypium raimondii
ref|XP_003540037.1|  PREDICTED: kinesin-3-like isoform 1                141   6e-35   Glycine max [soybeans]
ref|XP_002522825.1|  kinesin, putative                                  141   8e-35   
ref|XP_010644322.1|  PREDICTED: kinesin-3 isoform X2                    140   2e-34   Vitis vinifera
gb|KJB13567.1|  hypothetical protein B456_002G081700                    139   5e-34   Gossypium raimondii
gb|KJB62645.1|  hypothetical protein B456_009G427400                    137   1e-33   Gossypium raimondii
ref|XP_004151963.1|  PREDICTED: kinesin-3 isoform X2                    137   2e-33   Cucumis sativus [cucumbers]
ref|XP_010694266.1|  PREDICTED: kinesin-3 isoform X1                    137   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694268.1|  PREDICTED: kinesin-3 isoform X2                    137   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006452144.1|  hypothetical protein CICLE_v10007548mg             136   3e-33   
ref|XP_010062956.1|  PREDICTED: kinesin-3 isoform X1                    136   4e-33   Eucalyptus grandis [rose gum]
gb|KHN47841.1|  Kinesin-3                                               135   6e-33   Glycine soja [wild soybean]
ref|XP_008454567.1|  PREDICTED: kinesin-3 isoform X2                    135   1e-32   Cucumis melo [Oriental melon]
ref|XP_007132984.1|  hypothetical protein PHAVU_011G141500g             134   3e-32   Phaseolus vulgaris [French bean]
ref|XP_008244338.1|  PREDICTED: kinesin-3                               131   2e-31   Prunus mume [ume]
ref|XP_007213621.1|  hypothetical protein PRUPE_ppa002138mg             130   4e-31   
ref|XP_011651463.1|  PREDICTED: kinesin-3 isoform X1                    129   9e-31   Cucumis sativus [cucumbers]
ref|XP_011621059.1|  PREDICTED: kinesin-1                               129   1e-30   Amborella trichopoda
ref|XP_010092308.1|  hypothetical protein L484_021170                   128   2e-30   Morus notabilis
ref|XP_006467955.1|  PREDICTED: kinesin-1-like                          128   4e-30   Citrus sinensis [apfelsine]
ref|XP_008454566.1|  PREDICTED: kinesin-3 isoform X1                    127   5e-30   Cucumis melo [Oriental melon]
gb|KEH30756.1|  kinesin motor catalytic domain protein                  126   1e-29   Medicago truncatula
ref|XP_006449138.1|  hypothetical protein CICLE_v10014313mg             126   1e-29   Citrus clementina [clementine]
ref|XP_011048279.1|  PREDICTED: kinesin-3 isoform X2                    125   2e-29   Populus euphratica
ref|XP_003636711.1|  Kinesin-3                                          125   2e-29   
ref|XP_011048277.1|  PREDICTED: kinesin-3 isoform X1                    125   2e-29   Populus euphratica
ref|XP_006370608.1|  KINESIN-LIKE protein C                             125   3e-29   Populus trichocarpa [western balsam poplar]
gb|AES89902.2|  kinesin motor catalytic domain protein                  125   3e-29   Medicago truncatula
ref|XP_004505473.1|  PREDICTED: kinesin-3-like                          125   4e-29   Cicer arietinum [garbanzo]
ref|XP_002316967.2|  KINESIN-LIKE protein C                             124   5e-29   
gb|EPS70906.1|  hypothetical protein M569_03849                         124   6e-29   Genlisea aurea
gb|KHN27981.1|  Kinesin-3                                               124   7e-29   Glycine soja [wild soybean]
ref|XP_003543287.1|  PREDICTED: kinesin-3-like isoform X1               124   8e-29   Glycine max [soybeans]
ref|XP_010267813.1|  PREDICTED: kinesin-1 isoform X2                    123   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004294333.1|  PREDICTED: kinesin-3                               123   1e-28   Fragaria vesca subsp. vesca
ref|XP_003527313.2|  PREDICTED: kinesin-3-like isoform X1               123   2e-28   Glycine max [soybeans]
ref|XP_007149688.1|  hypothetical protein PHAVU_005G090700g             123   2e-28   Phaseolus vulgaris [French bean]
ref|XP_010539269.1|  PREDICTED: kinesin-3                               122   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_008355352.1|  PREDICTED: kinesin-3-like                          122   3e-28   Malus domestica [apple tree]
ref|XP_003540423.1|  PREDICTED: kinesin-3-like                          122   3e-28   Glycine max [soybeans]
ref|XP_009358086.1|  PREDICTED: kinesin-3-like                          122   3e-28   Pyrus x bretschneideri [bai li]
gb|KHN36737.1|  Kinesin-3                                               122   5e-28   Glycine soja [wild soybean]
gb|KHN20442.1|  Kinesin-3                                               121   5e-28   Glycine soja [wild soybean]
ref|XP_009127074.1|  PREDICTED: kinesin-3                               121   8e-28   Brassica rapa
ref|XP_003607705.1|  Kinesin-3                                          120   1e-27   
ref|XP_009355573.1|  PREDICTED: kinesin-3-like isoform X1               120   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_009355574.1|  PREDICTED: kinesin-3-like isoform X2               120   1e-27   
ref|XP_007132983.1|  hypothetical protein PHAVU_011G141500g             120   2e-27   Phaseolus vulgaris [French bean]
ref|XP_008371206.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-1-like     119   3e-27   
ref|XP_008345855.1|  PREDICTED: kinesin-1-like                          119   3e-27   
gb|KCW70118.1|  hypothetical protein EUGRSUZ_F03419                     117   4e-27   Eucalyptus grandis [rose gum]
ref|XP_006401547.1|  hypothetical protein EUTSA_v10012765mg             119   4e-27   Eutrema salsugineum [saltwater cress]
gb|KCW70117.1|  hypothetical protein EUGRSUZ_F03419                     118   6e-27   Eucalyptus grandis [rose gum]
ref|XP_010062957.1|  PREDICTED: kinesin-3 isoform X2                    119   6e-27   Eucalyptus grandis [rose gum]
emb|CDY06633.1|  BnaC02g13570D                                          118   7e-27   
gb|KCW70116.1|  hypothetical protein EUGRSUZ_F03419                     118   8e-27   Eucalyptus grandis [rose gum]
gb|KCW70115.1|  hypothetical protein EUGRSUZ_F03419                     118   9e-27   Eucalyptus grandis [rose gum]
ref|XP_009366635.1|  PREDICTED: kinesin-1                               117   1e-26   Pyrus x bretschneideri [bai li]
emb|CDY28759.1|  BnaA02g09510D                                          117   1e-26   Brassica napus [oilseed rape]
ref|XP_011030892.1|  PREDICTED: kinesin-3-like                          117   1e-26   Populus euphratica
emb|CDY67586.1|  BnaC09g53250D                                          117   1e-26   Brassica napus [oilseed rape]
ref|XP_008386025.1|  PREDICTED: kinesin-3                               117   2e-26   
ref|XP_010910020.1|  PREDICTED: kinesin-5-like                          117   2e-26   Elaeis guineensis
ref|XP_009119997.1|  PREDICTED: kinesin-3                               116   4e-26   Brassica rapa
dbj|BAB09933.1|  kinesin-like protein                                   115   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568811.1|  kinesin 3                                             115   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441621.1|  PREDICTED: kinesin-1                               115   1e-25   Cucumis melo [Oriental melon]
gb|ERM99862.1|  hypothetical protein AMTR_s00098p00155820               115   1e-25   Amborella trichopoda
ref|XP_006280058.1|  hypothetical protein CARUB_v10025939mg             114   2e-25   Capsella rubella
emb|CDY68543.1|  BnaA10g28890D                                          114   3e-25   Brassica napus [oilseed rape]
ref|XP_010482874.1|  PREDICTED: kinesin-3-like                          114   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010520868.1|  PREDICTED: kinesin-3-like isoform X1               112   7e-25   Tarenaya hassleriana [spider flower]
ref|XP_010520870.1|  PREDICTED: kinesin-3-like isoform X2               112   7e-25   
ref|XP_010448473.1|  PREDICTED: kinesin-3-like                          112   9e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010443046.1|  PREDICTED: kinesin-3                               112   9e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010931847.1|  PREDICTED: kinesin-5 isoform X1                    112   1e-24   Elaeis guineensis
ref|XP_010931849.1|  PREDICTED: kinesin-5 isoform X2                    112   1e-24   Elaeis guineensis
ref|XP_004154168.1|  PREDICTED: kinesin-1                               111   2e-24   Cucumis sativus [cucumbers]
ref|XP_004487619.1|  PREDICTED: kinesin-3-like isoform X1               110   3e-24   Cicer arietinum [garbanzo]
ref|XP_010510050.1|  PREDICTED: kinesin-3-like                          107   9e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008778970.1|  PREDICTED: kinesin-5-like isoform X2               109   9e-24   Phoenix dactylifera
ref|XP_008224876.1|  PREDICTED: kinesin-1                               109   1e-23   Prunus mume [ume]
ref|XP_008778969.1|  PREDICTED: kinesin-5-like isoform X1               109   1e-23   Phoenix dactylifera
ref|XP_003596607.1|  Kinesin-like protein                               109   1e-23   Medicago truncatula
ref|XP_010449752.1|  PREDICTED: kinesin-3-like                          108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010511309.1|  PREDICTED: kinesin-3-like isoform X1               108   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010425918.1|  PREDICTED: kinesin-3-like isoform X1               108   1e-23   
ref|XP_010425149.1|  PREDICTED: kinesin-3-like isoform X1               108   1e-23   
ref|XP_003596608.1|  Kinesin-like protein                               108   2e-23   
ref|XP_004485663.1|  PREDICTED: kinesin-1-like                          107   5e-23   Cicer arietinum [garbanzo]
ref|XP_007214637.1|  hypothetical protein PRUPE_ppa001567mg             106   9e-23   Prunus persica
ref|XP_008813777.1|  PREDICTED: kinesin-3-like isoform X2               101   1e-22   
ref|XP_003541768.1|  PREDICTED: kinesin-1-like                          105   2e-22   Glycine max [soybeans]
ref|XP_008813775.1|  PREDICTED: kinesin-5-like isoform X1               101   3e-22   
ref|XP_011012472.1|  PREDICTED: kinesin-1-like                          104   5e-22   Populus euphratica
gb|KHG15484.1|  Kinesin-1 -like protein                                 103   8e-22   Gossypium arboreum [tree cotton]
ref|XP_006413102.1|  hypothetical protein EUTSA_v10024503mg             103   1e-21   Eutrema salsugineum [saltwater cress]
gb|KFK29228.1|  hypothetical protein AALP_AA7G106500                    103   1e-21   Arabis alpina [alpine rockcress]
ref|XP_006285461.1|  hypothetical protein CARUB_v10006879mg             103   1e-21   Capsella rubella
ref|XP_010686936.1|  PREDICTED: kinesin-1-like                          102   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003545783.1|  PREDICTED: kinesin-1-like                          102   2e-21   Glycine max [soybeans]
ref|XP_010438647.1|  PREDICTED: kinesin-2                               102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_012091426.1|  PREDICTED: kinesin-1                               102   3e-21   Jatropha curcas
ref|XP_002316704.1|  KINESIN-LIKE protein A                             102   4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010999547.1|  PREDICTED: kinesin-1-like isoform X3               102   4e-21   Populus euphratica
ref|XP_010999545.1|  PREDICTED: kinesin-1-like isoform X1               102   4e-21   Populus euphratica
ref|XP_010999546.1|  PREDICTED: kinesin-1-like isoform X2               101   6e-21   Populus euphratica
gb|EPS63940.1|  hypothetical protein M569_10842                       98.6    8e-21   Genlisea aurea
ref|NP_567768.1|  kinesin 2                                             100   9e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAB38848.1|  kinesin-related protein katB                           100   9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010088100.1|  hypothetical protein L484_014846                   100   1e-20   
ref|XP_006396621.1|  hypothetical protein EUTSA_v10028442mg           99.4    3e-20   Eutrema salsugineum [saltwater cress]
ref|XP_011003399.1|  PREDICTED: kinesin-1-like isoform X1             99.4    3e-20   Populus euphratica
ref|XP_009143182.1|  PREDICTED: kinesin-2                             99.4    3e-20   Brassica rapa
ref|XP_011003402.1|  PREDICTED: kinesin-1-like isoform X3             99.4    3e-20   Populus euphratica
ref|XP_002304982.1|  KINESIN-LIKE protein A                           99.4    3e-20   Populus trichocarpa [western balsam poplar]
emb|CDX89269.1|  BnaA01g16240D                                        99.0    4e-20   
ref|XP_009393339.1|  PREDICTED: kinesin-5-like isoform X2             99.0    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY29282.1|  BnaC01g19340D                                        99.0    4e-20   Brassica napus [oilseed rape]
ref|XP_009393340.1|  PREDICTED: kinesin-5-like isoform X3             99.0    4e-20   
ref|XP_009393338.1|  PREDICTED: kinesin-5-like isoform X1             99.0    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529372.1|  PREDICTED: kinesin-1-like                        98.2    9e-20   Tarenaya hassleriana [spider flower]
ref|XP_011003401.1|  PREDICTED: kinesin-1-like isoform X2             96.7    2e-19   Populus euphratica
ref|XP_010057684.1|  PREDICTED: kinesin-1-like                        96.3    4e-19   Eucalyptus grandis [rose gum]
ref|XP_007025915.1|  Kinesin 1                                        95.5    6e-19   Theobroma cacao [chocolate]
ref|XP_010434203.1|  PREDICTED: kinesin-1-like                        95.5    7e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003593375.1|  Kinesin-like protein                             94.7    1e-18   
gb|AES63626.2|  kinesin motor catalytic domain protein                94.7    1e-18   Medicago truncatula
gb|KFK32217.1|  hypothetical protein AALP_AA6G213100                  94.4    2e-18   Arabis alpina [alpine rockcress]
ref|XP_010449096.1|  PREDICTED: kinesin-1-like                        94.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010538054.1|  PREDICTED: kinesin-1 isoform X2                  92.4    8e-18   Tarenaya hassleriana [spider flower]
ref|XP_010538046.1|  PREDICTED: kinesin-1 isoform X1                  92.4    9e-18   Tarenaya hassleriana [spider flower]
gb|KJB69351.1|  hypothetical protein B456_011G018600                  91.7    1e-17   Gossypium raimondii
gb|KHG03570.1|  Kinesin-1 -like protein                               91.7    1e-17   Gossypium arboreum [tree cotton]
emb|CAA20193.1|  kinesin-related protein katA (fragment)              89.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010059163.1|  PREDICTED: kinesin-3-like                        89.4    2e-17   
gb|KFK32218.1|  hypothetical protein AALP_AA6G213200                  90.9    3e-17   Arabis alpina [alpine rockcress]
ref|XP_009420213.1|  PREDICTED: kinesin-5-like                        90.1    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_193859.1|  kinesin-like motor protein heavy chain              90.1    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003528413.1|  PREDICTED: kinesin-1-like                        89.0    1e-16   Glycine max [soybeans]
ref|XP_002867856.1|  hypothetical protein ARALYDRAFT_914554           88.6    1e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_003532576.1|  PREDICTED: kinesin-1-like isoform X1             88.6    1e-16   Glycine max [soybeans]
ref|XP_010439497.1|  PREDICTED: kinesin-1                             88.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006584943.1|  PREDICTED: kinesin-1-like isoform X2             88.6    2e-16   Glycine max [soybeans]
ref|XP_010931850.1|  PREDICTED: kinesin-5 isoform X3                  88.2    2e-16   
ref|XP_002518570.1|  kinesin, putative                                87.8    3e-16   Ricinus communis
gb|AID21575.1|  AT4G21270p                                            86.7    6e-16   Arabidopsis halleri
dbj|BAF01074.1|  kinesin like protein                                 85.1    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431590.1|  PREDICTED: kinesin-5                             86.7    7e-16   Camelina sativa [gold-of-pleasure]
ref|NP_192428.2|  kinesin 5                                           86.3    9e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39158.1|  BnaC09g21860D                                        85.1    2e-15   Brassica napus [oilseed rape]
ref|XP_009114495.1|  PREDICTED: kinesin-5                             85.1    2e-15   Brassica rapa
gb|AAQ82843.1|  At4g05190                                             84.7    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KJB57694.1|  hypothetical protein B456_009G175800                  84.0    5e-15   Gossypium raimondii
ref|XP_007148296.1|  hypothetical protein PHAVU_006G196400g           83.6    7e-15   Phaseolus vulgaris [French bean]
emb|CDY46372.1|  BnaA09g19860D                                        82.8    1e-14   Brassica napus [oilseed rape]
emb|CAB81061.1|  kinesin-like protein                                 81.6    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872739.1|  hypothetical protein ARALYDRAFT_490168           81.6    3e-14   
emb|CAJ86215.1|  H0323C08.7                                           80.9    6e-14   Oryza sativa [red rice]
gb|KHN45723.1|  Kinesin-1                                             80.1    9e-14   Glycine soja [wild soybean]
emb|CAE04256.3|  OSJNBa0089N06.17                                     79.0    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053970.1|  Os04g0629700                                     79.0    2e-13   
ref|XP_006282798.1|  hypothetical protein CARUB_v10006408mg           78.6    3e-13   Capsella rubella
ref|XP_004504898.1|  PREDICTED: kinesin-1-like                        78.6    3e-13   Cicer arietinum [garbanzo]
ref|XP_006653796.1|  PREDICTED: kinesin-5-like                        78.2    4e-13   Oryza brachyantha
ref|XP_006287092.1|  hypothetical protein CARUB_v10000254mg           77.8    6e-13   Capsella rubella
gb|AID21622.1|  At4g21270*p-like protein                              72.4    1e-12   Arabidopsis lyrata [lyrate rockcress]
gb|KJB62643.1|  hypothetical protein B456_009G427400                  76.6    1e-12   Gossypium raimondii
ref|XP_010456930.1|  PREDICTED: kinesin-5-like                        76.6    1e-12   
ref|XP_010422415.1|  PREDICTED: kinesin-5-like                        76.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004309668.1|  PREDICTED: kinesin-1 isoform X1                  75.9    2e-12   Fragaria vesca subsp. vesca
ref|XP_003580611.1|  PREDICTED: kinesin-5-like                        75.5    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_008668838.1|  PREDICTED: kinesin-5                             74.7    6e-12   
tpg|DAA35856.1|  TPA: kinesin heavy chain                             74.3    7e-12   
ref|XP_011470975.1|  PREDICTED: kinesin-1 isoform X2                  73.6    1e-11   Fragaria vesca subsp. vesca
ref|XP_004490719.1|  PREDICTED: kinesin-3-like isoform X2             68.9    3e-11   
ref|XP_004490718.1|  PREDICTED: kinesin-3-like isoform X1             68.6    3e-11   
ref|XP_002448583.1|  hypothetical protein SORBIDRAFT_06g029500        71.6    5e-11   Sorghum bicolor [broomcorn]
ref|XP_008780377.1|  PREDICTED: kinesin-2-like isoform X3             66.2    8e-11   
ref|XP_008780379.1|  PREDICTED: kinesin-3-like isoform X5             65.5    9e-11   
ref|XP_004976910.1|  PREDICTED: kinesin-5-like isoform X1             70.5    1e-10   
ref|XP_004976911.1|  PREDICTED: kinesin-5-like isoform X2             70.5    1e-10   Setaria italica
gb|KHG01598.1|  Kinesin-3 -like protein                               70.1    2e-10   Gossypium arboreum [tree cotton]
ref|XP_007159206.1|  hypothetical protein PHAVU_002G218100g           68.9    4e-10   Phaseolus vulgaris [French bean]
ref|XP_007159205.1|  hypothetical protein PHAVU_002G218100g           68.6    5e-10   Phaseolus vulgaris [French bean]
ref|XP_009419596.1|  PREDICTED: kinesin-5-like                        68.6    6e-10   
ref|XP_008780376.1|  PREDICTED: kinesin-2-like isoform X2             61.6    3e-09   
ref|XP_008780378.1|  PREDICTED: kinesin-3-like isoform X4             61.2    3e-09   
gb|EMT04945.1|  Kinesin-1                                             65.9    4e-09   
dbj|BAK04104.1|  predicted protein                                    65.5    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS64454.1|  Kinesin-1                                             65.5    5e-09   Triticum urartu
ref|XP_008779320.1|  PREDICTED: kinesin-2-like isoform X2             60.8    8e-09   
gb|EAZ38419.1|  hypothetical protein OsJ_22797                        63.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779319.1|  PREDICTED: kinesin-2-like isoform X1             60.5    2e-08   
gb|EEC81381.1|  hypothetical protein OsI_24592                        63.9    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004987260.1|  PREDICTED: kinesin-5-like                        63.9    2e-08   
ref|XP_006658202.1|  PREDICTED: kinesin-5-like                        63.5    2e-08   
ref|XP_002965713.1|  hypothetical protein SELMODRAFT_84710            62.4    4e-08   
ref|XP_002971618.1|  hypothetical protein SELMODRAFT_95452            62.4    5e-08   
ref|XP_008651920.1|  PREDICTED: kinesin-5                             62.4    5e-08   
ref|XP_002461304.1|  hypothetical protein SORBIDRAFT_02g000560        61.2    1e-07   Sorghum bicolor [broomcorn]
gb|KHN33612.1|  Kinesin-1                                             60.8    1e-07   Glycine soja [wild soybean]
gb|ACL53698.1|  unknown                                               60.5    1e-07   Zea mays [maize]
gb|KEH31186.1|  kinesin motor catalytic domain protein                57.8    1e-06   Medicago truncatula
dbj|BAJ90626.1|  predicted protein                                    54.7    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002865499.1|  predicted protein                                48.5    1e-04   
ref|XP_008780375.1|  PREDICTED: kinesin-3-like isoform X1             48.1    4e-04   
ref|XP_002962919.1|  hypothetical protein SELMODRAFT_78306            50.1    5e-04   
ref|XP_002962358.1|  hypothetical protein SELMODRAFT_78149            49.7    8e-04   
gb|EYU21183.1|  hypothetical protein MIMGU_mgv1a026255mg              49.7    8e-04   Erythranthe guttata [common monkey flower]



>ref|XP_006363519.1| PREDICTED: kinesin-1-like [Solanum tuberosum]
Length=805

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 152/180 (84%), Gaps = 5/180 (3%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPS---GVRPGRQAFAVVNG  221
            MAPK+QNKPP+  T S+PS+  +T  EVS++K+R+IGNPKMPS   G R  RQA AVVNG
Sbjct  1    MAPKNQNKPPLR-TLSAPSDSNYTAGEVSLEKRRRIGNPKMPSTATGART-RQALAVVNG  58

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
             AD+PPTSGPPSSAGSD G++EF+KE+VEALL EKLKTKNKYN KEKCD MS+YIRRLK 
Sbjct  59   VADVPPTSGPPSSAGSDGGIVEFSKEEVEALLTEKLKTKNKYNTKEKCDLMSDYIRRLKL  118

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQLEGNY++EQ SL  +LESAEK+C+EM+MLM  KEEELN+II ELRK+I  LQ+
Sbjct  119  CIKWFQQLEGNYVTEQASLSGMLESAEKKCNEMEMLMNVKEEELNSIIKELRKDIEALQE  178



>ref|XP_009630428.1| PREDICTED: kinesin-3-like [Nicotiana tomentosiformis]
Length=800

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 146/178 (82%), Gaps = 6/178 (3%)
 Frame = +3

Query  57   PKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMP-SGVRPGRQAFAVVNGSA--  227
            P++QNK   AP PSSPSN K+  DE+SVDKKRKI  P+MP +  RP RQAFAVVN  A  
Sbjct  4    PRNQNK---APIPSSPSNSKYATDEISVDKKRKIAIPRMPVTAGRPTRQAFAVVNAVAQP  60

Query  228  DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            DL PTSGPPS+AGSD    EF+KEDVEALL EKLKTKNK+N KEKCD MSEYIRRLK CI
Sbjct  61   DLAPTSGPPSTAGSDSPAFEFSKEDVEALLAEKLKTKNKFNTKEKCDLMSEYIRRLKLCI  120

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQQLE N++++Q SL +LL+SA+K+C+EM+MLMK+KEEELN+IIMELRK I  LQD
Sbjct  121  KWFQQLEENHVTQQASLTTLLDSAQKKCNEMEMLMKAKEEELNSIIMELRKTIEALQD  178



>ref|XP_004251479.1| PREDICTED: kinesin-3-like [Solanum lycopersicum]
Length=806

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 148/180 (82%), Gaps = 4/180 (2%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPS---GVRPGRQAFAVVNG  221
            MAPK+QNKPP+    + PS+  +T  EVS++K+R+IGNPK+PS   G R  RQA AVVN 
Sbjct  1    MAPKNQNKPPLRTLSALPSDSNYTAGEVSLEKRRRIGNPKIPSTATGART-RQALAVVNE  59

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
             AD+PP SGPPS+AGSD G++EF+KE+VEALL EKLKTKNKYN KEKCD MS+YIRRLK 
Sbjct  60   VADVPPASGPPSNAGSDGGIVEFSKEEVEALLTEKLKTKNKYNTKEKCDLMSDYIRRLKL  119

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQLEGNY +EQ SL  +LESAEK+C+EM+++M  KEEELN+IIMELRKNI  LQ+
Sbjct  120  CIKWFQQLEGNYFTEQASLSGMLESAEKKCNEMEVVMNVKEEELNSIIMELRKNIEALQE  179



>ref|XP_009787399.1| PREDICTED: kinesin-3-like [Nicotiana sylvestris]
Length=800

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 146/178 (82%), Gaps = 6/178 (3%)
 Frame = +3

Query  57   PKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGV-RPGRQAFAVVNGSA--  227
            P++QNK   AP PSSPSN K+  DE+SVDKKRKI  P+MP+   RP RQAFAVVN  A  
Sbjct  4    PRNQNK---APIPSSPSNSKYATDEISVDKKRKIAIPRMPTTAGRPTRQAFAVVNAVAQP  60

Query  228  DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            DL PTSGPPS+AGSD    EF KEDVEALL EKLKTKNK+N KEKCD MSEYIRRLK C+
Sbjct  61   DLTPTSGPPSTAGSDSPAFEFTKEDVEALLAEKLKTKNKFNTKEKCDLMSEYIRRLKLCV  120

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQQL+ N++++Q SL++LL+SAEK+C+EM+MLMK+KEEELN+IIMELRK I  LQ+
Sbjct  121  KWFQQLQDNHVTQQASLRTLLDSAEKKCNEMEMLMKAKEEELNSIIMELRKTIEALQE  178



>ref|XP_006360099.1| PREDICTED: kinesin-1-like [Solanum tuberosum]
Length=800

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 147/181 (81%), Gaps = 7/181 (4%)
 Frame = +3

Query  51   MAP-KSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPS---GVRPGRQAFAVVN  218
            MAP ++QN+   AP PSSPSN K+  D+++V+KKRKI NP+MP+   G RP RQAFAVVN
Sbjct  1    MAPTRNQNR---APLPSSPSNSKYATDDITVEKKRKIANPRMPTAATGGRPIRQAFAVVN  57

Query  219  GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLK  398
             + DL P SGPPS+ GSD  V EF KEDVEALL EKLKTKNK+N KEKCD MSEYIRRLK
Sbjct  58   AAPDLAPASGPPSTTGSDSPVFEFTKEDVEALLAEKLKTKNKFNTKEKCDLMSEYIRRLK  117

Query  399  QCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
             CI+WFQQLE N +++Q SLKSLLESAEK+C+EM+ LMK+KEEELN+IIMELRK I  LQ
Sbjct  118  LCIKWFQQLEENNVTQQASLKSLLESAEKKCNEMEGLMKAKEEELNSIIMELRKTIEALQ  177

Query  579  D  581
            +
Sbjct  178  E  178



>ref|XP_004244160.1| PREDICTED: kinesin-3 [Solanum lycopersicum]
Length=800

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 147/178 (83%), Gaps = 6/178 (3%)
 Frame = +3

Query  57   PKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPS---GVRPGRQAFAVVNGSA  227
            P++QN+   AP PSSPSN K+  D+++V+KKRKI NP+MP+   G RP RQAFAVVN + 
Sbjct  4    PRNQNR---APLPSSPSNSKYATDDITVEKKRKIANPRMPTAATGGRPIRQAFAVVNAAP  60

Query  228  DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            DL P SGPPS+AGSD  V EF KEDVEALL EKLKTKNK+N KEKCD MSEYIRRLK CI
Sbjct  61   DLAPASGPPSTAGSDGPVFEFTKEDVEALLGEKLKTKNKFNTKEKCDLMSEYIRRLKLCI  120

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQQLE N +++Q SLKSLLESAEK+C+EM++LMK+KEEELN+IIMELRK I  LQ+
Sbjct  121  KWFQQLEENNVTQQASLKSLLESAEKKCNEMEVLMKAKEEELNSIIMELRKTIEALQE  178



>ref|XP_011095312.1| PREDICTED: kinesin-3-like [Sesamum indicum]
Length=801

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 151/180 (84%), Gaps = 8/180 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMP--SGVR-PGRQAFAVVNG  221
            MA K+QNKPP     SSPS+ K++VD+VSVDK+R+IGN KMP  SG R   RQAF+VVNG
Sbjct  1    MASKNQNKPP-----SSPSHSKYSVDDVSVDKRRRIGNTKMPPNSGTRVQTRQAFSVVNG  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D PPTSGPPS++GSD GV EF +EDVEALL+EKL+ KNK+N KEK +QM+EYI+RLKQ
Sbjct  56   GQDPPPTSGPPSNSGSDSGVTEFTREDVEALLIEKLRIKNKFNYKEKSEQMAEYIKRLKQ  115

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQ EGNY++EQE LK+LLE AEK+C++M++LMK+KE+ELN+IIMELR N+  LQ+
Sbjct  116  CIKWFQQCEGNYVTEQEKLKNLLELAEKKCNDMELLMKAKEDELNSIIMELRNNLEALQE  175



>ref|XP_011097929.1| PREDICTED: kinesin-3 [Sesamum indicum]
Length=801

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 8/180 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGV---RPGRQAFAVVNG  221
            MA K+QNK P     SSPSN K++VDEVSVDK+R+IGN KMP         RQAF+VVNG
Sbjct  1    MASKNQNKAP-----SSPSNSKYSVDEVSVDKRRRIGNTKMPPNTVTRTQTRQAFSVVNG  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              DLPPTSGPPS+ GSDCGV+ F KEDVEALL E+L+ KNK+N KEK +QM+EYI+RLKQ
Sbjct  56   GQDLPPTSGPPSNCGSDCGVVGFTKEDVEALLNERLRIKNKFNYKEKSEQMAEYIKRLKQ  115

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQL+ NYI+E E  KSLLE AEK+C +M+ LM +KE+ELN+II+ELRKN+  LQ+
Sbjct  116  CIKWFQQLQENYITELEKQKSLLELAEKKCIDMESLMTAKEDELNSIIVELRKNLEALQE  175



>ref|XP_009794105.1| PREDICTED: kinesin-3-like [Nicotiana sylvestris]
Length=803

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 135/180 (75%), Gaps = 7/180 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFAVVNGS  224
            MAPK+QNKPP+     SP N  +T  EV   K+R+I NP MPS     R  QA AV+NG 
Sbjct  1    MAPKNQNKPPL----HSPFNSNYTEGEVPAGKRRRIENPGMPSTATAARTRQALAVMNGG  56

Query  225  ADLpptsgppssagsD-CGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
            A   P +  P S+    CG++EF+KED+EALL EKLKTKNKYN+KEKC  MSEYIRRLK 
Sbjct  57   ASDMPPTSSPPSSADSDCGIVEFSKEDIEALLTEKLKTKNKYNIKEKCGLMSEYIRRLKL  116

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQLE NYI+EQ SLK LLESAEK+C+E++MLMKSKEEELN+II +LRKNI  LQ+
Sbjct  117  CIKWFQQLEENYITEQASLKGLLESAEKKCNEIEMLMKSKEEELNSIITKLRKNIEALQE  176



>gb|EYU33594.1| hypothetical protein MIMGU_mgv1a004905mg [Erythranthe guttata]
Length=505

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 145/180 (81%), Gaps = 9/180 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMP--SGVR-PGRQAFAVVNG  221
            MA K+QNK P +P        K++VDEVSVDK+R+IGN KMP   G R   RQAF+VVNG
Sbjct  1    MASKNQNKAPSSP------QSKYSVDEVSVDKRRRIGNAKMPPYGGTRMQTRQAFSVVNG  54

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              DLPPT+ PPS +GS+ G++EF+KED++ALL EKL+ KNK+N K+K + M +YI+RLKQ
Sbjct  55   GQDLPPTTAPPSHSGSEGGIVEFSKEDIDALLNEKLRIKNKFNFKDKSELMGDYIKRLKQ  114

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQLEGNY+SEQE LK+LL++ EK+C++M+ +MK+KE+ELN+IIMELRK++  LQ+
Sbjct  115  CIKWFQQLEGNYVSEQEKLKNLLDAVEKKCNDMESMMKAKEDELNSIIMELRKHLEALQE  174



>ref|XP_002282749.2| PREDICTED: kinesin-3 isoform X1 [Vitis vinifera]
Length=806

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  51   MAPKSQNKPPV---APTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVV  215
            MA K+QNKPP+      P+SPSN +  VDEV+VDK+RKIG  KM  P+     RQAF+VV
Sbjct  1    MASKNQNKPPIPNFTNAPASPSNNQPVVDEVAVDKRRKIGLGKMVGPANSGRTRQAFSVV  60

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            NG  +     GPPSSAGS+CG IEF KEDVEALL EK+K KNK+N+KEKCDQM +YIR+L
Sbjct  61   NGGQE---NGGPPSSAGSECGGIEFTKEDVEALLNEKMKGKNKFNLKEKCDQMMDYIRKL  117

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            + CI+WFQ+LEG+Y+ EQE L+++L+ AE++C+E+++LMK+KEEELN+IIMELRKN A L
Sbjct  118  RLCIKWFQELEGSYLLEQEKLRNMLDCAERKCNELEVLMKNKEEELNSIIMELRKNCASL  177

Query  576  QD  581
             +
Sbjct  178  HE  179



>emb|CAN78128.1| hypothetical protein VITISV_028758 [Vitis vinifera]
Length=834

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 144/182 (79%), Gaps = 8/182 (4%)
 Frame = +3

Query  51   MAPKSQNKPPV---APTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVV  215
            MA K+QNKPP+      P+SPSN +  VDEV+VDK+RKIG  KM  P+     RQAF+VV
Sbjct  1    MASKNQNKPPIPNFTNAPASPSNNQPVVDEVAVDKRRKIGLGKMVGPANSGRTRQAFSVV  60

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            NG  +     GPPSSAGS+CG IEF KEDVEALL EK+K KNK+N+KEKCDQM +YIR+L
Sbjct  61   NGGQE---NGGPPSSAGSECGGIEFTKEDVEALLNEKMKGKNKFNLKEKCDQMMDYIRKL  117

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            + CI+WFQ+LEG+Y+ EQE L+++L+ AE++C+E+++LMK+KEEELN+IIMELRKN A L
Sbjct  118  RLCIKWFQELEGSYLLEQEKLRNMLDCAERKCNELEVLMKNKEEELNSIIMELRKNCASL  177

Query  576  QD  581
             +
Sbjct  178  HE  179



>ref|XP_009624731.1| PREDICTED: kinesin-3-like [Nicotiana tomentosiformis]
Length=801

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 141/180 (78%), Gaps = 10/180 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFAVVNGS  224
            MAPK+QNKPP+     SP N   +  EV   K+R+I NP M S     R  QA AVVNG 
Sbjct  1    MAPKNQNKPPL----HSPFN---SAGEVPAGKRRRIENPGMLSTATAARTRQALAVVNGG  53

Query  225  A-DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
            A D+PPTSGPPSSA SDCG++EF+KE +EALL EKLKTKNKYN+KEKC  MSEYIRRLK 
Sbjct  54   ASDMPPTSGPPSSADSDCGIVEFSKEVIEALLTEKLKTKNKYNIKEKCGLMSEYIRRLKL  113

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+WFQQLE NYI+EQ S+K LLE AEK+C+E++MLMK+KEEELN+IIMELRKNI  LQ+
Sbjct  114  CIKWFQQLEENYITEQASIKGLLELAEKKCNEIEMLMKAKEEELNSIIMELRKNIEELQE  173



>emb|CDP05808.1| unnamed protein product [Coffea canephora]
Length=803

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 8/185 (4%)
 Frame = +3

Query  51   MAPKS-QNKPPV----APTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGV---RPGRQAF  206
            MAPK+ QNKPP+    A + SS  N K+ VDEVSV+KKRKI N KMP      R  RQA 
Sbjct  1    MAPKNNQNKPPLPTFAASSTSSSPNSKYIVDEVSVEKKRKIANTKMPPATISTRANRQAL  60

Query  207  AVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYI  386
               NG  DLPP+SGPPS+AGSDCGV+EF KE VEAL+ E+LK KNK+N KEKCDQMS++I
Sbjct  61   MERNGGGDLPPSSGPPSTAGSDCGVVEFTKESVEALVNERLKVKNKFNYKEKCDQMSDFI  120

Query  387  RRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNI  566
            +RLK+CI+WFQQLE  ++SE E LK LLE+AEK+C+EM+MLMK+KEE+LN+IIMELR+N 
Sbjct  121  KRLKECIKWFQQLEKEHVSEHEKLKDLLEAAEKKCNEMEMLMKAKEEQLNSIIMELRRNY  180

Query  567  AVLQD  581
               Q+
Sbjct  181  EASQE  185



>gb|KDO46380.1| hypothetical protein CISIN_1g003711mg [Citrus sinensis]
Length=461

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 7/184 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAP---TPSSPSNGK--FTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFA  209
            MA  +QNKPPV     T +SPS+ K    VDEV+ DK++K G  KM       R  QAF+
Sbjct  1    MASNNQNKPPVLSNNITKASPSSNKKKLGVDEVTCDKEQKFGAEKMVGTANNARIRQAFS  60

Query  210  VVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
            VVNG  DL  +S P S+AGS+CG IEF +EDVEALL EK++ KNK+N KE+C+ M +YI+
Sbjct  61   VVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIK  120

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            RL+ CI+WFQ+LEG+Y  E E L++ LE +E++C+EM++ +++KEEELN II+ELRK+ A
Sbjct  121  RLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFA  180

Query  570  VLQD  581
             LQ+
Sbjct  181  SLQE  184



>ref|XP_010267812.1| PREDICTED: kinesin-1 isoform X1 [Nelumbo nucifera]
Length=806

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 3/180 (2%)
 Frame = +3

Query  51   MAPKSQNKPPVA-PTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNG  221
            MA ++QNKPP+   TP SPSN K +VDEV +DK+RKIG+ KM  P+     RQAF+V+N 
Sbjct  1    MASRNQNKPPLPNATPRSPSNKKDSVDEVPIDKRRKIGSGKMVGPANSGRTRQAFSVLNA  60

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D   +     +  SDC  IEF KEDVE+LL EK+K KNK++ K KC+QM+EYI++L+ 
Sbjct  61   GQDPAASGDSTGNGSSDCSAIEFTKEDVESLLNEKMKGKNKFDYKGKCEQMAEYIKKLRL  120

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            CI+W Q+LE N + EQE L+++LESA+++CS+ +  MK+KE ELN+II ELRKN A+LQ+
Sbjct  121  CIKWLQELEENSVLEQEKLRNMLESADRKCSQTEAQMKNKEGELNSIIAELRKNCALLQE  180



>ref|XP_006475301.1| PREDICTED: kinesin-3-like isoform X2 [Citrus sinensis]
Length=800

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 134/183 (73%), Gaps = 6/183 (3%)
 Frame = +3

Query  51   MAPKSQNKPPVAP---TPSSPS-NGKFTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFAV  212
            MA  +QNKPPV     T +SPS N K  VDEV+ DK++K G  KM       R  QAF+V
Sbjct  1    MASNNQNKPPVLSNNITKASPSSNKKLGVDEVTCDKEQKFGAEKMVGTANNARIRQAFSV  60

Query  213  VNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRR  392
            VNG  DL  +S P S+AGS+CG IEF +EDVEALL EK++ KNK+N KE+C+ M +YI+R
Sbjct  61   VNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIKR  120

Query  393  LKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAV  572
            L+ CI+WFQ+LEG+Y  E E L++ LE +E++C+EM++ +++KEEELN II+ELRK+ A 
Sbjct  121  LRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFAS  180

Query  573  LQD  581
            LQ+
Sbjct  181  LQE  183



>gb|KDO46379.1| hypothetical protein CISIN_1g003711mg [Citrus sinensis]
Length=801

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 7/184 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAP---TPSSPSNGK--FTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFA  209
            MA  +QNKPPV     T +SPS+ K    VDEV+ DK++K G  KM       R  QAF+
Sbjct  1    MASNNQNKPPVLSNNITKASPSSNKKKLGVDEVTCDKEQKFGAEKMVGTANNARIRQAFS  60

Query  210  VVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
            VVNG  DL  +S P S+AGS+CG IEF +EDVEALL EK++ KNK+N KE+C+ M +YI+
Sbjct  61   VVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIK  120

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            RL+ CI+WFQ+LEG+Y  E E L++ LE +E++C+EM++ +++KEEELN II+ELRK+ A
Sbjct  121  RLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFA  180

Query  570  VLQD  581
             LQ+
Sbjct  181  SLQE  184



>ref|XP_006475300.1| PREDICTED: kinesin-3-like isoform X1 [Citrus sinensis]
Length=801

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 134/184 (73%), Gaps = 7/184 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAP---TPSSPSNGK--FTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFA  209
            MA  +QNKPPV     T +SPS+ K    VDEV+ DK++K G  KM       R  QAF+
Sbjct  1    MASNNQNKPPVLSNNITKASPSSNKKKLGVDEVTCDKEQKFGAEKMVGTANNARIRQAFS  60

Query  210  VVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
            VVNG  DL  +S P S+AGS+CG IEF +EDVEALL EK++ KNK+N KE+C+ M +YI+
Sbjct  61   VVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENMMDYIK  120

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            RL+ CI+WFQ+LEG+Y  E E L++ LE +E++C+EM++ +++KEEELN II+ELRK+ A
Sbjct  121  RLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVELRKSFA  180

Query  570  VLQD  581
             LQ+
Sbjct  181  SLQE  184



>ref|XP_007021094.1| Kinesin-1 isoform 5 [Theobroma cacao]
 gb|EOY12619.1| Kinesin-1 isoform 5 [Theobroma cacao]
Length=529

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 11/188 (6%)
 Frame = +3

Query  51   MAPKSQNKPPV----APTPSS-----PSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ-  200
            M  K+QNKPP     +PTP+S     P    +  DEVS +K +++G  KM      GR  
Sbjct  1    MGSKNQNKPPFQHNPSPTPTSTATPSPLKKNYIADEVSGEKGQRLGFDKMVGTANNGRLR  60

Query  201  -AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
             AF++VNGS DL P S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M 
Sbjct  61   LAFSLVNGSHDLGPNSAPASNAGSECGGIEFTREDVEALVSEKMKYKNKFNYKERCENMM  120

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            EYI+RL+ CI+WFQ+LEG Y  EQE L+S LE  E+RCSEM++ +K+K+EELN II+ELR
Sbjct  121  EYIKRLRLCIKWFQELEGEYAFEQEKLRSALELTERRCSEMEVALKNKDEELNLIILELR  180

Query  558  KNIAVLQD  581
            K++A LQ+
Sbjct  181  KSLASLQE  188



>ref|XP_007021092.1| Kinesin 3 isoform 3 [Theobroma cacao]
 gb|EOY12617.1| Kinesin 3 isoform 3 [Theobroma cacao]
Length=761

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 11/188 (6%)
 Frame = +3

Query  51   MAPKSQNKPPV----APTPSS-----PSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ-  200
            M  K+QNKPP     +PTP+S     P    +  DEVS +K +++G  KM      GR  
Sbjct  1    MGSKNQNKPPFQHNPSPTPTSTATPSPLKKNYIADEVSGEKGQRLGFDKMVGTANNGRLR  60

Query  201  -AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
             AF++VNGS DL P S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M 
Sbjct  61   LAFSLVNGSHDLGPNSAPASNAGSECGGIEFTREDVEALVSEKMKYKNKFNYKERCENMM  120

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            EYI+RL+ CI+WFQ+LEG Y  EQE L+S LE  E+RCSEM++ +K+K+EELN II+ELR
Sbjct  121  EYIKRLRLCIKWFQELEGEYAFEQEKLRSALELTERRCSEMEVALKNKDEELNLIILELR  180

Query  558  KNIAVLQD  581
            K++A LQ+
Sbjct  181  KSLASLQE  188



>ref|XP_007021090.1| Kinesin 3 isoform 1 [Theobroma cacao]
 gb|EOY12615.1| Kinesin 3 isoform 1 [Theobroma cacao]
Length=802

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 11/188 (6%)
 Frame = +3

Query  51   MAPKSQNKPPV----APTPSS-----PSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ-  200
            M  K+QNKPP     +PTP+S     P    +  DEVS +K +++G  KM      GR  
Sbjct  1    MGSKNQNKPPFQHNPSPTPTSTATPSPLKKNYIADEVSGEKGQRLGFDKMVGTANNGRLR  60

Query  201  -AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
             AF++VNGS DL P S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M 
Sbjct  61   LAFSLVNGSHDLGPNSAPASNAGSECGGIEFTREDVEALVSEKMKYKNKFNYKERCENMM  120

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            EYI+RL+ CI+WFQ+LEG Y  EQE L+S LE  E+RCSEM++ +K+K+EELN II+ELR
Sbjct  121  EYIKRLRLCIKWFQELEGEYAFEQEKLRSALELTERRCSEMEVALKNKDEELNLIILELR  180

Query  558  KNIAVLQD  581
            K++A LQ+
Sbjct  181  KSLASLQE  188



>ref|XP_007021091.1| Kinesin 3 isoform 2 [Theobroma cacao]
 gb|EOY12616.1| Kinesin 3 isoform 2 [Theobroma cacao]
Length=784

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 11/188 (6%)
 Frame = +3

Query  51   MAPKSQNKPPV----APTPSS-----PSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ-  200
            M  K+QNKPP     +PTP+S     P    +  DEVS +K +++G  KM      GR  
Sbjct  1    MGSKNQNKPPFQHNPSPTPTSTATPSPLKKNYIADEVSGEKGQRLGFDKMVGTANNGRLR  60

Query  201  -AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
             AF++VNGS DL P S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M 
Sbjct  61   LAFSLVNGSHDLGPNSAPASNAGSECGGIEFTREDVEALVSEKMKYKNKFNYKERCENMM  120

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            EYI+RL+ CI+WFQ+LEG Y  EQE L+S LE  E+RCSEM++ +K+K+EELN II+ELR
Sbjct  121  EYIKRLRLCIKWFQELEGEYAFEQEKLRSALELTERRCSEMEVALKNKDEELNLIILELR  180

Query  558  KNIAVLQD  581
            K++A LQ+
Sbjct  181  KSLASLQE  188



>ref|XP_010247011.1| PREDICTED: kinesin-5-like [Nelumbo nucifera]
Length=806

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 135/181 (75%), Gaps = 5/181 (3%)
 Frame = +3

Query  51   MAPKSQNKPPV--APTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVN  218
            MA ++QNKPP+  AP P SPSN K ++DEV +DK+RKIG+ KM  P+     RQAF+VVN
Sbjct  1    MASRNQNKPPLPNAP-PRSPSNKKDSIDEVPIDKRRKIGSGKMVGPATTGRTRQAFSVVN  59

Query  219  GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLK  398
               D   TS   S+A SDCG IEF KE VEALL EK+K KNK++ K KC+Q++EY+++L+
Sbjct  60   AGQDPAVTSDYISNASSDCGGIEFTKEVVEALLNEKMKGKNKFDYKGKCEQLTEYVKKLR  119

Query  399  QCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
             CI+W Q+LE NY+ EQE L+++LES   +C+E +  MK++E ELN+II+EL+K+ A+LQ
Sbjct  120  LCIKWLQELEENYLLEQEKLRNMLESVNIKCAETEEQMKNREGELNSIIVELKKDFALLQ  179

Query  579  D  581
            +
Sbjct  180  E  180



>ref|XP_012070721.1| PREDICTED: kinesin-3 isoform X1 [Jatropha curcas]
 gb|KDP39040.1| hypothetical protein JCGZ_00797 [Jatropha curcas]
Length=798

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = +3

Query  51   MAPKSQNKPP---VAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFAVV  215
            M  K+QNKPP   V P  +SPS+ K+  DEV VD  +++G  KM      GR  QAF++V
Sbjct  1    MVSKNQNKPPLNSVTPIITSPSHKKYVGDEVLVDNWQQLGINKMVGTAANGRVRQAFSIV  60

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            NG  +L P S PPS+ GS+ G  EF +EDV+ALL E++K KNK+N KE+CD M +YI+RL
Sbjct  61   NGEQELAPNSAPPSNNGSEYGGFEFTREDVDALLNERMKYKNKFNYKERCDNMMDYIKRL  120

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            + CI+WFQ+LEG+Y+ EQE L++ LE  E +C+EM++++K+KEEELN II+ELRK++A L
Sbjct  121  RLCIKWFQELEGSYLYEQERLQNALEFNESQCAEMELMLKNKEEELNLIIVELRKSLASL  180

Query  576  QD  581
            Q+
Sbjct  181  QE  182



>ref|XP_012070722.1| PREDICTED: kinesin-3 isoform X2 [Jatropha curcas]
Length=797

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = +3

Query  51   MAPKSQNKPP---VAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGR--QAFAVV  215
            M  K+QNKPP   V P  +SPS+ K+  DEV VD  +++G  KM      GR  QAF++V
Sbjct  1    MVSKNQNKPPLNSVTPIITSPSH-KYVGDEVLVDNWQQLGINKMVGTAANGRVRQAFSIV  59

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            NG  +L P S PPS+ GS+ G  EF +EDV+ALL E++K KNK+N KE+CD M +YI+RL
Sbjct  60   NGEQELAPNSAPPSNNGSEYGGFEFTREDVDALLNERMKYKNKFNYKERCDNMMDYIKRL  119

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            + CI+WFQ+LEG+Y+ EQE L++ LE  E +C+EM++++K+KEEELN II+ELRK++A L
Sbjct  120  RLCIKWFQELEGSYLYEQERLQNALEFNESQCAEMELMLKNKEEELNLIIVELRKSLASL  179

Query  576  QD  581
            Q+
Sbjct  180  QE  181



>gb|KJB13566.1| hypothetical protein B456_002G081700 [Gossypium raimondii]
Length=802

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 127/188 (68%), Gaps = 11/188 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNG---------KFTVDEVSVDKKRKIGNPKMPSGVRPGRQ-  200
            M  K+QNKPP     +  +           K+  D VS DK +++G  KM      GR  
Sbjct  1    MGSKNQNKPPFQHNTTLTTTSTITPSSLKKKYIADVVSEDKGQRLGFEKMVGTANNGRLR  60

Query  201  -AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
             AF++VNGS DL  +S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M 
Sbjct  61   LAFSLVNGSQDLDLSSAPASNAGSECGGIEFTREDVEALVNEKMKYKNKFNYKERCENMM  120

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            EYI+RL+ CI+WFQ+LEG Y  EQE L++  E  E+RCSEM++ + +KEEELN II+ELR
Sbjct  121  EYIKRLRLCIKWFQELEGEYAFEQEKLRNASELTERRCSEMEVALNNKEEELNLIILELR  180

Query  558  KNIAVLQD  581
            K++A LQD
Sbjct  181  KSLASLQD  188



>gb|KHG03491.1| Kinesin-3 -like protein [Gossypium arboreum]
Length=768

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 127/188 (68%), Gaps = 11/188 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNG---------KFTVDEVSVDKKRKIGNPKMPSGVRPGRQ-  200
            M  KSQNKPP     +  +           K+  D VS DK +++G  KM      GR  
Sbjct  1    MGSKSQNKPPFQHNTTLTTTSTITPSSLKKKYIADVVSEDKGQRLGFEKMVGTANNGRLR  60

Query  201  -AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
             AF++VNGS DL  +S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M 
Sbjct  61   LAFSLVNGSQDLDLSSAPASNAGSECGGIEFTREDVEALVNEKMKYKNKFNYKERCENMM  120

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            EYI+RL+ CI+WFQ+LEG Y  EQE L++ LE  E+ CSEM++ + +KEEELN II+ELR
Sbjct  121  EYIKRLRLCIKWFQELEGEYAFEQEKLRNALELTERSCSEMEVALNNKEEELNLIILELR  180

Query  558  KNIAVLQD  581
            K++A LQD
Sbjct  181  KSLASLQD  188



>gb|KJB62642.1| hypothetical protein B456_009G427400 [Gossypium raimondii]
Length=750

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 129/189 (68%), Gaps = 12/189 (6%)
 Frame = +3

Query  51   MAPKSQNKPPV----------APTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ  200
            M+ K+QNKPP           + T  S S  K    EVS +K +K+G  KM      GR 
Sbjct  1    MSSKNQNKPPFHHNTTSPSTTSTTTPSTSKNKCIAAEVSEEKGQKLGFQKMIGTPNNGRL  60

Query  201  --AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
              AF++VNGS DL P S P S AGS+CG IEF +EDVEAL+ EK+K+KNK+N KE+C+ M
Sbjct  61   RLAFSLVNGSQDLGPDSTPVSHAGSECGAIEFTREDVEALVSEKMKSKNKFNYKERCENM  120

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LEG Y  EQE L+S LE  E+RC EM+M +K+K+EE+N II+EL
Sbjct  121  MEYIKRLRLCIRWFQELEGEYAFEQEKLRSALELTERRCYEMEMALKNKDEEMNLIILEL  180

Query  555  RKNIAVLQD  581
            R ++A LQ+
Sbjct  181  RNSLASLQE  189



>gb|KJB62640.1| hypothetical protein B456_009G427400 [Gossypium raimondii]
Length=803

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 129/189 (68%), Gaps = 12/189 (6%)
 Frame = +3

Query  51   MAPKSQNKPPV----------APTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ  200
            M+ K+QNKPP           + T  S S  K    EVS +K +K+G  KM      GR 
Sbjct  1    MSSKNQNKPPFHHNTTSPSTTSTTTPSTSKNKCIAAEVSEEKGQKLGFQKMIGTPNNGRL  60

Query  201  --AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
              AF++VNGS DL P S P S AGS+CG IEF +EDVEAL+ EK+K+KNK+N KE+C+ M
Sbjct  61   RLAFSLVNGSQDLGPDSTPVSHAGSECGAIEFTREDVEALVSEKMKSKNKFNYKERCENM  120

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LEG Y  EQE L+S LE  E+RC EM+M +K+K+EE+N II+EL
Sbjct  121  MEYIKRLRLCIRWFQELEGEYAFEQEKLRSALELTERRCYEMEMALKNKDEEMNLIILEL  180

Query  555  RKNIAVLQD  581
            R ++A LQ+
Sbjct  181  RNSLASLQE  189



>emb|CBI33223.3| unnamed protein product [Vitis vinifera]
Length=791

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 8/179 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNGS  224
            MA ++QN+PP      SP+  K  +DEV +DK+RKIG  +M    GV  GRQAFA +N  
Sbjct  1    MASRNQNRPP-----RSPATKKDNMDEVPLDKRRKIGTGRMLGTRGVGRGRQAFAAINNQ  55

Query  225  ADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
             DL   SG  S+ G +CG IEF KE+VEALL EK+K K K++ K K +QM  +I++LK C
Sbjct  56   QDLGAPSGMTSTEGPECGTIEFTKEEVEALLNEKIKAK-KFDTKGKMEQMDGHIKKLKLC  114

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            I+WFQQ E   + EQ  L++ LE AEK+C++ ++ MK+KEEELN II ELRK+IA LQD
Sbjct  115  IKWFQQHEEGQLVEQGKLQNALECAEKKCADTELEMKNKEEELNVIIEELRKSIASLQD  173



>ref|XP_002265300.1| PREDICTED: kinesin-1-like [Vitis vinifera]
Length=802

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 8/179 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNGS  224
            MA ++QN+PP      SP+  K  +DEV +DK+RKIG  +M    GV  GRQAFA +N  
Sbjct  1    MASRNQNRPP-----RSPATKKDNMDEVPLDKRRKIGTGRMLGTRGVGRGRQAFAAINNQ  55

Query  225  ADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
             DL   SG  S+ G +CG IEF KE+VEALL EK+K K K++ K K +QM  +I++LK C
Sbjct  56   QDLGAPSGMTSTEGPECGTIEFTKEEVEALLNEKIKAK-KFDTKGKMEQMDGHIKKLKLC  114

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            I+WFQQ E   + EQ  L++ LE AEK+C++ ++ MK+KEEELN II ELRK+IA LQD
Sbjct  115  IKWFQQHEEGQLVEQGKLQNALECAEKKCADTELEMKNKEEELNVIIEELRKSIASLQD  173



>gb|KJB62644.1| hypothetical protein B456_009G427400 [Gossypium raimondii]
Length=802

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 128/189 (68%), Gaps = 13/189 (7%)
 Frame = +3

Query  51   MAPKSQNKPPV----------APTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ  200
            M+ K+QNKPP           + T  S S  K    EVS +K +K+G  KM      GR 
Sbjct  1    MSSKNQNKPPFHHNTTSPSTTSTTTPSTSKNKCIAAEVSEEKGQKLGFQKMIGTPNNGRL  60

Query  201  --AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
              AF++VNGS DL P S P S AGS+CG IEF +EDVEAL+ EK+K+KNK+N K +C+ M
Sbjct  61   RLAFSLVNGSQDLGPDSTPVSHAGSECGAIEFTREDVEALVSEKMKSKNKFNYK-RCENM  119

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LEG Y  EQE L+S LE  E+RC EM+M +K+K+EE+N II+EL
Sbjct  120  MEYIKRLRLCIRWFQELEGEYAFEQEKLRSALELTERRCYEMEMALKNKDEEMNLIILEL  179

Query  555  RKNIAVLQD  581
            R ++A LQ+
Sbjct  180  RNSLASLQE  188



>ref|XP_003540037.1| PREDICTED: kinesin-3-like isoform 1 [Glycine max]
Length=799

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 130/184 (71%), Gaps = 7/184 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVA--PTPSSPSNGK-FTVDEVSVD-KKRKIGNPKMPSGVRPGR--QAFAV  212
            M  K+QN+PP++   TP  PSN K F  D + +D K++++G  KM      GR  QAF V
Sbjct  1    MVTKNQNRPPLSLTSTPPPPSNSKNFEGDVLLLDNKEQRVGAEKMVGTPINGRTRQAFTV  60

Query  213  VNGSA-DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
            VNG   DL P+S PPS+AGSD GVIEF +EDVEALL EK K K+++N KE+C+ M +YI+
Sbjct  61   VNGGVHDLGPSSAPPSNAGSDYGVIEFTREDVEALLSEKAKRKDRFNYKERCENMMDYIK  120

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            RLK CIRWFQ LE  Y  EQE LK+ LE  +++C E+++L+K KEEELN+II E+R+N  
Sbjct  121  RLKVCIRWFQDLEMYYSLEQEKLKNSLELTQQKCIEIELLLKIKEEELNSIISEMRRNCT  180

Query  570  VLQD  581
             LQ+
Sbjct  181  SLQE  184



>ref|XP_002522825.1| kinesin, putative [Ricinus communis]
 gb|EEF39523.1| kinesin, putative [Ricinus communis]
Length=780

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 132/189 (70%), Gaps = 14/189 (7%)
 Frame = +3

Query  51   MAPKSQNKPP--------VAPTPSSPSNGKFTVDEVS-VDKKRKIGNPKMPSGVRPGR--  197
            MA K+QNKPP        +  TPSS  + K+  +EV  +DK  K+   +M      GR  
Sbjct  1    MASKNQNKPPFTNNSSPIITTTPSS--HKKYIGNEVQCIDKWLKLEVEEMVGTATYGRMR  58

Query  198  QAFAVVNGSADLpptsgpp-ssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            QAF++VNG  +L   +  P S+AGS+ G IEF +EDV+ALL E++K KNK+N KE+CD M
Sbjct  59   QAFSIVNGDQELATPNSAPPSNAGSEYGGIEFTREDVDALLSERMKYKNKFNYKERCDNM  118

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LEG Y+ EQE L++ LE  E +C+EM++++K+KEEELN II+EL
Sbjct  119  MDYIKRLRLCIRWFQELEGCYLFEQEKLQNALEFNESQCAEMELMLKNKEEELNLIIVEL  178

Query  555  RKNIAVLQD  581
            R+++A +Q+
Sbjct  179  RRSLASVQE  187



>ref|XP_010644322.1| PREDICTED: kinesin-3 isoform X2 [Vitis vinifera]
 ref|XP_010644323.1| PREDICTED: kinesin-3 isoform X2 [Vitis vinifera]
 emb|CBI20496.3| unnamed protein product [Vitis vinifera]
Length=763

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = +3

Query  174  PSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNM  353
            P+     RQAF+VVNG  +     GPPSSAGS+CG IEF KEDVEALL EK+K KNK+N+
Sbjct  4    PANSGRTRQAFSVVNGGQE---NGGPPSSAGSECGGIEFTKEDVEALLNEKMKGKNKFNL  60

Query  354  KEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEEL  533
            KEKCDQM +YIR+L+ CI+WFQ+LEG+Y+ EQE L+++L+ AE++C+E+++LMK+KEEEL
Sbjct  61   KEKCDQMMDYIRKLRLCIKWFQELEGSYLLEQEKLRNMLDCAERKCNELEVLMKNKEEEL  120

Query  534  NAIIMELRKNIAVLQD  581
            N+IIMELRKN A L +
Sbjct  121  NSIIMELRKNCASLHE  136



>gb|KJB13567.1| hypothetical protein B456_002G081700 [Gossypium raimondii]
Length=753

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF++VNGS DL  +S P S+AGS+CG IEF +EDVEAL+ EK+K KNK+N KE+C+ M
Sbjct  11   RLAFSLVNGSQDLDLSSAPASNAGSECGGIEFTREDVEALVNEKMKYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CI+WFQ+LEG Y  EQE L++  E  E+RCSEM++ + +KEEELN II+EL
Sbjct  71   MEYIKRLRLCIKWFQELEGEYAFEQEKLRNASELTERRCSEMEVALNNKEEELNLIILEL  130

Query  555  RKNIAVLQD  581
            RK++A LQD
Sbjct  131  RKSLASLQD  139



>gb|KJB62645.1| hypothetical protein B456_009G427400 [Gossypium raimondii]
 gb|KJB62647.1| hypothetical protein B456_009G427400 [Gossypium raimondii]
Length=753

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF++VNGS DL P S P S AGS+CG IEF +EDVEAL+ EK+K+KNK+N KE+C+ M
Sbjct  11   RLAFSLVNGSQDLGPDSTPVSHAGSECGAIEFTREDVEALVSEKMKSKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LEG Y  EQE L+S LE  E+RC EM+M +K+K+EE+N II+EL
Sbjct  71   MEYIKRLRLCIRWFQELEGEYAFEQEKLRSALELTERRCYEMEMALKNKDEEMNLIILEL  130

Query  555  RKNIAVLQD  581
            R ++A LQ+
Sbjct  131  RNSLASLQE  139



>ref|XP_004151963.1| PREDICTED: kinesin-3 isoform X2 [Cucumis sativus]
 gb|KGN57961.1| hypothetical protein Csa_3G414070 [Cucumis sativus]
Length=752

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
             R +F++VNG  +L  TS P S AGSDCGVIEF+KEDVEALL EKLK K+++N+KEKCD 
Sbjct  10   SRLSFSMVNGGQELCLTSTPTSIAGSDCGVIEFSKEDVEALLNEKLKRKDRFNLKEKCDN  69

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI++LK CIRWFQ+LE +Y+ EQ+ L+  LES+E +CSEM+M++K KEEELN++I+E
Sbjct  70   MVEYIKKLKLCIRWFQELEYSYLLEQKKLQDELESSEIKCSEMEMIVKKKEEELNSLIVE  129

Query  552  LRKNIAVL  575
            LRKN A L
Sbjct  130  LRKNNAFL  137



>ref|XP_010694266.1| PREDICTED: kinesin-3 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010694267.1| PREDICTED: kinesin-3 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=789

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  270  DCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseq  449
            D GV+EF KEDVE LL E+++TKNK+N KE+C+QM +YIRRL+ CIRWFQ+LEG Y+ EQ
Sbjct  61   DVGVLEFAKEDVELLLNERMRTKNKFNYKERCEQMMDYIRRLRLCIRWFQELEGGYLLEQ  120

Query  450  eslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            ++L+ LL++AE++CS+M+MLM++KEEELNAIIMELRKN  +LQD
Sbjct  121  DNLRELLQAAERKCSDMEMLMQNKEEELNAIIMELRKNYNLLQD  164



>ref|XP_010694268.1| PREDICTED: kinesin-3 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=788

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  270  DCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseq  449
            D GV+EF KEDVE LL E+++TKNK+N KE+C+QM +YIRRL+ CIRWFQ+LEG Y+ EQ
Sbjct  61   DVGVLEFAKEDVELLLNERMRTKNKFNYKERCEQMMDYIRRLRLCIRWFQELEGGYLLEQ  120

Query  450  eslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            ++L+ LL++AE++CS+M+MLM++KEEELNAIIMELRKN  +LQD
Sbjct  121  DNLRELLQAAERKCSDMEMLMQNKEEELNAIIMELRKNYNLLQD  164



>ref|XP_006452144.1| hypothetical protein CICLE_v10007548mg [Citrus clementina]
 gb|ESR65384.1| hypothetical protein CICLE_v10007548mg [Citrus clementina]
Length=756

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            RQAF+VVNG  DL  +S P S+AGS+CG IEF +EDVEALL EK++ KNK+N KE+C+ M
Sbjct  11   RQAFSVVNGIQDLGLSSNPASNAGSECGTIEFTREDVEALLSEKMRYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CI+WFQ+LEG+Y  E E L++ LE +E++C+EM++ +++KEEELN II+EL
Sbjct  71   MDYIKRLRLCIKWFQELEGDYAFEHERLRNALELSEQKCAEMELALRNKEEELNLIIVEL  130

Query  555  RKNIAVLQD  581
            RK+ A LQ+
Sbjct  131  RKSFASLQE  139



>ref|XP_010062956.1| PREDICTED: kinesin-3 isoform X1 [Eucalyptus grandis]
 gb|KCW70113.1| hypothetical protein EUGRSUZ_F03419 [Eucalyptus grandis]
Length=819

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 131/189 (69%), Gaps = 13/189 (7%)
 Frame = +3

Query  54   APKSQNKPPV--------APTPS-SPSNGKFTVDEVSV-DKKRKIGNPKMPSGVRP---G  194
            A + Q++PP+        + TP+ SP   K+  DE+ V  KKR+I  P+M          
Sbjct  5    AEEDQSRPPLQSQSNTASSTTPTRSPPTKKYRADELGVIGKKREIRGPRMVGTTTARARS  64

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R+AF+VVN   DL P+S P S+AGS+CG +EF++EDV+ALL E+ K+KNK+N KE+C+ M
Sbjct  65   REAFSVVNSGQDLCPSSAPASNAGSECGGMEFSREDVDALLSERPKSKNKFNYKERCENM  124

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CI+WFQ+LE +++ EQE L++ L   ++R  E+++  ++KEEEL++II+EL
Sbjct  125  QEYIKRLRLCIKWFQELEDSFLQEQERLRNALNYVQQRLDELEVSSQNKEEELSSIIVEL  184

Query  555  RKNIAVLQD  581
            RKN+A  Q+
Sbjct  185  RKNLASAQE  193



>gb|KHN47841.1| Kinesin-3 [Glycine soja]
Length=804

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 127/184 (69%), Gaps = 7/184 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVA--PTPSSPSN-GKFTVDEVSVD-KKRKIGNPKMPSGVRPGR--QAFAV  212
            M  K+QN PP++   TP  PSN   F  D + +D K++++G   M      GR  QAF V
Sbjct  1    MVTKNQNWPPLSLTSTPPPPSNIQNFEGDVLFLDNKEQRVGAETMVGTPINGRTRQAFTV  60

Query  213  VNGSA-DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
            VNG   DL P+S PPS+AGSD GVIEF +EDVEALL EK K K+++N KE+C+ M +YI+
Sbjct  61   VNGGGHDLCPSSTPPSNAGSDYGVIEFTREDVEALLNEKAKRKDRFNYKERCENMMDYIK  120

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            RLK CIRWFQ LE  Y  EQE LK+ LE  +K+C E+++L+K KEEELN+II E+R+N  
Sbjct  121  RLKVCIRWFQDLEMYYSLEQEKLKNSLEMTQKKCIEIELLLKIKEEELNSIITEMRRNCT  180

Query  570  VLQD  581
             LQ+
Sbjct  181  SLQE  184



>ref|XP_008454567.1| PREDICTED: kinesin-3 isoform X2 [Cucumis melo]
Length=752

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R +F++VNG  +L  TS P S AGSDCGVIEF KEDVEALL EKLK K+++N+KEKCD M
Sbjct  11   RLSFSMVNGGQELCLTSTPTSIAGSDCGVIEFTKEDVEALLNEKLKRKDRFNLKEKCDNM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI++LK CI+WFQ+LE  Y+ EQ+ L+  LES+E +CSEM+M++K KEEELN++I+EL
Sbjct  71   VEYIKKLKLCIKWFQELEYGYLLEQKKLQDELESSEIKCSEMEMIVKKKEEELNSLIVEL  130

Query  555  RKNIAVL  575
            RKN A L
Sbjct  131  RKNNAFL  137



>ref|XP_007132984.1| hypothetical protein PHAVU_011G141500g [Phaseolus vulgaris]
 gb|ESW04978.1| hypothetical protein PHAVU_011G141500g [Phaseolus vulgaris]
Length=797

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 124/182 (68%), Gaps = 5/182 (3%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGK-FTVDEVSVDK-KRKIGNPKMPSGVRPGR--QAFAVVN  218
            M  K QN+PP++ T + P   K F  D + +D  ++++G  KM      GR  QAF VVN
Sbjct  1    MVTKYQNRPPLSLTSTPPPPSKNFEGDVLLIDNIEQRVGAEKMVGTPINGRTRQAFTVVN  60

Query  219  GSA-DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            G   DL P+S PPS+AGSD G IEF +EDVEALL E+ K K+++N KE+C+ M +YI+RL
Sbjct  61   GGGHDLGPSSAPPSNAGSDYGAIEFTREDVEALLNERAKRKDRFNYKERCENMVDYIKRL  120

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            K CIRWFQ LE  Y  E E LK+ LE  +++C E+++L+K KEEELN+II E+R+N   L
Sbjct  121  KVCIRWFQDLEMYYSLEHEKLKNSLELTQQKCIEIELLLKIKEEELNSIITEMRRNCTSL  180

Query  576  QD  581
            Q+
Sbjct  181  QE  182



>ref|XP_008244338.1| PREDICTED: kinesin-3 [Prunus mume]
Length=760

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  171  MPSGVRPGR--QAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNK  344
            M    R GR   AF+VVNG  DL P+S P S+AGS+C  IEF +EDVEALL E+ + K++
Sbjct  1    MVGTARNGRVRHAFSVVNGGQDLGPSSAPASNAGSECDGIEFTREDVEALLNERPRRKDR  60

Query  345  YNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKE  524
            +N+KEKCD ++EYI+RLK CI+WFQ+LEG+Y+ E+E L++ +E +E++C+EM +L K+KE
Sbjct  61   FNLKEKCDTLTEYIKRLKLCIKWFQELEGSYLFEREKLQNSVEVSERQCNEMGILFKNKE  120

Query  525  EELNAIIMELRKNIAVLQD  581
            EELN+II ELRK+ A +Q+
Sbjct  121  EELNSIIAELRKSFASVQE  139



>ref|XP_007213621.1| hypothetical protein PRUPE_ppa002138mg [Prunus persica]
 gb|EMJ14820.1| hypothetical protein PRUPE_ppa002138mg [Prunus persica]
Length=710

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 109/139 (78%), Gaps = 2/139 (1%)
 Frame = +3

Query  171  MPSGVRPGR--QAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNK  344
            M    R GR   AF+VVNG  DL P+S P S+AGS+C  IEF +EDVEALL E+ + K++
Sbjct  1    MVGTARNGRVRHAFSVVNGGQDLGPSSAPASNAGSECDGIEFTREDVEALLNERPRRKDR  60

Query  345  YNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKE  524
            +N+KEKCD ++EYI+RLK CI+WFQ+LEG+Y+ E+E L++ +E +E++C+EM +L K+KE
Sbjct  61   FNLKEKCDTLTEYIKRLKLCIKWFQELEGSYLFEREKLQNSVEVSERQCNEMGILFKNKE  120

Query  525  EELNAIIMELRKNIAVLQD  581
            EELN+II ELRK+ A +++
Sbjct  121  EELNSIIAELRKSFASVEE  139



>ref|XP_011651463.1| PREDICTED: kinesin-3 isoform X1 [Cucumis sativus]
Length=761

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 105/137 (77%), Gaps = 9/137 (7%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNM------  353
             R +F++VNG  +L  TS P S AGSDCGVIEF+KEDVEALL EKLK K+++N+      
Sbjct  10   SRLSFSMVNGGQELCLTSTPTSIAGSDCGVIEFSKEDVEALLNEKLKRKDRFNLKVSPSF  69

Query  354  ---KEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKE  524
               KEKCD M EYI++LK CIRWFQ+LE +Y+ EQ+ L+  LES+E +CSEM+M++K KE
Sbjct  70   SAVKEKCDNMVEYIKKLKLCIRWFQELEYSYLLEQKKLQDELESSEIKCSEMEMIVKKKE  129

Query  525  EELNAIIMELRKNIAVL  575
            EELN++I+ELRKN A L
Sbjct  130  EELNSLIVELRKNNAFL  146



>ref|XP_011621059.1| PREDICTED: kinesin-1 [Amborella trichopoda]
Length=803

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 113/183 (62%), Gaps = 9/183 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPG-----RQAFAVV  215
            M  ++  +PP    P SPSN K  +DEV VDK++KIG     +G   G     RQAF+VV
Sbjct  1    MTSRNYTRPPA---PRSPSNKKENIDEVPVDKRQKIGRDMFGTGKMAGAQLRTRQAFSVV  57

Query  216  NGSADLpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRR  392
            N   ++   +     +   DC  +EF +EDV+ALL EK+K KNK++ K KC+ M+EYI+R
Sbjct  58   NSGEEISDHTNGGLGNRNMDCNSVEFRREDVDALLNEKMKGKNKFDYKGKCEHMTEYIKR  117

Query  393  LKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAV  572
            L+QCI+WFQ  +   + E++ L+  L+SAE +  E++  MK KEEEL   + ELR ++  
Sbjct  118  LRQCIKWFQDEQEALLIEEDKLRRELQSAENKHKEIESQMKKKEEELTDTVAELRTSLTT  177

Query  573  LQD  581
            LQ+
Sbjct  178  LQE  180



>ref|XP_010092308.1| hypothetical protein L484_021170 [Morus notabilis]
 gb|EXB50942.1| hypothetical protein L484_021170 [Morus notabilis]
Length=761

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            RQAF++VNG  D+ P+S PPS+AGS+CG  EF +EDVEALL EK K K+K+N+KEKCD +
Sbjct  12   RQAFSLVNGGYDMSPSSAPPSNAGSECGGTEFTREDVEALLREKPKRKDKFNLKEKCDLL  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            +EYI+RLK CI+WFQ+LE +Y+ EQE L++ LE AE +C E ++ +++KEEELN+II EL
Sbjct  72   TEYIKRLKLCIKWFQELETSYVFEQEKLQNRLEKAEMKCGETEIQLRNKEEELNSIIQEL  131

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  132  RKNYASLQE  140



>ref|XP_006467955.1| PREDICTED: kinesin-1-like [Citrus sinensis]
 gb|KDO75610.1| hypothetical protein CISIN_1g003672mg [Citrus sinensis]
Length=804

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 10/181 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPG----RQAFAVVN  218
            MA ++QN+PP      SPS  K   D+V  DK+R+IG  +       G    RQAFAVVN
Sbjct  1    MASRNQNRPP-----RSPSIKKEGTDDVPFDKRRRIGAGRTTGATSTGTGRPRQAFAVVN  55

Query  219  GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLK  398
               D+   S   S+ GSDCG IEF KE+VEALL EK KTK K+++K K +QM+E+ +R K
Sbjct  56   NRQDVSAASDMASTEGSDCGTIEFTKEEVEALLNEKPKTK-KFDLKAKIEQMTEHNKRFK  114

Query  399  QCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
             CI+WFQQ++ N++ E++ ++S LES EK+ S+ +M MK++E ELN  I++LR+  A L+
Sbjct  115  LCIKWFQQVDENHVLEKQKIQSALESTEKKLSDTEMEMKNRESELNGTILDLRQENAHLR  174

Query  579  D  581
            +
Sbjct  175  E  175



>ref|XP_008454566.1| PREDICTED: kinesin-3 isoform X1 [Cucumis melo]
Length=761

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 103/137 (75%), Gaps = 9/137 (7%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNM------  353
             R +F++VNG  +L  TS P S AGSDCGVIEF KEDVEALL EKLK K+++N+      
Sbjct  10   SRLSFSMVNGGQELCLTSTPTSIAGSDCGVIEFTKEDVEALLNEKLKRKDRFNLKVSPSF  69

Query  354  ---KEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKE  524
               KEKCD M EYI++LK CI+WFQ+LE  Y+ EQ+ L+  LES+E +CSEM+M++K KE
Sbjct  70   SAVKEKCDNMVEYIKKLKLCIKWFQELEYGYLLEQKKLQDELESSEIKCSEMEMIVKKKE  129

Query  525  EELNAIIMELRKNIAVL  575
            EELN++I+ELRKN A L
Sbjct  130  EELNSLIVELRKNNAFL  146



>gb|KEH30756.1| kinesin motor catalytic domain protein [Medicago truncatula]
Length=746

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 119/184 (65%), Gaps = 17/184 (9%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNP-------KMPSGVRPGRQAFA  209
            M  K QN PP++ + +SP+  KF         +  +G+        + P   R  RQA  
Sbjct  1    MVTKIQNWPPLSLSHTSPTPSKF---------QNFVGDNNCLETMVETPINGRI-RQALT  50

Query  210  VVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
            VVNG  D+  +S PPS+AGSD GVIEF +EDVEALL EK K K ++N KE+C+ M +YI+
Sbjct  51   VVNGGHDVGLSSAPPSNAGSDYGVIEFTREDVEALLNEKAKKKERFNYKERCENMVDYIK  110

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            RLK CIRWFQ LE +Y  +QE LK+ LE  +++  E++ML+K KEEELN II+E+RKN  
Sbjct  111  RLKVCIRWFQDLEMSYSIDQEKLKNSLEMTKQKSIEIEMLLKIKEEELNLIIIEMRKNCT  170

Query  570  VLQD  581
             LQ+
Sbjct  171  SLQE  174



>ref|XP_006449138.1| hypothetical protein CICLE_v10014313mg [Citrus clementina]
 gb|ESR62378.1| hypothetical protein CICLE_v10014313mg [Citrus clementina]
Length=804

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 10/181 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPG----RQAFAVVN  218
            MA ++QN+PP      SPS  K   D+V  DK+R+IG  +       G    RQAFAVVN
Sbjct  1    MASRNQNRPP-----RSPSIKKEGTDDVPFDKRRRIGAGRTTGATSTGTGRPRQAFAVVN  55

Query  219  GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLK  398
               D+   S   S+ GSDCG IEF KE+VEALL EK KTK K+++K K +QM+E+ +R K
Sbjct  56   NRQDVSAASDMASTEGSDCGSIEFTKEEVEALLNEKPKTK-KFDLKAKIEQMTEHNKRFK  114

Query  399  QCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
             CI+WFQQ++ N++ E++ ++S LES EK+ S+ +M MK++E ELN  I++LR+  A L+
Sbjct  115  LCIKWFQQVDENHVLEKQKIQSALESTEKKLSDTEMEMKNRESELNGSILDLRQENAHLR  174

Query  579  D  581
            +
Sbjct  175  E  175



>ref|XP_011048279.1| PREDICTED: kinesin-3 isoform X2 [Populus euphratica]
Length=719

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  +    S PPS+AGS+ G  EF +EDV ALL E++K KNK+N KE+C+ M
Sbjct  11   RHAFSVVNGEQEGGLNSAPPSNAGSEYGGFEFTREDVYALLCERMKYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CI+WFQ+LEG+Y+ EQE L++ L+ AE RC+EMD+++K+KEEELN II+EL
Sbjct  71   MDYIKRLRLCIKWFQELEGSYLFEQEKLQNALDFAESRCAEMDLIVKNKEEELNLIIVEL  130

Query  555  RKNIAVLQD  581
            RK++A LQ+
Sbjct  131  RKSLASLQE  139



>ref|XP_003636711.1| Kinesin-3, partial [Medicago truncatula]
Length=684

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGK-FTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSA  227
            M  K QN PP++ + +SP+  K F  D   ++        + P   R  RQA  VVNG  
Sbjct  1    MVTKIQNWPPLSLSHTSPTPSKNFVGDNNCLETM-----VETPINGRI-RQALTVVNGGH  54

Query  228  DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            D+  +S PPS+AGSD GVIEF +EDVEALL EK K K ++N KE+C+ M +YI+RLK CI
Sbjct  55   DVGLSSAPPSNAGSDYGVIEFTREDVEALLNEKAKKKERFNYKERCENMVDYIKRLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RWFQ LE +Y  +QE LK+ LE  +++  E++ML+K KEEELN II+E+RKN   LQ+
Sbjct  115  RWFQDLEMSYSIDQEKLKNSLEMTKQKSIEIEMLLKIKEEELNLIIIEMRKNCTSLQE  172



>ref|XP_011048277.1| PREDICTED: kinesin-3 isoform X1 [Populus euphratica]
 ref|XP_011048278.1| PREDICTED: kinesin-3 isoform X1 [Populus euphratica]
Length=752

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  +    S PPS+AGS+ G  EF +EDV ALL E++K KNK+N KE+C+ M
Sbjct  11   RHAFSVVNGEQEGGLNSAPPSNAGSEYGGFEFTREDVYALLCERMKYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CI+WFQ+LEG+Y+ EQE L++ L+ AE RC+EMD+++K+KEEELN II+EL
Sbjct  71   MDYIKRLRLCIKWFQELEGSYLFEQEKLQNALDFAESRCAEMDLIVKNKEEELNLIIVEL  130

Query  555  RKNIAVLQD  581
            RK++A LQ+
Sbjct  131  RKSLASLQE  139



>ref|XP_006370608.1| KINESIN-LIKE protein C [Populus trichocarpa]
 gb|ERP67177.1| KINESIN-LIKE protein C [Populus trichocarpa]
Length=752

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  +    S PPS+AGS+ G  EF +EDV ALL E++K KNK+N KE+C+ M
Sbjct  11   RHAFSVVNGEQEGGLNSAPPSNAGSEYGGFEFTREDVYALLCERMKYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CI+WFQ+LEG+Y+ EQE L++ L+ AE RC+EMD+++K+KEEELN II+EL
Sbjct  71   MDYIKRLRLCIKWFQELEGSYLFEQEKLQNALDFAESRCAEMDLIVKNKEEELNLIIVEL  130

Query  555  RKNIAVLQD  581
            RK++A LQ+
Sbjct  131  RKSLASLQE  139



>gb|AES89902.2| kinesin motor catalytic domain protein [Medicago truncatula]
Length=793

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGK-FTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSA  227
            M  K QN PP++ + +SP+  K F  D   ++        + P   R  RQA  VVNG  
Sbjct  1    MVTKIQNWPPLSLSHTSPTPSKNFVGDNNCLETM-----VETPINGRI-RQALTVVNGGH  54

Query  228  DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            D+  +S PPS+AGSD GVIEF +EDVEALL EK K K ++N KE+C+ M +YI+RLK CI
Sbjct  55   DVGLSSAPPSNAGSDYGVIEFTREDVEALLNEKAKKKERFNYKERCENMVDYIKRLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RWFQ LE +Y  +QE LK+ LE  +++  E++ML+K KEEELN II+E+RKN   LQ+
Sbjct  115  RWFQDLEMSYSIDQEKLKNSLEMTKQKSIEIEMLLKIKEEELNLIIIEMRKNCTSLQE  172



>ref|XP_004505473.1| PREDICTED: kinesin-3-like [Cicer arietinum]
Length=791

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 129/182 (71%), Gaps = 5/182 (3%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKF---TVDEVSVDKKRKIGNPKMPSGVRPGR--QAFAVV  215
            M  K+QN+PP++ + +SP+  KF     DE  +DK++ +   KM      GR  QAF VV
Sbjct  1    MVTKNQNRPPLSLSSTSPTPSKFQNFVGDEHLLDKEQLVEAEKMVETPINGRTRQAFKVV  60

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            NG  +L P S PPS+AGSD G+IEF +EDVEALL EK K K+++N KE+C+ M +YI+RL
Sbjct  61   NGGHELSPNSAPPSNAGSDYGIIEFTREDVEALLNEKAKKKDRFNYKERCENMVDYIKRL  120

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            K CIRWFQ LE NY  EQE LK+ LE  +++  E+++L+K KE+ELN+II+E+R+N + L
Sbjct  121  KVCIRWFQDLEINYSLEQEKLKNSLEMTQQKSIEIELLLKIKEDELNSIIVEMRRNCSSL  180

Query  576  QD  581
            Q+
Sbjct  181  QE  182



>ref|XP_002316967.2| KINESIN-LIKE protein C [Populus trichocarpa]
 gb|EEE97579.2| KINESIN-LIKE protein C [Populus trichocarpa]
Length=712

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  ++   S PPS+AGS+ G  EF +EDV  LL E++K KNK+N KE+C+ M
Sbjct  11   RHAFSVVNGEEEVGLNSVPPSNAGSEYGGFEFTREDVYGLLNERMKYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CI+WFQ+LEG Y+ EQE L++ L+  E +C+EMD+++K+KEEELN II+EL
Sbjct  71   MDYIKRLRLCIKWFQELEGGYLFEQEKLQNALDFTESKCAEMDLMLKNKEEELNLIIVEL  130

Query  555  RKNIAVLQD  581
            RK++A LQ+
Sbjct  131  RKSLASLQE  139



>gb|EPS70906.1| hypothetical protein M569_03849 [Genlisea aurea]
Length=796

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 126/181 (70%), Gaps = 14/181 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMP--SGVRP-GRQAFAVVNG  221
            MA K+ N+       ++ +  K+  ++VS++K+R+IG PKMP  +G R   RQA  VVN 
Sbjct  1    MASKNSNRAA-----ANLAQNKYPSEDVSIEKRRRIGTPKMPLNTGRRTQARQALTVVNV  55

Query  222  SADLpptsgppssagsDCGV-IEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLK  398
              ++P T+    S     GV +EF  +DVEALL EKLK K+++N KE  + MSE I+RLK
Sbjct  56   GREVPLTNDNSDSN----GVAMEFTADDVEALLNEKLK-KSRFNHKENSEHMSECIKRLK  110

Query  399  QCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
             CI+WFQQ+EG YI EQESLK+LLESAE +CS++++   +KE+ELN+II+ELRKNI  LQ
Sbjct  111  LCIKWFQQVEGKYILEQESLKNLLESAENKCSDIEVKFTAKEDELNSIIIELRKNILALQ  170

Query  579  D  581
            +
Sbjct  171  E  171



>gb|KHN27981.1| Kinesin-3 [Glycine soja]
Length=762

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R +F VVNG  DL P+S PPS+AGSD G+IEF +EDVEALL EK K K+++N KE+C+ M
Sbjct  11   RLSFGVVNGGHDLGPSSAPPSNAGSDYGIIEFTREDVEALLNEKAKRKDRFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RLK CIRWFQ LE +Y  EQE LKS LE A+++C+E+++L+K KEEELN+II+E+
Sbjct  71   MDYIKRLKVCIRWFQDLEISYSLEQEKLKSSLELAQQKCTEIELLLKIKEEELNSIIVEM  130

Query  555  RKNIAVLQD  581
            R+N   LQ+
Sbjct  131  RRNCTSLQE  139



>ref|XP_003543287.1| PREDICTED: kinesin-3-like isoform X1 [Glycine max]
 ref|XP_006594807.1| PREDICTED: kinesin-3-like isoform X2 [Glycine max]
 ref|XP_006594808.1| PREDICTED: kinesin-3-like isoform X3 [Glycine max]
Length=762

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R +F VVNG  DL P+S PPS+AGSD G+IEF +EDVEALL EK K K+++N KE+C+ M
Sbjct  11   RLSFGVVNGGHDLGPSSAPPSNAGSDYGIIEFTREDVEALLNEKAKRKDRFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RLK CIRWFQ LE +Y  EQE LKS LE A+++C+E+++L+K KEEELN+II+E+
Sbjct  71   MDYIKRLKVCIRWFQDLEISYSLEQEKLKSSLELAQQKCTEIELLLKIKEEELNSIIVEM  130

Query  555  RKNIAVLQD  581
            R+N   LQ+
Sbjct  131  RRNCTSLQE  139



>ref|XP_010267813.1| PREDICTED: kinesin-1 isoform X2 [Nelumbo nucifera]
Length=765

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = +3

Query  174  PSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNM  353
            P+     RQAF+V+N   D   +     +  SDC  IEF KEDVE+LL EK+K KNK++ 
Sbjct  4    PANSGRTRQAFSVLNAGQDPAASGDSTGNGSSDCSAIEFTKEDVESLLNEKMKGKNKFDY  63

Query  354  KEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEEL  533
            K KC+QM+EYI++L+ CI+W Q+LE N + EQE L+++LESA+++CS+ +  MK+KE EL
Sbjct  64   KGKCEQMAEYIKKLRLCIKWLQELEENSVLEQEKLRNMLESADRKCSQTEAQMKNKEGEL  123

Query  534  NAIIMELRKNIAVLQD  581
            N+II ELRKN A+LQ+
Sbjct  124  NSIIAELRKNCALLQE  139



>ref|XP_004294333.1| PREDICTED: kinesin-3 [Fragaria vesca subsp. vesca]
Length=755

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A+A+VNG  DL P S P S+AGS+CG +EF +E VEALL E+ K K+++++KEKCD +
Sbjct  11   RPAYAMVNGGPDLAPNSAPASNAGSECGDVEFTREYVEALLNERPKRKDRFSLKEKCDCL  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            ++YIRRLK  IRWFQ+LE NY+ E E L++ LE +E + SEMD+L+++KEEELN+II EL
Sbjct  71   TDYIRRLKPVIRWFQELEVNYLLEHEKLQNSLEVSELKRSEMDLLLRNKEEELNSIIAEL  130

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  131  RKNYAALQE  139



>ref|XP_003527313.2| PREDICTED: kinesin-3-like isoform X1 [Glycine max]
 ref|XP_006582239.1| PREDICTED: kinesin-3-like isoform X2 [Glycine max]
Length=780

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  141  DKKRKIGNPKMPSGVRPGR--QAFAVVNGSA-DLpptsgppssagsDCGVIEFNKEDVEA  311
            +K++++G   M      GR  QAF VVNG   DL P+S PPS+AGSD GVIEF +EDVEA
Sbjct  16   NKEQRVGAETMVGTPINGRTRQAFTVVNGGGHDLCPSSTPPSNAGSDYGVIEFTREDVEA  75

Query  312  LLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRC  491
            LL EK K K+++N KE+C+ M +YI+RLK CIRWFQ LE  Y  EQE LK+ LE  +K+C
Sbjct  76   LLNEKAKRKDRFNYKERCENMMDYIKRLKVCIRWFQDLEMYYSLEQEKLKNSLEMTQKKC  135

Query  492  SEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             E+++L+K KEEELN+II E+R+N   LQ+
Sbjct  136  IEIELLLKIKEEELNSIITEMRRNCTSLQE  165



>ref|XP_007149688.1| hypothetical protein PHAVU_005G090700g [Phaseolus vulgaris]
 ref|XP_007149689.1| hypothetical protein PHAVU_005G090700g [Phaseolus vulgaris]
 gb|ESW21682.1| hypothetical protein PHAVU_005G090700g [Phaseolus vulgaris]
 gb|ESW21683.1| hypothetical protein PHAVU_005G090700g [Phaseolus vulgaris]
Length=762

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 4/142 (3%)
 Frame = +3

Query  156  IGNPKMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKT  335
            +G P +    RP   AF VVNG  DL P+S PPS+AGSD G+IEF +EDVEALL EK K 
Sbjct  2    VGTP-INGRTRP---AFGVVNGGHDLGPSSAPPSNAGSDYGIIEFTREDVEALLNEKAKR  57

Query  336  KNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMK  515
            K+++N KE+C+ M +YI+RLK CIRWFQ LE +Y  EQE LKS LE A+++C E+++L+K
Sbjct  58   KDRFNYKERCENMMDYIKRLKVCIRWFQDLEISYSLEQEKLKSSLELAQQKCKEIELLLK  117

Query  516  SKEEELNAIIMELRKNIAVLQD  581
             KE+ELN+II+E+R+N   LQ+
Sbjct  118  IKEDELNSIIVEMRRNCTSLQE  139



>ref|XP_010539269.1| PREDICTED: kinesin-3 [Tarenaya hassleriana]
 ref|XP_010539271.1| PREDICTED: kinesin-3 [Tarenaya hassleriana]
 ref|XP_010539272.1| PREDICTED: kinesin-3 [Tarenaya hassleriana]
Length=753

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R  F VVNGS DL P+S P S+ GS+ G +EF +EDVEALL E+++ K+K+N KE+C+ M
Sbjct  10   RTVFPVVNGSRDLTPSSAPASTIGSENGAVEFTREDVEALLNERIRYKSKFNYKERCENM  69

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE L++ L   EK CS+M++ +++KEEELN II EL
Sbjct  70   MDYIKRLRLCIRWFQELELDYAFEQEKLRNALAMTEKHCSDMELSLRNKEEELNMIIEEL  129

Query  555  RKNIAVLQD  581
            RKN A +Q+
Sbjct  130  RKNFAAVQE  138



>ref|XP_008355352.1| PREDICTED: kinesin-3-like [Malus domestica]
Length=759

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  +L P+S P S+AGS+ G IEF +EDV+ALL E+ K K+++++KEKC+ M
Sbjct  11   RHAFSVVNGGQELGPSSAPVSNAGSESGGIEFTREDVDALLNERPKRKDRFSLKEKCETM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            SEYI+RLK CI+WFQ+LE +Y+ E++ L++ +E +E++  EM +L+K+KEEELN+II EL
Sbjct  71   SEYIKRLKLCIKWFQELEESYLIERKKLENDVEVSERQRDEMGILLKNKEEELNSIIAEL  130

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  131  RKNYASLQE  139



>ref|XP_003540423.1| PREDICTED: kinesin-3-like [Glycine max]
Length=762

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R +F  VNG  DL P+S PPS+AGSD G+IEF +EDVEALL EK K K+++N KE+C+ M
Sbjct  11   RLSFGAVNGGHDLGPSSAPPSNAGSDYGIIEFTREDVEALLNEKAKRKDRFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RLK CIRWFQ LE +Y  EQE LKS LE A+++C+E+++L+K KEEELN+II+E+
Sbjct  71   MDYIKRLKVCIRWFQDLEISYSLEQEKLKSSLELAQQKCTEIELLLKIKEEELNSIIVEM  130

Query  555  RKNIAVLQD  581
            R+N   LQ+
Sbjct  131  RRNCTSLQE  139



>ref|XP_009358086.1| PREDICTED: kinesin-3-like [Pyrus x bretschneideri]
Length=759

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  +L P+S P S+AGS+ G IEF +EDV+ALL E+ K K+++++KEKC+ M
Sbjct  11   RHAFSVVNGGQELGPSSAPVSNAGSESGGIEFTREDVDALLNERPKRKDRFSLKEKCETM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            SEYI+RLK CI+WFQ+LE +Y+  +E L++ +E +E++  EM +L+K+KEEELN+II EL
Sbjct  71   SEYIKRLKLCIKWFQELEESYLIGREKLENDVEVSERQRDEMGILLKNKEEELNSIIAEL  130

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  131  RKNYASLQE  139



>gb|KHN36737.1| Kinesin-3 [Glycine soja]
Length=762

 Score =   122 bits (305),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 77/129 (60%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R +F VVNG  DL P+S PPS+AGSD G+IEF +EDVEALL EK K K+++N KE+C+ M
Sbjct  11   RLSFGVVNGGHDLGPSSAPPSNAGSDYGIIEFTREDVEALLNEKAKRKDRFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RLK CIRWFQ LE +Y  EQE LKS LE A+++C+E+++L+K KEEELN+II+E+
Sbjct  71   MDYIKRLKVCIRWFQDLEISYSLEQEKLKSSLELAQQKCTEIELLLKIKEEELNSIIVEM  130

Query  555  RKNIAVLQD  581
            R+N   LQ+
Sbjct  131  RRNCTSLQE  139



>gb|KHN20442.1| Kinesin-3 [Glycine soja]
Length=679

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +3

Query  195  RQAFAVVNGSA-DLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            RQAF VVNG   DL P+S PPS+AGSD GVIEF +EDVEALL EK K K+++N KE+C+ 
Sbjct  11   RQAFTVVNGGVHDLGPSSAPPSNAGSDYGVIEFTREDVEALLSEKAKRKDRFNYKERCEN  70

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M +YI+RLK CIRWFQ LE  Y  EQE LK+ LE  +++C E+++L+K KEEELN+II E
Sbjct  71   MMDYIKRLKVCIRWFQDLEMYYSLEQEKLKNSLELTQQKCIEIELLLKIKEEELNSIISE  130

Query  552  LRKNIAVLQD  581
            +R+N   LQ+
Sbjct  131  MRRNCTSLQE  140



>ref|XP_009127074.1| PREDICTED: kinesin-3 [Brassica rapa]
 ref|XP_009127075.1| PREDICTED: kinesin-3 [Brassica rapa]
Length=754

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 99/141 (70%), Gaps = 3/141 (2%)
 Frame = +3

Query  156  IGNPKMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKT  335
            +G       +RP   AF V NGS DL P S P S+AGS+CG +EF +EDVEALL E++K 
Sbjct  2    VGTMANNGRIRP---AFPVANGSKDLTPDSAPVSTAGSECGQVEFTREDVEALLNERIKY  58

Query  336  KNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMK  515
            K+K+N KE+C+ M EYI+RL+ CIRWFQ+LE +Y  EQE LK+ L   EK C++M+  +K
Sbjct  59   KSKFNYKERCENMMEYIKRLRLCIRWFQELELDYAFEQEKLKNALVLNEKHCADMEASLK  118

Query  516  SKEEELNAIIMELRKNIAVLQ  578
            +KEEELN II ELRKN    Q
Sbjct  119  NKEEELNMIIEELRKNFESAQ  139



>ref|XP_003607705.1| Kinesin-3 [Medicago truncatula]
Length=760

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            RQA  VVNG  D+  +S PPS+AGSD GVIEF +EDVEALL EK K K ++N KE+C+ M
Sbjct  11   RQALTVVNGGHDVGLSSAPPSNAGSDYGVIEFTREDVEALLNEKAKKKERFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RLK CIRWFQ LE +Y  +QE LK+ LE  +++  E++ML+K KEEELN II+E+
Sbjct  71   VDYIKRLKVCIRWFQDLEMSYSIDQEKLKNSLEMTKQKSIEIEMLLKIKEEELNLIIIEM  130

Query  555  RKNIAVLQD  581
            RKN   LQ+
Sbjct  131  RKNCTSLQE  139



>ref|XP_009355573.1| PREDICTED: kinesin-3-like isoform X1 [Pyrus x bretschneideri]
Length=759

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  DL P+S P S+AGS+ G IEF +EDV ALL E+ K K+++++KEKC+ +
Sbjct  11   RHAFSVVNGGQDLGPSSAPASNAGSESGGIEFTREDVGALLNERPKRKDRFSLKEKCETL  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            SEY++RLK CI+WFQ+LE +Y+ E+E L++ ++ ++ +  EM +L+K+KEEELN+II+EL
Sbjct  71   SEYVKRLKLCIKWFQELEESYLLEREKLENDVQVSKLQRDEMGILLKNKEEELNSIIVEL  130

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  131  RKNYASLQE  139



>ref|XP_009355574.1| PREDICTED: kinesin-3-like isoform X2 [Pyrus x bretschneideri]
Length=759

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  DL P+S P S+AGS+ G IEF +EDV ALL E+ K K+++++KEKC+ +
Sbjct  11   RHAFSVVNGGQDLGPSSAPASNAGSESGGIEFTREDVGALLNERPKRKDRFSLKEKCETL  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            SEY++RLK CI+WFQ+LE +Y+ E+E L++ ++ ++ +  EM +L+K+KEEELN+II+EL
Sbjct  71   SEYVKRLKLCIKWFQELEESYLLEREKLENDVQVSKLQRDEMGILLKNKEEELNSIIVEL  130

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  131  RKNYASLQE  139



>ref|XP_007132983.1| hypothetical protein PHAVU_011G141500g [Phaseolus vulgaris]
 gb|ESW04977.1| hypothetical protein PHAVU_011G141500g [Phaseolus vulgaris]
Length=780

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 4/159 (3%)
 Frame = +3

Query  117  FTVDEVSVDK-KRKIGNPKMPSGVRPGR--QAFAVVNGSA-DLpptsgppssagsDCGVI  284
            F  D + +D  ++++G  KM      GR  QAF VVNG   DL P+S PPS+AGSD G I
Sbjct  7    FEGDVLLIDNIEQRVGAEKMVGTPINGRTRQAFTVVNGGGHDLGPSSAPPSNAGSDYGAI  66

Query  285  EFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslks  464
            EF +EDVEALL E+ K K+++N KE+C+ M +YI+RLK CIRWFQ LE  Y  E E LK+
Sbjct  67   EFTREDVEALLNERAKRKDRFNYKERCENMVDYIKRLKVCIRWFQDLEMYYSLEHEKLKN  126

Query  465  llesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             LE  +++C E+++L+K KEEELN+II E+R+N   LQ+
Sbjct  127  SLELTQQKCIEIELLLKIKEEELNSIITEMRRNCTSLQE  165



>ref|XP_008371206.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-1-like [Malus domestica]
Length=816

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 119/183 (65%), Gaps = 18/183 (10%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGN--PKMPSGVRPGRQAFAVVN--  218
            MA ++QN+ P      SP + K ++DEV +DK+R+I    P++PS     R   AVV   
Sbjct  1    MASRNQNRAP-----RSPFSKKSSLDEVPLDKRRRIETRKPELPSSNGRQRPPLAVVKQD  55

Query  219  --GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRR  392
              G+ D+    G       +CG +EF KE+VEALLVEKLK K K++ K K DQ+++Y +R
Sbjct  56   AAGTGDIGSVEGS------ECGNVEFTKEEVEALLVEKLKVK-KFDHKGKADQLADYSKR  108

Query  393  LKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAV  572
            LK CIRW QQ+E  +I E+E L+  L SAEK+CS+ ++ MK+K +ELNA+  +LR+++A 
Sbjct  109  LKLCIRWLQQVEEGHILEEEKLRKALASAEKKCSDTEVEMKNKVDELNAVNSKLRESMAA  168

Query  573  LQD  581
            L++
Sbjct  169  LEE  171



>ref|XP_008345855.1| PREDICTED: kinesin-1-like [Malus domestica]
Length=800

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 119/183 (65%), Gaps = 18/183 (10%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGN--PKMPSGVRPGRQAFAVVN--  218
            MA ++QN+ P      SP + K ++DEV +DK+R+I    P++PS     R   AVV   
Sbjct  1    MASRNQNRAP-----RSPFSKKSSLDEVPLDKRRRIETRKPELPSSNGRQRPPLAVVKQD  55

Query  219  --GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRR  392
              G+ D+    G       +CG +EF KE+VEALLVEKLK K K++ K K DQ+++Y +R
Sbjct  56   AAGTGDIGSVEGS------ECGNVEFTKEEVEALLVEKLKVK-KFDHKGKADQLADYSKR  108

Query  393  LKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAV  572
            LK CIRW QQ+E  +I E+E L+  L SAEK+CS+ ++ MK+K +ELNA+  +LR+++A 
Sbjct  109  LKLCIRWLQQVEEGHILEEEKLRXALASAEKKCSDTEVEMKNKVDELNAVNSKLRESMAA  168

Query  573  LQD  581
            L++
Sbjct  169  LEE  171



>gb|KCW70118.1| hypothetical protein EUGRSUZ_F03419 [Eucalyptus grandis]
Length=539

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
             R+AF+VVN   DL P+S P S+AGS+CG +EF++EDV+ALL E+ K+KNK+N KE+C+ 
Sbjct  11   SREAFSVVNSGQDLCPSSAPASNAGSECGGMEFSREDVDALLSERPKSKNKFNYKERCEN  70

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI+RL+ CI+WFQ+LE +++ EQE L++ L   ++R  E+++  ++KEEEL++II+E
Sbjct  71   MQEYIKRLRLCIKWFQELEDSFLQEQERLRNALNYVQQRLDELEVSSQNKEEELSSIIVE  130

Query  552  LRKNIAVLQD  581
            LRKN+A  Q+
Sbjct  131  LRKNLASAQE  140



>ref|XP_006401547.1| hypothetical protein EUTSA_v10012765mg [Eutrema salsugineum]
 gb|ESQ43000.1| hypothetical protein EUTSA_v10012765mg [Eutrema salsugineum]
Length=753

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL   S P S+AGS+ G +EF +EDVEALL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVANGSKDLTSNSAPASTAGSEYGPVEFTREDVEALLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +K+KEEELN II EL
Sbjct  72   MDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLKNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>gb|KCW70117.1| hypothetical protein EUGRSUZ_F03419 [Eucalyptus grandis]
Length=647

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
             R+AF+VVN   DL P+S P S+AGS+CG +EF++EDV+ALL E+ K+KNK+N KE+C+ 
Sbjct  11   SREAFSVVNSGQDLCPSSAPASNAGSECGGMEFSREDVDALLSERPKSKNKFNYKERCEN  70

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI+RL+ CI+WFQ+LE +++ EQE L++ L   ++R  E+++  ++KEEEL++II+E
Sbjct  71   MQEYIKRLRLCIKWFQELEDSFLQEQERLRNALNYVQQRLDELEVSSQNKEEELSSIIVE  130

Query  552  LRKNIAVLQD  581
            LRKN+A  Q+
Sbjct  131  LRKNLASAQE  140



>ref|XP_010062957.1| PREDICTED: kinesin-3 isoform X2 [Eucalyptus grandis]
 ref|XP_010062958.1| PREDICTED: kinesin-3 isoform X2 [Eucalyptus grandis]
 ref|XP_010062959.1| PREDICTED: kinesin-3 isoform X2 [Eucalyptus grandis]
 gb|KCW70114.1| hypothetical protein EUGRSUZ_F03419 [Eucalyptus grandis]
Length=766

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R+AF+VVN   DL P+S P S+AGS+CG +EF++EDV+ALL E+ K+KNK+N KE+C+ M
Sbjct  12   REAFSVVNSGQDLCPSSAPASNAGSECGGMEFSREDVDALLSERPKSKNKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CI+WFQ+LE +++ EQE L++ L   ++R  E+++  ++KEEEL++II+EL
Sbjct  72   QEYIKRLRLCIKWFQELEDSFLQEQERLRNALNYVQQRLDELEVSSQNKEEELSSIIVEL  131

Query  555  RKNIAVLQD  581
            RKN+A  Q+
Sbjct  132  RKNLASAQE  140



>emb|CDY06633.1| BnaC02g13570D [Brassica napus]
Length=754

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+AGS+CG +EF +EDVEALL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVANGSKDLTPDSAPVSTAGSECGQVEFTREDVEALLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ L   EK C++M+  +K KEEELN II  L
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALVLNEKHCADMEASLKHKEEELNMIIEVL  131

Query  555  RKNIAVLQ  578
            RKN    Q
Sbjct  132  RKNFESAQ  139



>gb|KCW70116.1| hypothetical protein EUGRSUZ_F03419 [Eucalyptus grandis]
Length=692

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
             R+AF+VVN   DL P+S P S+AGS+CG +EF++EDV+ALL E+ K+KNK+N KE+C+ 
Sbjct  11   SREAFSVVNSGQDLCPSSAPASNAGSECGGMEFSREDVDALLSERPKSKNKFNYKERCEN  70

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI+RL+ CI+WFQ+LE +++ EQE L++ L   ++R  E+++  ++KEEEL++II+E
Sbjct  71   MQEYIKRLRLCIKWFQELEDSFLQEQERLRNALNYVQQRLDELEVSSQNKEEELSSIIVE  130

Query  552  LRKNIAVLQD  581
            LRKN+A  Q+
Sbjct  131  LRKNLASAQE  140



>gb|KCW70115.1| hypothetical protein EUGRSUZ_F03419 [Eucalyptus grandis]
Length=733

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  192  GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
             R+AF+VVN   DL P+S P S+AGS+CG +EF++EDV+ALL E+ K+KNK+N KE+C+ 
Sbjct  11   SREAFSVVNSGQDLCPSSAPASNAGSECGGMEFSREDVDALLSERPKSKNKFNYKERCEN  70

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI+RL+ CI+WFQ+LE +++ EQE L++ L   ++R  E+++  ++KEEEL++II+E
Sbjct  71   MQEYIKRLRLCIKWFQELEDSFLQEQERLRNALNYVQQRLDELEVSSQNKEEELSSIIVE  130

Query  552  LRKNIAVLQD  581
            LRKN+A  Q+
Sbjct  131  LRKNLASAQE  140



>ref|XP_009366635.1| PREDICTED: kinesin-1 [Pyrus x bretschneideri]
Length=800

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (67%), Gaps = 18/183 (10%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGN--PKMPSGVRPGRQAFAVVN--  218
            MA ++QN+ P      SP + K ++DEV +DK+R+I    P++PS +   R   AVV   
Sbjct  1    MASRNQNRAP-----RSPFSKKSSLDEVPLDKRRRIETRKPEVPSSMGRQRPPLAVVKQD  55

Query  219  --GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRR  392
              G++D+    G       +CG +EF K++VEALLVEKLK K K++ K K +Q+++Y +R
Sbjct  56   AAGTSDIGSVEGS------ECGNVEFTKDEVEALLVEKLKVK-KFDHKGKAEQLADYSKR  108

Query  393  LKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAV  572
            LK CIRW QQ+E  +I E+E L++ L SAEK+CS+ ++ MK+K +ELNAI  +LR+++A 
Sbjct  109  LKLCIRWLQQVEEGHILEEEKLRNALASAEKKCSDTEVEMKNKVDELNAINSKLRESMAA  168

Query  573  LQD  581
            L++
Sbjct  169  LEE  171



>emb|CDY28759.1| BnaA02g09510D [Brassica napus]
Length=754

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 3/141 (2%)
 Frame = +3

Query  156  IGNPKMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKT  335
            +G       +RP   AF V N S DL P S P S+AGS+CG +EF +EDVEALL E++K 
Sbjct  2    VGTMASNGRIRP---AFPVANVSKDLTPDSAPVSTAGSECGQVEFTREDVEALLNERIKY  58

Query  336  KNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMK  515
            K+K+N KE+C+ M EYI+RL+ CIRWFQ+LE +Y  EQE LK+ L   EK C++M+  +K
Sbjct  59   KSKFNYKERCENMMEYIKRLRLCIRWFQELELDYAFEQEKLKNALVLNEKHCADMEASLK  118

Query  516  SKEEELNAIIMELRKNIAVLQ  578
            +KEEELN II ELRKN    Q
Sbjct  119  NKEEELNMIIEELRKNFESAQ  139



>ref|XP_011030892.1| PREDICTED: kinesin-3-like [Populus euphratica]
 ref|XP_011030893.1| PREDICTED: kinesin-3-like [Populus euphratica]
Length=752

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R  F+VVN   ++   S PPS+AGS+ G  EF +EDV  LL E++K KNK+N KE+C+ M
Sbjct  11   RHEFSVVNVEEEVGLNSVPPSNAGSEYGGFEFTREDVYGLLNERMKYKNKFNYKERCENM  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CI+WFQ+LEG Y+ EQE L++ L+  E +C+EMD+++K+KEEELN II+EL
Sbjct  71   MDYIKRLRLCIKWFQELEGGYLFEQEKLQNALDFTESKCAEMDLILKNKEEELNLIIVEL  130

Query  555  RKNIAVLQD  581
            RK++A LQ+
Sbjct  131  RKSLASLQE  139



>emb|CDY67586.1| BnaC09g53250D [Brassica napus]
Length=753

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+AGS+ G +EF++EDVEALL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVTNGSKDLTPNSAPASTAGSEYGPVEFSREDVEALLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M+  +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALEMNEKHCADMETSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN    Q
Sbjct  132  RKNFESAQ  139



>ref|XP_008386025.1| PREDICTED: kinesin-3 [Malus domestica]
Length=759

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF+VVNG  D+ P+S P S+AGS+ G I F +EDV+ALL E+ K K+++++KEKC+ +
Sbjct  11   RHAFSVVNGGQDMGPSSAPASNAGSESGGIXFTREDVDALLNERPKRKDRFSLKEKCETL  70

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            SEY++RLK CI+WFQ+LE +Y+ E E L++ ++ ++ +  EM +L+++KEEELN+II+EL
Sbjct  71   SEYVKRLKLCIKWFQELEESYLLEHEKLENDVQVSKLQRDEMGILLENKEEELNSIIVEL  130

Query  555  RKNIAVLQD  581
            RKN A LQ+
Sbjct  131  RKNYASLQE  139



>ref|XP_010910020.1| PREDICTED: kinesin-5-like [Elaeis guineensis]
Length=815

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 122/191 (64%), Gaps = 16/191 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTP-----SSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFA  209
            M+ ++QN+PP  PTP      SPSN K  +DE  VDK+RKIG  KM  P+     RQ  +
Sbjct  1    MSFRNQNRPP--PTPVLNPIRSPSNKKENLDEAPVDKRRKIGIGKMVCPATNPRARQMLS  58

Query  210  VVN------GSADLpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCD  368
             VN      G  D    + P S  GS  G +EF ++EDVE +L EK+K KNK + K K +
Sbjct  59   TVNAGPNPGGHGDHGTGAAPTSDGGSSGGGVEFASREDVERVLGEKMKGKNKNDYKGKSE  118

Query  369  QMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIM  548
            QM EYI++L+ CIRWF +LE  Y++EQE L+S+L+S E+R  E+++ M++K EELN II 
Sbjct  119  QMIEYIKKLRTCIRWFMELEDGYLAEQEKLRSMLDSEERRHVEIEVQMRAKFEELNTIIQ  178

Query  549  ELRKNIAVLQD  581
            EL++  A LQ+
Sbjct  179  ELQRQHASLQE  189



>ref|XP_009119997.1| PREDICTED: kinesin-3 [Brassica rapa]
 ref|XP_009119998.1| PREDICTED: kinesin-3 [Brassica rapa]
 ref|XP_009119999.1| PREDICTED: kinesin-3 [Brassica rapa]
Length=753

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+AGS+ G +EF++EDVEALL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVTNGSKDLTPNSAPASTAGSEYGPVEFSREDVEALLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M+  +++KEEELN II EL
Sbjct  72   MDYIKRLRLCIRWFQELELDYAFEQEKLKNALEMNEKHCADMETSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN    Q
Sbjct  132  RKNFESAQ  139



>dbj|BAB09933.1| kinesin-like protein [Arabidopsis thaliana]
Length=746

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+ GS+ G +EF +EDVE LL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVTNGSKDLTPNSAPASTTGSEYGPVEFTREDVETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C +M++ +K+KEEELN II EL
Sbjct  72   MDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCVDMEVSLKNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|NP_568811.1| kinesin 3 [Arabidopsis thaliana]
 sp|P46875.1|ATK3_ARATH RecName: Full=Kinesin-3; AltName: Full=Kinesin-like protein C 
[Arabidopsis thaliana]
 dbj|BAA04674.1| heavy chain polypeptide of kinesin-like protein [Arabidopsis 
thaliana]
 gb|AAO24588.1| At5g54670 [Arabidopsis thaliana]
 dbj|BAF00095.1| heavy chain polypeptide of kinesin like protein [Arabidopsis 
thaliana]
 gb|AED96525.1| kinesin 3 [Arabidopsis thaliana]
Length=754

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+ GS+ G +EF +EDVE LL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVTNGSKDLTPNSAPASTTGSEYGPVEFTREDVETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C +M++ +K+KEEELN II EL
Sbjct  72   MDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCVDMEVSLKNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_008441621.1| PREDICTED: kinesin-1 [Cucumis melo]
Length=798

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 117/179 (65%), Gaps = 10/179 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNGS  224
            MA ++QN+PP +P        K   D+V +DK+RKI   ++  P+    GRQ F  VN  
Sbjct  1    MASRNQNRPPRSPAK------KDVPDDVPLDKRRKIAAGRILGPAAGARGRQPFVDVNNR  54

Query  225  ADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
              +  +    +    +CG +EF KE+++ALL EKLK K K+++K K DQ++++ +RLK C
Sbjct  55   QGVSASDACSTEDS-ECGTVEFTKEEIDALLSEKLKGK-KFDLKGKVDQITDHNKRLKLC  112

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            I+WFQQ+E +++ E+E L++ LESAEK+CS +++ MK + +EL++ I  LR N+A L++
Sbjct  113  IKWFQQIEESHLLEEERLRTALESAEKKCSAIELEMKERADELSSTISVLRDNVASLEE  171



>gb|ERM99862.1| hypothetical protein AMTR_s00098p00155820 [Amborella trichopoda]
Length=791

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 102/162 (63%), Gaps = 6/162 (4%)
 Frame = +3

Query  114  KFTVDEVSVDKKRKIGNPKMPSGVRPG-----RQAFAVVNGSADLpptsgpps-sagsDC  275
            K  +DEV VDK++KIG     +G   G     RQAF+VVN   ++   +     +   DC
Sbjct  7    KENIDEVPVDKRQKIGRDMFGTGKMAGAQLRTRQAFSVVNSGEEISDHTNGGLGNRNMDC  66

Query  276  GVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
              +EF +EDV+ALL EK+K KNK++ K KC+ M+EYI+RL+QCI+WFQ  +   + E++ 
Sbjct  67   NSVEFRREDVDALLNEKMKGKNKFDYKGKCEHMTEYIKRLRQCIKWFQDEQEALLIEEDK  126

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L+  L+SAE +  E++  MK KEEEL   + ELR ++  LQ+
Sbjct  127  LRRELQSAENKHKEIESQMKKKEEELTDTVAELRTSLTTLQE  168



>ref|XP_006280058.1| hypothetical protein CARUB_v10025939mg [Capsella rubella]
 ref|XP_006280059.1| hypothetical protein CARUB_v10025939mg [Capsella rubella]
 gb|EOA12956.1| hypothetical protein CARUB_v10025939mg [Capsella rubella]
 gb|EOA12957.1| hypothetical protein CARUB_v10025939mg [Capsella rubella]
Length=754

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+ GS+ G +EF ++DVE LL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVTNGSKDLTPNSAPASTTGSEYGPLEFTRDDVETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>emb|CDY68543.1| BnaA10g28890D [Brassica napus]
Length=753

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R AF V NGS DL P S P S+AGS+ G +EF++EDVEALL E++K K+K+N KE+C+ M
Sbjct  12   RSAFPVTNGSKDLTPNSAPASTAGSEYGPVEFSREDVEALLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +YI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M+  +++KEEELN II EL
Sbjct  72   MDYIKRLRLCIRWFQELEFDYAFEQEKLKNALEMNEKHCADMETSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            R N    Q
Sbjct  132  RMNFESAQ  139



>ref|XP_010482874.1| PREDICTED: kinesin-3-like [Camelina sativa]
 ref|XP_010482875.1| PREDICTED: kinesin-3-like [Camelina sativa]
Length=754

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V NGS DL P S P S+ GS+ G +EF +EDVE LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVTNGSKDLTPNSAPASTTGSEYGPVEFTREDVETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_010520868.1| PREDICTED: kinesin-3-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010520869.1| PREDICTED: kinesin-3-like isoform X1 [Tarenaya hassleriana]
Length=747

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 95/133 (71%), Gaps = 8/133 (6%)
 Frame = +3

Query  183  VRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEK  362
            +RP   AF  +NGS DL P+S        + G +EF +EDVEALL E++K K+K++ KE+
Sbjct  9    IRP---AFPALNGSRDLTPSSVGS-----ENGAVEFTREDVEALLSERIKYKSKFDYKER  60

Query  363  CDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAI  542
            C+ M +YI+RL+ CIRWFQ+LE +Y  EQE L++   +AEK C++M++ +++KEEELN I
Sbjct  61   CENMMDYIKRLRLCIRWFQELELDYAFEQEKLRNASTTAEKHCADMELSLRNKEEELNII  120

Query  543  IMELRKNIAVLQD  581
            + ELR+N   +Q+
Sbjct  121  VEELRRNFTAVQE  133



>ref|XP_010520870.1| PREDICTED: kinesin-3-like isoform X2 [Tarenaya hassleriana]
Length=744

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 95/133 (71%), Gaps = 8/133 (6%)
 Frame = +3

Query  183  VRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEK  362
            +RP   AF  +NGS DL P+S        + G +EF +EDVEALL E++K K+K++ KE+
Sbjct  9    IRP---AFPALNGSRDLTPSSVGS-----ENGAVEFTREDVEALLSERIKYKSKFDYKER  60

Query  363  CDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAI  542
            C+ M +YI+RL+ CIRWFQ+LE +Y  EQE L++   +AEK C++M++ +++KEEELN I
Sbjct  61   CENMMDYIKRLRLCIRWFQELELDYAFEQEKLRNASTTAEKHCADMELSLRNKEEELNII  120

Query  543  IMELRKNIAVLQD  581
            + ELR+N   +Q+
Sbjct  121  VEELRRNFTAVQE  133



>ref|XP_010448473.1| PREDICTED: kinesin-3-like [Camelina sativa]
 ref|XP_010448481.1| PREDICTED: kinesin-3-like [Camelina sativa]
Length=754

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V NGS DL P S P S+ GS+ G +EF ++DVE LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVTNGSKDLTPNSAPASTTGSEYGPVEFTRDDVETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_010443046.1| PREDICTED: kinesin-3 [Camelina sativa]
Length=754

 Score =   112 bits (280),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V NGS DL P S P S+ GS+ G +EF ++DVE LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVTNGSKDLTPNSAPASTTGSEYGPVEFTRDDVETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_010931847.1| PREDICTED: kinesin-5 isoform X1 [Elaeis guineensis]
Length=816

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 120/189 (63%), Gaps = 12/189 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPT---PSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVV  215
            M+ ++QN+PP  P      SPSN K  +DE  VDK+RKIG  KM  P+     RQ  + V
Sbjct  1    MSSRNQNRPPPTPVPNPSRSPSNKKDNLDEAPVDKRRKIGVGKMVGPATNLRARQVLSTV  60

Query  216  N------GSADLpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            N      G  D    + P S AGS+ G IEF ++EDVE LL EK+K KNK + K K +QM
Sbjct  61   NAGPNPGGHGDHAAGTAPSSDAGSNGGGIEFGSREDVERLLGEKMKGKNKNDYKGKSEQM  120

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI++L+ CIRWF +LE  Y++EQE L+++L+S EKR ++++  M++K EEL  II EL
Sbjct  121  IEYIKKLRTCIRWFMELEDGYMAEQEKLRNMLDSEEKRHADIEAEMRAKVEELTTIIQEL  180

Query  555  RKNIAVLQD  581
            +   A LQ+
Sbjct  181  QSQHASLQE  189



>ref|XP_010931849.1| PREDICTED: kinesin-5 isoform X2 [Elaeis guineensis]
Length=815

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 120/189 (63%), Gaps = 12/189 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPT---PSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVV  215
            M+ ++QN+PP  P      SPSN K  +DE  VDK+RKIG  KM  P+     RQ  + V
Sbjct  1    MSSRNQNRPPPTPVPNPSRSPSNKKDNLDEAPVDKRRKIGVGKMVGPATNLRARQVLSTV  60

Query  216  N------GSADLpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            N      G  D    + P S AGS+ G IEF ++EDVE LL EK+K KNK + K K +QM
Sbjct  61   NAGPNPGGHGDHAAGTAPSSDAGSNGGGIEFGSREDVERLLGEKMKGKNKNDYKGKSEQM  120

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI++L+ CIRWF +LE  Y++EQE L+++L+S EKR ++++  M++K EEL  II EL
Sbjct  121  IEYIKKLRTCIRWFMELEDGYMAEQEKLRNMLDSEEKRHADIEAEMRAKVEELTTIIQEL  180

Query  555  RKNIAVLQD  581
            +   A LQ+
Sbjct  181  QSQHASLQE  189



>ref|XP_004154168.1| PREDICTED: kinesin-1 [Cucumis sativus]
 gb|KGN64578.1| hypothetical protein Csa_1G065980 [Cucumis sativus]
Length=798

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 116/179 (65%), Gaps = 10/179 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNGS  224
            MA ++QN+PP +P        K   D+V +DK+RKI   ++  P+    GRQ F  VN  
Sbjct  1    MASRNQNRPPRSPAK------KDVPDDVPLDKRRKIAAGRILGPAAGARGRQPFVDVNNR  54

Query  225  ADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
              +  +    +    +CG +EF KE++++LL EKLK K K+++K K DQ++++ +RLK C
Sbjct  55   QGVSASDACSTEDS-ECGTVEFTKEEIDSLLSEKLKGK-KFDLKGKVDQITDHNKRLKLC  112

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            I+WFQQ+E +++ E+E L++ LESAEK+CS +++ MK + +E ++ +  LR N+A L++
Sbjct  113  IKWFQQIEESHLLEEERLRTALESAEKKCSAIELEMKERADEFSSTVSVLRDNVASLEE  171



>ref|XP_004487619.1| PREDICTED: kinesin-3-like isoform X1 [Cicer arietinum]
 ref|XP_004487620.1| PREDICTED: kinesin-3-like isoform X2 [Cicer arietinum]
Length=760

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCG-VIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            R +F VVNG  DL P+S PPS+AGSD G  IEF +EDVE LL EK K K+++N KE+C+ 
Sbjct  10   RLSFGVVNGGHDLGPSSTPPSNAGSDYGSFIEFTREDVETLLNEKSKRKDRFNYKERCEN  69

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M +YI+RLK CIRWFQ LE +Y  EQE LKS LE ++++C E+++L+K KEEELN+II E
Sbjct  70   MIDYIKRLKVCIRWFQDLELSYSLEQEKLKSSLELSQQKCMEIELLLKIKEEELNSIITE  129

Query  552  LRKNIAVLQD  581
            +R++   LQ+
Sbjct  130  MRRSCTNLQE  139



>ref|XP_010510050.1| PREDICTED: kinesin-3-like [Camelina sativa]
Length=386

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V+NGS DL P S P S+ GS+ G +EF ++ +E LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVINGSKDLTPNSAPASTTGSEYGPVEFTRDYIETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_008778970.1| PREDICTED: kinesin-5-like isoform X2 [Phoenix dactylifera]
Length=803

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 14/188 (7%)
 Frame = +3

Query  51   MAPKSQNKPP----VAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAV  212
            M+ ++QN+PP      PTPS PSN K  +DE  VDK+RKI   +M  P+     RQ  + 
Sbjct  1    MSSRNQNRPPPTPVFDPTPS-PSNKKENLDEAPVDKRRKIRVGRMVCPATNPHARQVLST  59

Query  213  VNGSAD------LpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            VN   +          + P S  GS  G +EF ++EDVE LL EK+K KNK + K K +Q
Sbjct  60   VNAGPNPGGHGDHGAGAAPSSDGGSSGGGVEFTSREDVERLLGEKMKGKNKNDYKGKSEQ  119

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++  MK+K EELN II +
Sbjct  120  MIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEAQMKAKVEELNTIIQD  179

Query  552  LRKNIAVL  575
            L++  A L
Sbjct  180  LQRQHASL  187



>ref|XP_008224876.1| PREDICTED: kinesin-1 [Prunus mume]
Length=801

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 115/187 (61%), Gaps = 29/187 (16%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKI-----------GNPKMPSGVRPGR  197
            MA ++QN+ P      SP   K + DEV VDK+R+I           G P+ P  VR   
Sbjct  1    MASRNQNRAP-----RSPFTKKSSADEVPVDKRRRIETRKTDAQGSMGRPRPPLSVRQEA  55

Query  198  QAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
               + + GS +           GS+C  +EF KE+VEALL EKLK K K++ K K DQ++
Sbjct  56   APTSDI-GSTE-----------GSECASVEFTKEEVEALLNEKLKVK-KFDHKGKADQLA  102

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            +Y +RLK CI+WFQQ+E  +I E+E L++ L SAE++C++ ++ MK+K +ELNA+  +LR
Sbjct  103  DYTKRLKLCIKWFQQVEEGHILEEEKLRNALSSAEQKCTDTEVEMKNKVDELNAVSSKLR  162

Query  558  KNIAVLQ  578
            ++IA L+
Sbjct  163  EDIATLE  169



>ref|XP_008778969.1| PREDICTED: kinesin-5-like isoform X1 [Phoenix dactylifera]
Length=815

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 14/188 (7%)
 Frame = +3

Query  51   MAPKSQNKPP----VAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAV  212
            M+ ++QN+PP      PTPS PSN K  +DE  VDK+RKI   +M  P+     RQ  + 
Sbjct  1    MSSRNQNRPPPTPVFDPTPS-PSNKKENLDEAPVDKRRKIRVGRMVCPATNPHARQVLST  59

Query  213  VNGSAD------LpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            VN   +          + P S  GS  G +EF ++EDVE LL EK+K KNK + K K +Q
Sbjct  60   VNAGPNPGGHGDHGAGAAPSSDGGSSGGGVEFTSREDVERLLGEKMKGKNKNDYKGKSEQ  119

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++  MK+K EELN II +
Sbjct  120  MIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEAQMKAKVEELNTIIQD  179

Query  552  LRKNIAVL  575
            L++  A L
Sbjct  180  LQRQHASL  187



>ref|XP_003596607.1| Kinesin-like protein [Medicago truncatula]
 gb|AES66858.1| kinesin motor domain protein [Medicago truncatula]
Length=761

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCG-VIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            R +F   NG  DL P+S PPS+AGSD G  I+F +EDVEALL EK K K+++N KE+C+ 
Sbjct  10   RLSFGFGNGGHDLGPSSTPPSNAGSDYGSYIDFTREDVEALLNEKSKRKDRFNYKERCEN  69

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M +YI+RLK CIRWFQ LE +Y  EQE LKS LE ++++C E+++L+K KEEELN+II E
Sbjct  70   MIDYIKRLKVCIRWFQDLELSYSLEQEKLKSSLELSQQKCVEIELLLKIKEEELNSIITE  129

Query  552  LRKNIAVLQD  581
            +R+N   LQ+
Sbjct  130  MRRNCTSLQE  139



>ref|XP_010449752.1| PREDICTED: kinesin-3-like [Camelina sativa]
Length=649

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V+NGS DL P S P S+ GS+ G +EF ++ +E LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVINGSKDLTPNSAPASTTGSEYGPVEFTRDYIETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_010511309.1| PREDICTED: kinesin-3-like isoform X1 [Camelina sativa]
Length=649

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V+NGS DL P S P S+ GS+ G +EF ++ +E LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVINGSKDLTPNSAPASTTGSEYGPVEFTRDYIETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_010425918.1| PREDICTED: kinesin-3-like isoform X1 [Camelina sativa]
Length=649

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V+NGS DL P S P S+ GS+ G +EF ++ +E LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVINGSKDLTPNSAPASTTGSEYGPVEFTRDYIETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_010425149.1| PREDICTED: kinesin-3-like isoform X1 [Camelina sativa]
Length=588

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            R A  V+NGS DL P S P S+ GS+ G +EF ++ +E LL E++K K+K+N KE+C+ M
Sbjct  12   RSASPVINGSKDLTPNSAPASTTGSEYGPVEFTRDYIETLLNERIKYKSKFNYKERCENM  71

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             EYI+RL+ CIRWFQ+LE +Y  EQE LK+ LE  EK C++M++ +++KEEELN II EL
Sbjct  72   MEYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCADMEVSLRNKEEELNMIIEEL  131

Query  555  RKNIAVLQ  578
            RKN   +Q
Sbjct  132  RKNFESVQ  139



>ref|XP_003596608.1| Kinesin-like protein [Medicago truncatula]
 gb|AES66859.1| kinesin motor domain protein [Medicago truncatula]
Length=683

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCG-VIEFNKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            R +F   NG  DL P+S PPS+AGSD G  I+F +EDVEALL EK K K+++N KE+C+ 
Sbjct  10   RLSFGFGNGGHDLGPSSTPPSNAGSDYGSYIDFTREDVEALLNEKSKRKDRFNYKERCEN  69

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M +YI+RLK CIRWFQ LE +Y  EQE LKS LE ++++C E+++L+K KEEELN+II E
Sbjct  70   MIDYIKRLKVCIRWFQDLELSYSLEQEKLKSSLELSQQKCVEIELLLKIKEEELNSIITE  129

Query  552  LRKNIAVLQD  581
            +R+N   LQ+
Sbjct  130  MRRNCTSLQE  139



>ref|XP_004485663.1| PREDICTED: kinesin-1-like [Cicer arietinum]
Length=788

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 110/177 (62%), Gaps = 6/177 (3%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P+      G   V+EV  DK+R+IG  K     R  R  F  VN   +
Sbjct  1    MASRNQNRPPRSPSNMQKKGG--GVEEVPSDKRRRIGFEKTDRQGR-ARAPFGAVNNKTE  57

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
                +   S+ GS+C  I+F KE+VEALL E++K    Y+ K+K +QM + I+RLK C+R
Sbjct  58   ---ANDVGSAEGSECSTIDFTKEEVEALLNERMKKGTPYDNKKKMEQMGDLIKRLKNCVR  114

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WF+++E  YI E+E L++ LESAEK+C + +  MK K EELN  I +LR  I+ L++
Sbjct  115  WFKRVEEGYIQEKEKLQTDLESAEKKCIDTENEMKIKIEELNEAISDLRVTISSLEE  171



>ref|XP_007214637.1| hypothetical protein PRUPE_ppa001567mg [Prunus persica]
 gb|EMJ15836.1| hypothetical protein PRUPE_ppa001567mg [Prunus persica]
Length=801

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 114/187 (61%), Gaps = 29/187 (16%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKI-----------GNPKMPSGVRPGR  197
            MA ++QN+ P      SP   K + DEV VDK+R+I           G P+ P  VR   
Sbjct  1    MASRNQNRAP-----RSPFTKKSSADEVPVDKRRRIETRKTDAQGSMGRPRPPLSVRQEA  55

Query  198  QAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMS  377
               + + GS +           GS+C  +EF KE+VEALL EKLK K K++ K K DQ++
Sbjct  56   APTSDI-GSTE-----------GSECASVEFTKEEVEALLNEKLKVK-KFDHKGKADQLA  102

Query  378  EYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            +Y +RLK CI+WFQ +E  ++ E+E L++ L SAE++C++ ++ MK+K +ELNA+  +LR
Sbjct  103  DYTKRLKLCIKWFQHVEEGHLLEEEKLRNALSSAEQKCTDTEVEMKNKVDELNAVSSKLR  162

Query  558  KNIAVLQ  578
            ++IA L+
Sbjct  163  EDIATLE  169



>ref|XP_008813777.1| PREDICTED: kinesin-3-like isoform X2 [Phoenix dactylifera]
Length=214

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 112/178 (63%), Gaps = 14/178 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAP----TPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAV  212
            M+ ++QN+PP  P    TPS PSN K  +DE  VDK+RKI   +M  P+     RQ  + 
Sbjct  1    MSSRNQNRPPPTPVFDPTPS-PSNKKENLDEAPVDKRRKIRVGRMVCPATNPHARQVLST  59

Query  213  VNGSAD------LpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            VN   +          + P S  GS  G +EF ++EDVE LL EK+K KNK + K K +Q
Sbjct  60   VNAGPNPGGHGDHGAGAAPSSDGGSSGGGVEFTSREDVERLLGEKMKGKNKNDYKGKSEQ  119

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAII  545
            M EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++  M++K EELNA +
Sbjct  120  MIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEAQMRAKVEELNAFV  177



>ref|XP_003541768.1| PREDICTED: kinesin-1-like [Glycine max]
 gb|KHN19063.1| Kinesin-1 [Glycine soja]
Length=799

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 109/178 (61%), Gaps = 11/178 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA + +N+PP      S SN K   +EV  DK+R+IG+ +M      GR     +   A+
Sbjct  1    MASRIENRPP-----RSLSNKKGATEEVFSDKRRRIGSERMERQGGRGRAPLGALKADAN  55

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTK-NKYNMKEKCDQMSEYIRRLKQCI  407
                     + GS+C  ++F KE+VEALL+EK  TK N+Y+ K+K DQM + I+RLK C+
Sbjct  56   -----DGAGAEGSECSTVDFTKEEVEALLMEKTNTKENRYDNKKKMDQMGDLIKRLKLCV  110

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RWF+++E  YI ++E L++ L+SAEK+C +++  MK K  EL+  I  LR  I+ L++
Sbjct  111  RWFKRVEEGYILQKEKLQTDLQSAEKKCLDIENEMKIKIAELDETISNLRVTISSLEE  168



>ref|XP_008813775.1| PREDICTED: kinesin-5-like isoform X1 [Phoenix dactylifera]
Length=248

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 112/178 (63%), Gaps = 14/178 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAP----TPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAV  212
            M+ ++QN+PP  P    TPS PSN K  +DE  VDK+RKI   +M  P+     RQ  + 
Sbjct  1    MSSRNQNRPPPTPVFDPTPS-PSNKKENLDEAPVDKRRKIRVGRMVCPATNPHARQVLST  59

Query  213  VNGSAD------LpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQ  371
            VN   +          + P S  GS  G +EF ++EDVE LL EK+K KNK + K K +Q
Sbjct  60   VNAGPNPGGHGDHGAGAAPSSDGGSSGGGVEFTSREDVERLLGEKMKGKNKNDYKGKSEQ  119

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAII  545
            M EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++  M++K EELNA +
Sbjct  120  MIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEAQMRAKVEELNAFV  177



>ref|XP_011012472.1| PREDICTED: kinesin-1-like [Populus euphratica]
Length=800

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (63%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SPS+ K  V+ + +DK+R+IG  +        R+ F  VN   D
Sbjct  1    MASRNQNRPP-----RSPSSKKEGVEGIPLDKRRRIGMGRTGGATNVERKPFGSVNRKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S + GSDCG +EF KE+V+AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VTATSDVGSCAEGSDCGNVEFTKEEVDALVNERLKMK-KFDHKGNLELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ + +++ E+  L+  L++ EK+C+E +  MK+KEE  +A I ELR++ A LQ+
Sbjct  115  KWFQKRDESHVEEEGKLQIALDALEKKCTETEAEMKNKEERFSATISELRQDNACLQE  172



>gb|KHG15484.1| Kinesin-1 -like protein [Gossypium arboreum]
Length=800

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 110/180 (61%), Gaps = 11/180 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRK---IGNPKMPSGVRPGRQAFAVVNG  221
            MA ++QN+PP      SPS  K   DE  +DK+R+   +G    P+     R+AF+ VN 
Sbjct  1    MASRNQNRPP-----RSPSTRKEIGDENPLDKRRRLGAVGRGVGPTATGRTRRAFSAVNN  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D    +        +C   EF KE+VEA+L E+ K K K+++K K +  +E+ +RLK 
Sbjct  56   IQDTTTAANAEVGNAEECH--EFTKEEVEAILNERPKAK-KFDLKAKYEHAAEHNKRLKL  112

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQQ + N++ ++E LK+ LESAEK+C + ++  K+ EEELNA+I ELR + A LQ+
Sbjct  113  CVKWFQQCDENHVLDKEKLKNSLESAEKKCLDTELEKKNMEEELNAVISELRDSNASLQE  172



>ref|XP_006413102.1| hypothetical protein EUTSA_v10024503mg [Eutrema salsugineum]
 gb|ESQ54555.1| hypothetical protein EUTSA_v10024503mg [Eutrema salsugineum]
Length=745

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 94/137 (69%), Gaps = 10/137 (7%)
 Frame = +3

Query  168  KMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKY  347
            +MP+G R  RQAF    G+ DL  T G       + G +EF +EDV+ALL E++K K+KY
Sbjct  4    EMPNGGRI-RQAFP---GTKDLTSTEGS------EYGPVEFTREDVDALLHERIKYKSKY  53

Query  348  NMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEE  527
            N KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE LK+ +E  EK C+++++ +K K+ 
Sbjct  54   NYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEKLKNAMELNEKHCADLEVSLKEKDV  113

Query  528  ELNAIIMELRKNIAVLQ  578
            ELN +I ELRKN A +Q
Sbjct  114  ELNMVIEELRKNFASVQ  130



>gb|KFK29228.1| hypothetical protein AALP_AA7G106500 [Arabis alpina]
Length=745

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +3

Query  195  RQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
            RQAF    G+ DL  T G       + G +EF +EDVEALL E++K K+KYN KE+C+  
Sbjct  12   RQAFP---GTRDLTSTEGS------EYGPLEFTREDVEALLHERIKYKSKYNYKERCENT  62

Query  375  SEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
             +Y++RL+ CIRWFQ+LE +Y  EQE LK+ +E  EK C+++++ +K KEEELN +I EL
Sbjct  63   MDYVKRLRLCIRWFQELELDYAFEQEKLKNAMELNEKHCADLEVSLKEKEEELNMVIEEL  122

Query  555  RKNIAVLQ  578
            RKN + +Q
Sbjct  123  RKNFSSVQ  130



>ref|XP_006285461.1| hypothetical protein CARUB_v10006879mg [Capsella rubella]
 gb|EOA18359.1| hypothetical protein CARUB_v10006879mg [Capsella rubella]
Length=744

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +3

Query  276  GVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            G +EF +EDVEALL E++K K+KYN KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE 
Sbjct  29   GPVEFTREDVEALLHERIKYKSKYNYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEK  88

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
            LK+ +E  EK C+++++ +K KEEELN +I ELRKN A +Q
Sbjct  89   LKNAMEMNEKHCADLELNLKVKEEELNLVIDELRKNFASVQ  129



>ref|XP_010686936.1| PREDICTED: kinesin-1-like [Beta vulgaris subsp. vulgaris]
Length=798

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 111/180 (62%), Gaps = 11/180 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM---PSGVRPGRQAFAVVNG  221
            MA ++QN+ P      SP + K   +E+  DK+RKIG       P+    GR+  + VN 
Sbjct  1    MASRNQNRAP-----KSPHHKKDGGEEIPFDKRRKIGGGSRLTGPTASSRGRRVLSTVNS  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
            +     +     +  S+   +EF +E+VEALL EK+K K K+++K K +Q+SE  ++L+ 
Sbjct  56   NNQDSASDVASVAEASES--VEFTREEVEALLNEKIKGK-KFDLKGKLEQISESNKKLRL  112

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQ +E N   EQE L+  L S+EK+C+E+++  K++E+ELNAII ELR+  A LQD
Sbjct  113  CLKWFQGVEQNLNQEQEKLRDSLNSSEKKCTEIEIGSKNREDELNAIIGELRQKQAALQD  172



>ref|XP_003545783.1| PREDICTED: kinesin-1-like [Glycine max]
Length=800

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (62%), Gaps = 10/178 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA + +N+PP        SN K   +EV  DK+R+IG+ +M      GR     +   A+
Sbjct  1    MASRIENRPPRIL-----SNKKGATEEVFSDKRRRIGSERMERQGGRGRAPLGALKADAN  55

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTK-NKYNMKEKCDQMSEYIRRLKQCI  407
                +   S+ GS+C  ++F KE+VEALL EK+ TK N+Y+ K+K DQM + I+RLK C+
Sbjct  56   ----NDGASAEGSECSTVDFTKEEVEALLNEKMNTKENRYDNKKKMDQMGDLIKRLKLCL  111

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RWF+++E  YI E+E L++ LESAEK+C +++  MK K  EL+  I  LR  I+ L++
Sbjct  112  RWFKRVEEGYIQEKEKLQTDLESAEKKCLDIENEMKIKIAELDETISNLRAAISSLEE  169



>ref|XP_010438647.1| PREDICTED: kinesin-2 [Camelina sativa]
 ref|XP_010438648.1| PREDICTED: kinesin-2 [Camelina sativa]
Length=744

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +3

Query  276  GVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            G +EF +EDVEALL E++K K+KYN KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE 
Sbjct  29   GPVEFTREDVEALLHERIKYKSKYNYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEK  88

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
            LK+ +E  EK C+++++ +K KEEELN +I ELRKN A +Q
Sbjct  89   LKNAMEMNEKHCADLEVNLKVKEEELNLVIDELRKNFASVQ  129



>ref|XP_012091426.1| PREDICTED: kinesin-1 [Jatropha curcas]
 gb|KDP20822.1| hypothetical protein JCGZ_21293 [Jatropha curcas]
Length=785

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 109/177 (62%), Gaps = 7/177 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P+      G      + +DK+R+IG  ++       R+ F  VN   D
Sbjct  1    MASRNQNRPPRSPSTKDGGGG------IPLDKRRRIGAGRIGGPNSTDRRPFGSVNKRQD  54

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
            +       S+ GS+C  I+F KE++EAL++E+ K K K++ K   + +SE   RLK CI+
Sbjct  55   VTAPGDIGSTEGSECENIDFTKEEIEALVIERPKMK-KFDHKGNMELVSELNNRLKLCIK  113

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQ+ + +++ EQ  L++ LES+EK+C++MDM MKS+EE+ N  I ELRK    LQ+
Sbjct  114  WFQKRDESHVDEQGKLRNALESSEKKCADMDMEMKSREEKYNEDISELRKENISLQE  170



>ref|XP_002316704.1| KINESIN-LIKE protein A [Populus trichocarpa]
 gb|EEE97316.1| KINESIN-LIKE protein A [Populus trichocarpa]
Length=801

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SPS+ K  V+ + +DK+R+I   +        R+ F  VN   D
Sbjct  1    MASRNQNRPP-----RSPSSKKEGVEGIPLDKRRRIAMGRTGGATNVERKPFGSVNRKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S + GSDCG +EF KE+V+AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VTATSDVGSCAEGSDCGNVEFTKEEVDALVNERLKMK-KFDHKGNLELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ + +++ E+  L+  L++ EK+C+E +  MK+KEE  +A I ELR++ A LQ+
Sbjct  115  KWFQKRDESHVEEEGKLQIALDALEKKCTETEAEMKNKEERFSATISELRQDNACLQE  172



>ref|XP_010999547.1| PREDICTED: kinesin-1-like isoform X3 [Populus euphratica]
Length=800

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SPS+ K  V+ + +DK+R+IG  +        R+ F  VN   D
Sbjct  1    MASRNQNRPP-----RSPSSKKEGVEGIPLDKRRRIGMGRTGGATNVERKPFGSVNRKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S + GSDCG +EF KE+V+AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VTATSDVGSCAEGSDCGNVEFTKEEVDALVNERLKMK-KFDHKGNLELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ + +++ E+  L+  L++ EK+C+E +  MK+KE   +A I ELR++ A LQ+
Sbjct  115  KWFQKRDESHVEEEGKLQIALDALEKKCTETEAEMKNKEGRFSATISELRQDNACLQE  172



>ref|XP_010999545.1| PREDICTED: kinesin-1-like isoform X1 [Populus euphratica]
Length=801

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SPS+ K  V+ + +DK+R+IG  +        R+ F  VN   D
Sbjct  1    MASRNQNRPP-----RSPSSKKEGVEGIPLDKRRRIGMGRTGGATNVERKPFGSVNRKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S + GSDCG +EF KE+V+AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VTATSDVGSCAEGSDCGNVEFTKEEVDALVNERLKMK-KFDHKGNLELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ + +++ E+  L+  L++ EK+C+E +  MK+KE   +A I ELR++ A LQ+
Sbjct  115  KWFQKRDESHVEEEGKLQIALDALEKKCTETEAEMKNKEGRFSATISELRQDNACLQE  172



>ref|XP_010999546.1| PREDICTED: kinesin-1-like isoform X2 [Populus euphratica]
Length=801

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SPS+ K  V+ + +DK+R+IG  +        R+ F  VN   D
Sbjct  1    MASRNQNRPP-----RSPSSKKEGVEGIPLDKRRRIGMGRTGGATNVERKPFGSVNRKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S + GSDCG +EF KE+V+AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VTATSDVGSCAEGSDCGNVEFTKEEVDALVNERLKMK-KFDHKVNLELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ + +++ E+  L+  L++ EK+C+E +  MK+KE   +A I ELR++ A LQ+
Sbjct  115  KWFQKRDESHVEEEGKLQIALDALEKKCTETEAEMKNKEGRFSATISELRQDNACLQE  172



>gb|EPS63940.1| hypothetical protein M569_10842, partial [Genlisea aurea]
Length=396

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = +3

Query  180  GVRP-GRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMK  356
            G RP  RQA ++VN   D         ++ SDC  +EF  EDVE+LL EKLK K++ N K
Sbjct  3    GRRPQTRQALSLVNVGQD--APPSNAVNSESDCVAMEFTAEDVESLLNEKLK-KSRLNHK  59

Query  357  EKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELN  536
            E  ++MSEYI+RLK CI+WFQQLE  + SEQE+LK+LL+ A+K+CS+ +++MK KE+ELN
Sbjct  60   ENSEKMSEYIKRLKLCIKWFQQLEMKHNSEQENLKNLLDLADKKCSDTELMMKEKEDELN  119

Query  537  AIIMELRKNIAVLQD  581
            + I  LRK++  L++
Sbjct  120  SNITLLRKDLHALKE  134



>ref|NP_567768.1| kinesin 2 [Arabidopsis thaliana]
 sp|P46864.1|ATK2_ARATH RecName: Full=Kinesin-2; AltName: Full=Kinesin-like protein B 
[Arabidopsis thaliana]
 dbj|BAA04673.1| heavy chain polypeptide of kinesin-like protein [Arabidopsis 
thaliana]
 gb|AEE85310.1| kinesin 2 [Arabidopsis thaliana]
Length=745

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  276  GVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            G +EF +EDVE LL E++K K+KYN KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE 
Sbjct  30   GPVEFTREDVETLLHERIKYKSKYNYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEK  89

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
            LK+ +E  EK C+++++ +K KEEELN +I ELRKN A +Q
Sbjct  90   LKNAMEMNEKHCADLEVNLKVKEEELNMVIDELRKNFASVQ  130



>emb|CAB38848.1| kinesin-related protein katB [Arabidopsis thaliana]
 emb|CAB79573.1| kinesin-related protein katB [Arabidopsis thaliana]
Length=744

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  276  GVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            G +EF +EDVE LL E++K K+KYN KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE 
Sbjct  30   GPVEFTREDVETLLHERIKYKSKYNYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEK  89

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
            LK+ +E  EK C+++++ +K KEEELN +I ELRKN A +Q
Sbjct  90   LKNAMEMNEKHCADLEVNLKVKEEELNMVIDELRKNFASVQ  130



>ref|XP_010088100.1| hypothetical protein L484_014846 [Morus notabilis]
 gb|EXB31419.1| hypothetical protein L484_014846 [Morus notabilis]
Length=782

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 113/180 (63%), Gaps = 9/180 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPG---RQAFAVVNG  221
            MA ++QN+ P      SP+  K  VD+V  DK+R+IG  + P     G   RQ F+ VN 
Sbjct  1    MASRNQNRAP-----RSPNAKKEGVDDVPFDKRRRIGVTRAPGQTGSGPPRRQPFSSVNN  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D   T+   +S  S+   +EF KE+VEALL EKLK  +K++ K+K +Q+ +  +R K 
Sbjct  56   RQDATATAADANSIESENTSVEFTKEEVEALLNEKLKA-SKFDHKKKAEQLGDQNKRFKL  114

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQ++E + + EQE L + LE +EK+C + ++ +K+K EE+N I +EL+K IA L++
Sbjct  115  CVKWFQRVEESSLLEQEKLHNALECSEKKCLDTELELKNKVEEMNQINLELQKTIATLEE  174



>ref|XP_006396621.1| hypothetical protein EUTSA_v10028442mg [Eutrema salsugineum]
 gb|ESQ38074.1| hypothetical protein EUTSA_v10028442mg [Eutrema salsugineum]
Length=793

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+PP +P     S        +  DK+RK     M +     RQ  + VN    
Sbjct  1    MPLRNQNRPPRSPNAKKESGSG-----IPFDKRRK-----METQGTGRRQVLSTVN---K  47

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
            L  TS     +  +CG +EF K++V ALL E+ K   K++ K K +QM++ IRRLK C+R
Sbjct  48   LDVTSNSDVGSTEECGKVEFTKDEVVALLSERAKA-GKFDTKGKIEQMTDIIRRLKVCVR  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+L+S LESAEKR S+ ++  K+KEEEL AII E+++ IA LQ+
Sbjct  107  WFQQVDETHVQEKENLRSSLESAEKRYSDKELGAKTKEEELQAIIAEMKEKIASLQE  163



>ref|XP_011003399.1| PREDICTED: kinesin-1-like isoform X1 [Populus euphratica]
 ref|XP_011003400.1| PREDICTED: kinesin-1-like isoform X1 [Populus euphratica]
Length=791

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 109/178 (61%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+PP      SPS+ K  V+ + +DK+R+IG  +    +   R+ F  VN   D
Sbjct  1    MTSRNQNRPP-----RSPSSKKEGVESIPLDKRRRIGMGRTGGAMNAERKPFGSVNKKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S   GSDCG +EF KE+++AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VAATSDVGSCVEGSDCGNVEFTKEEIDALVNERLKMK-KFDHKGNMELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ +  ++  +  L++ L++ EK+C+E +  MK+KEE  +A I ELR++   +Q+
Sbjct  115  KWFQKRDEAHVEGEGKLQNALDALEKKCAETEAEMKNKEERFSATISELRQDNTCVQE  172



>ref|XP_009143182.1| PREDICTED: kinesin-2 [Brassica rapa]
Length=745

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 93/137 (68%), Gaps = 10/137 (7%)
 Frame = +3

Query  168  KMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKY  347
            +M +G R  RQ+F    G+ DL  T G       + G +EF +EDV+ALL E++K K+KY
Sbjct  4    EMTNGGRI-RQSFP---GARDLTSTEGS------EYGPVEFTREDVDALLHERIKYKSKY  53

Query  348  NMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEE  527
            N KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE LK+ +E  EK C+++++ +K KE 
Sbjct  54   NYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEKLKNAMELNEKHCADLEVSLKEKEV  113

Query  528  ELNAIIMELRKNIAVLQ  578
            ELN +I ELRKN + +Q
Sbjct  114  ELNLVIHELRKNFSSVQ  130



>ref|XP_011003402.1| PREDICTED: kinesin-1-like isoform X3 [Populus euphratica]
Length=790

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 109/178 (61%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+PP      SPS+ K  V+ + +DK+R+IG  +    +   R+ F  VN   D
Sbjct  1    MTSRNQNRPP-----RSPSSKKEGVESIPLDKRRRIGMGRTGGAMNAERKPFGSVNKKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S   GSDCG +EF KE+++AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VAATSDVGSCVEGSDCGNVEFTKEEIDALVNERLKMK-KFDHKGNMELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ +  ++  +  L++ L++ EK+C+E +  MK+KEE  +A I ELR++   +Q+
Sbjct  115  KWFQKRDEAHVEGEGKLQNALDALEKKCAETEAEMKNKEERFSATISELRQDNTCVQE  172



>ref|XP_002304982.1| KINESIN-LIKE protein A [Populus trichocarpa]
 gb|EEE85493.1| KINESIN-LIKE protein A [Populus trichocarpa]
Length=791

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+PP      SPS+ K  V+ + +DK+R+IG  +        R+ F  VN   D
Sbjct  1    MTSRNQNRPP-----RSPSSKKEGVESIPLDKRRRIGMGRTGGATNAERKPFGSVNKKLD  55

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S   GSDCG +EF KE+++AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  56   VAATSDVGSCVEGSDCGNVEFTKEEIDALVNERLKMK-KFDHKGNMELVSELNARLKVCI  114

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ +  ++  +  L+  L++ EK+C+E +  MK+KEE  +A I ELR++   +Q+
Sbjct  115  KWFQKRDEAHVEGEGKLQKALDALEKKCAETEAEMKNKEERFSATISELRQDNTCVQE  172



>emb|CDX89269.1| BnaA01g16240D [Brassica napus]
Length=707

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 93/137 (68%), Gaps = 10/137 (7%)
 Frame = +3

Query  168  KMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKY  347
            +M +G R  RQ+F    G+ DL  T G       + G +EF +EDV+ALL E++K K+KY
Sbjct  4    EMTNGGRI-RQSFP---GARDLTSTEGS------EYGPVEFTREDVDALLHERIKYKSKY  53

Query  348  NMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEE  527
            N KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE LK+ +E  EK C+++++ +K KE 
Sbjct  54   NYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEKLKNAMELNEKHCADLEVSLKEKEV  113

Query  528  ELNAIIMELRKNIAVLQ  578
            ELN +I ELRKN + +Q
Sbjct  114  ELNLVIHELRKNFSSVQ  130



>ref|XP_009393339.1| PREDICTED: kinesin-5-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=810

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 10/178 (6%)
 Frame = +3

Query  72   KPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRP---GRQAFAVVNGSAD-Lpp  239
            KPP+ P   + +  K  VDE S+DK+R++   K  +G  P   GRQ  + VN   D +  
Sbjct  8    KPPLPPRSPTRAKRKENVDEASLDKRRRVVAGK--TGASPNDRGRQVLSAVNAGPDPVGN  65

Query  240  tsgppssagsDCG---VIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
                  + GSD G    IEF ++EDVE LL EK+K KNK + K K +QM EYI++L+ CI
Sbjct  66   RDQVAPAEGSDGGNVAAIEFESREDVERLLGEKMKGKNKNDYKGKSEQMMEYIKKLRVCI  125

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RW+  LE  Y++EQE+L++L+ + E R S+++  M++K  EL A I EL++    LQ+
Sbjct  126  RWYMDLEDKYLAEQENLRNLMTAEENRHSDIENQMRAKVTELEATIEELKRECESLQE  183



>emb|CDY29282.1| BnaC01g19340D [Brassica napus]
Length=707

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 92/137 (67%), Gaps = 10/137 (7%)
 Frame = +3

Query  168  KMPSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKY  347
            +M +G R  RQ+F    G+ DL  T G       + G +EF +EDV+ALL E++K K+KY
Sbjct  4    EMTNGGRI-RQSFP---GARDLTSTEGS------EYGPVEFTREDVDALLHERIKYKSKY  53

Query  348  NMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEE  527
            N KE+C+   +Y++RL+ CIRWFQ+LE +Y  EQE LK+ +   EK C+++++ +K KE 
Sbjct  54   NYKERCENTMDYVKRLRLCIRWFQELELDYAFEQEKLKNAMGLNEKHCADLEVSLKEKEV  113

Query  528  ELNAIIMELRKNIAVLQ  578
            ELN +I ELRKN + +Q
Sbjct  114  ELNLVIHELRKNFSSVQ  130



>ref|XP_009393340.1| PREDICTED: kinesin-5-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=810

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 10/178 (6%)
 Frame = +3

Query  72   KPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRP---GRQAFAVVNGSAD-Lpp  239
            KPP+ P   + +  K  VDE S+DK+R++   K  +G  P   GRQ  + VN   D +  
Sbjct  8    KPPLPPRSPTRAKRKENVDEASLDKRRRVVAGK--TGASPNDRGRQVLSAVNAGPDPVGN  65

Query  240  tsgppssagsDCG---VIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
                  + GSD G    IEF ++EDVE LL EK+K KNK + K K +QM EYI++L+ CI
Sbjct  66   RDQVAPAEGSDGGNVAAIEFESREDVERLLGEKMKGKNKNDYKGKSEQMMEYIKKLRVCI  125

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RW+  LE  Y++EQE+L++L+ + E R S+++  M++K  EL A I EL++    LQ+
Sbjct  126  RWYMDLEDKYLAEQENLRNLMTAEENRHSDIENQMRAKVTELEATIEELKRECESLQE  183



>ref|XP_009393338.1| PREDICTED: kinesin-5-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=811

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 10/178 (6%)
 Frame = +3

Query  72   KPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRP---GRQAFAVVNGSAD-Lpp  239
            KPP+ P   + +  K  VDE S+DK+R++   K  +G  P   GRQ  + VN   D +  
Sbjct  8    KPPLPPRSPTRAKRKENVDEASLDKRRRVVAGK--TGASPNDRGRQVLSAVNAGPDPVGN  65

Query  240  tsgppssagsDCG---VIEF-NKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
                  + GSD G    IEF ++EDVE LL EK+K KNK + K K +QM EYI++L+ CI
Sbjct  66   RDQVAPAEGSDGGNVAAIEFESREDVERLLGEKMKGKNKNDYKGKSEQMMEYIKKLRVCI  125

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RW+  LE  Y++EQE+L++L+ + E R S+++  M++K  EL A I EL++    LQ+
Sbjct  126  RWYMDLEDKYLAEQENLRNLMTAEENRHSDIENQMRAKVTELEATIEELKRECESLQE  183



>ref|XP_010529372.1| PREDICTED: kinesin-1-like [Tarenaya hassleriana]
Length=790

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (63%), Gaps = 25/176 (14%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVN----  218
            MAP++QN+PP +P+       K  +  +  DK+RK+   +M    R  RQ  + VN    
Sbjct  1    MAPRNQNRPPRSPSK------KEGISSIPFDKRRKL---EMQGTSR--RQVLSTVNRQDA  49

Query  219  -GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
              ++DL            DCG +EF K++V ALL E+ K  +K++ K K +QM++ I+RL
Sbjct  50   AANSDLGTAE--------DCGKVEFTKDEVVALLNERPKA-SKFDSKAKIEQMTDIIKRL  100

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKN  563
            K C++WFQQ++  ++ E+E+L++ LESAEKR S+ ++ MK+KEEEL+A I +L +N
Sbjct  101  KICVKWFQQVDETHVQEKENLRNSLESAEKRSSDRELEMKAKEEELHATISQLNEN  156



>ref|XP_011003401.1| PREDICTED: kinesin-1-like isoform X2 [Populus euphratica]
 ref|XP_011003403.1| PREDICTED: kinesin-1-like isoform X2 [Populus euphratica]
Length=790

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 108/178 (61%), Gaps = 8/178 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+PP +P+       K  V+ + +DK+R+IG  +    +   R+ F  VN   D
Sbjct  1    MTSRNQNRPPRSPSK------KEGVESIPLDKRRRIGMGRTGGAMNAERKPFGSVNKKLD  54

Query  231  Lpptsgpps-sagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCI  407
            +  TS   S   GSDCG +EF KE+++AL+ E+LK K K++ K   + +SE   RLK CI
Sbjct  55   VAATSDVGSCVEGSDCGNVEFTKEEIDALVNERLKMK-KFDHKGNMELVSELNARLKVCI  113

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +WFQ+ +  ++  +  L++ L++ EK+C+E +  MK+KEE  +A I ELR++   +Q+
Sbjct  114  KWFQKRDEAHVEGEGKLQNALDALEKKCAETEAEMKNKEERFSATISELRQDNTCVQE  171



>ref|XP_010057684.1| PREDICTED: kinesin-1-like [Eucalyptus grandis]
Length=802

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 115/179 (64%), Gaps = 8/179 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNGS  224
            M+ ++QN+ P      SP+  K  + E+ +DK+R+IG  +   P+     RQAF+ VN  
Sbjct  1    MSSRNQNRQP-----RSPNAKKGALVEIPLDKRRRIGAARATGPTSSSRARQAFSEVNNR  55

Query  225  ADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
             D+  T    S+ GS+   +EF KE+VE LL EK KTK K+++K K + M+++ +RL+ C
Sbjct  56   QDVTSTGETASAEGSENIPVEFTKEEVETLLNEKPKTK-KFDLKGKLEYMTDHNKRLRLC  114

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            ++WFQ+++  ++ EQE L++ LESAEK+C++ +  M+ K  ELN ++ +LR + + LQ+
Sbjct  115  VKWFQRVDEGHLLEQERLRNSLESAEKKCTDTEFEMEKKLGELNEVLAQLRNDNSSLQE  173



>ref|XP_007025915.1| Kinesin 1 [Theobroma cacao]
 gb|EOY28537.1| Kinesin 1 [Theobroma cacao]
Length=803

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 112/180 (62%), Gaps = 9/180 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMP---SGVRPGRQAFAVVNG  221
            MA ++QN+PP      SPS  K   DE  +DK+R++G        +G    RQAFAVVN 
Sbjct  1    MASRNQNRPP-----RSPSTRKEIGDENPLDKRRRVGAVGRGVGLTGTGRTRQAFAVVNN  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D+   S   +    +C   EF KE+VEALL EK K K K++++ K +  +++ +RLK 
Sbjct  56   RQDVTTASNADAGNAEECPNHEFTKEEVEALLNEKPKAK-KFDLRAKYEHAADHNKRLKL  114

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQQ + +++ ++E LK+ LESAEK+C + ++  K KEEELNA+I +L  N A LQ+
Sbjct  115  CVKWFQQCDESHVLDKEKLKNSLESAEKKCMDTELEKKKKEEELNAVISQLSDNNASLQE  174



>ref|XP_010434203.1| PREDICTED: kinesin-1-like [Camelina sativa]
Length=792

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 107/177 (60%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SP++ K  +  +S DK+RK+            RQAF+ VN   D
Sbjct  1    MASRNQNRPP-----RSPNSKKEGLGSISFDKRRKVETQGTGR-----RQAFSAVN-KQD  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
            +  TS   S    +CG ++F K++V ALL E+ K   K++ K K +QM++ I+RLK C+R
Sbjct  50   ITTTSDVGSIE--ECGKVDFTKDEVLALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVR  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+ K  LESAE++ +  ++  K+KEEEL A I  L +N+  L D
Sbjct  107  WFQQVDETHVQEKENFKVSLESAEQKYNHKELEAKTKEEELQATISNLEENVVSLHD  163



>ref|XP_003593375.1| Kinesin-like protein [Medicago truncatula]
Length=787

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 105/177 (59%), Gaps = 7/177 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M+ ++QN+ P      SPSN +        +K+R+IG  +M    R GR     +N  +D
Sbjct  1    MSSRNQNRAP------SPSNMQKKGGGAEENKRRRIGGERMVVQGR-GRAPLGSLNNRSD  53

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
                +G  ++ GS+  +IEF KE+VEALL EK+K  N  + K+K +QM + I+RLK C+R
Sbjct  54   ANDGAGGGATEGSEPSIIEFTKEEVEALLTEKMKKGNPLDTKKKMEQMVDLIKRLKNCVR  113

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WF+ +E  YI E+E L++ LESAEK+C + +  M  K  ELN  I  LR  I+ L++
Sbjct  114  WFKVVEEGYIKEKEKLQTDLESAEKKCVDTENEMNMKIAELNEAISNLRMTISSLEE  170



>gb|AES63626.2| kinesin motor catalytic domain protein [Medicago truncatula]
Length=785

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 106/177 (60%), Gaps = 9/177 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M+ ++QN+ P      SPSN K    E   +K+R+IG  +M    R GR     +N  +D
Sbjct  1    MSSRNQNRAP------SPSNKKGGGAEE--NKRRRIGGERMVVQGR-GRAPLGSLNNRSD  51

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
                +G  ++ GS+  +IEF KE+VEALL EK+K  N  + K+K +QM + I+RLK C+R
Sbjct  52   ANDGAGGGATEGSEPSIIEFTKEEVEALLTEKMKKGNPLDTKKKMEQMVDLIKRLKNCVR  111

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WF+ +E  YI E+E L++ LESAEK+C + +  M  K  ELN  I  LR  I+ L++
Sbjct  112  WFKVVEEGYIKEKEKLQTDLESAEKKCVDTENEMNMKIAELNEAISNLRMTISSLEE  168



>gb|KFK32217.1| hypothetical protein AALP_AA6G213100 [Arabis alpina]
Length=794

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 16/179 (9%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEV--SVDKKRKIGNPKMPSGVRPGRQAFAVVNGS  224
            M+ ++QN+ P  P      N  F   E   S+DK+RK+       G    RQ  + VN  
Sbjct  1    MSLRNQNRVPRTP------NANFQKKEGLPSIDKRRKMETQ----GTTGRRQVLSTVNRQ  50

Query  225  ADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
                 T+     +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I++LK C
Sbjct  51   ---DVTANSDVGSTEECGKVEFTKDEVAALLNERAKA-GKFDTKAKIEQMTDIIKKLKVC  106

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +RWFQQ+E  ++ E+E+L SLLESA KR  + ++  K+KEEEL A I E+++NIA LQ+
Sbjct  107  VRWFQQVEETHVQEKENLGSLLESAGKRYCDKELDAKTKEEELQATIAEMKQNIATLQE  165



>ref|XP_010449096.1| PREDICTED: kinesin-1-like [Camelina sativa]
Length=792

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P       G      +  DK+RK+            RQAF+ VN   D
Sbjct  1    MASRNQNRPPRSPNSKKEGFGN-----IPFDKRRKVETQGTGR-----RQAFSAVN-KQD  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
            +  TS   S    +CG ++F K++V ALL E+ K   K++ K K +QM++ I+RLK C+R
Sbjct  50   ITTTSDVGSIE--ECGKVDFTKDEVLALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVR  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+++LK  LESAE++ +  ++  K+KEEEL AII  L +N+  L D
Sbjct  107  WFQQVDETHVQEKDNLKVSLESAEQKYNHKELEAKTKEEELQAIISNLEENVVSLHD  163



>ref|XP_010538054.1| PREDICTED: kinesin-1 isoform X2 [Tarenaya hassleriana]
Length=784

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 110/177 (62%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M P++QN+PP      SPS  K     +  DK+RK+   +M    R  RQ  + +N   D
Sbjct  1    MPPRNQNRPP-----RSPSAKKEGAASIPFDKRRKL---EMQVAGR--RQVLSTMN-RQD  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
            +   S   S+   D   +EF K++V ALL E+ K  +K++ K K +QM++ I+RLK C++
Sbjct  50   ISANSDVSSAE--DRAKVEFTKDEVVALLNERPKA-SKFDSKSKIEQMTDIIKRLKMCVK  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ+E  ++ E+E+L++ LESAEKRCS+ D+ MK+KEE L A I +L+++   LQ+
Sbjct  107  WFQQVEETHVQEKENLRTSLESAEKRCSDRDLEMKTKEEGLQATISQLKEHNMSLQE  163



>ref|XP_010538046.1| PREDICTED: kinesin-1 isoform X1 [Tarenaya hassleriana]
Length=791

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 110/177 (62%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M P++QN+PP      SPS  K     +  DK+RK+   +M    R  RQ  + +N   D
Sbjct  1    MPPRNQNRPP-----RSPSAKKEGAASIPFDKRRKL---EMQVAGR--RQVLSTMN-RQD  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
            +   S   S+   D   +EF K++V ALL E+ K  +K++ K K +QM++ I+RLK C++
Sbjct  50   ISANSDVSSAE--DRAKVEFTKDEVVALLNERPKA-SKFDSKSKIEQMTDIIKRLKMCVK  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ+E  ++ E+E+L++ LESAEKRCS+ D+ MK+KEE L A I +L+++   LQ+
Sbjct  107  WFQQVEETHVQEKENLRTSLESAEKRCSDRDLEMKTKEEGLQATISQLKEHNMSLQE  163



>gb|KJB69351.1| hypothetical protein B456_011G018600 [Gossypium raimondii]
Length=802

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 111/180 (62%), Gaps = 12/180 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIG---NPKMPSGVRPGRQAFAVVNG  221
            MA + QN+PP      SPS+ K   DE  +DK+R++G        +G    RQ FAVVN 
Sbjct  1    MASRIQNRPP-----RSPSSRKELGDENPLDKRRRLGAMGRGAGSTGTARTRQPFAVVNN  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D+   +   +    +C   EF KE+VEA+L EK K K K+++K K +  +E+ ++LK 
Sbjct  56   RQDVNTAAVANAE---ECSNHEFTKEEVEAILNEKPKAK-KFDLKAKYEHAAEHNKKLKL  111

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQQ + N++ + E LKS LESAEKRC + ++  K+KEEELN II ELR N A L++
Sbjct  112  CVKWFQQCDENHVIDAEKLKSSLESAEKRCIDTELEKKNKEEELNTIISELRDNNASLEE  171



>gb|KHG03570.1| Kinesin-1 -like protein [Gossypium arboreum]
Length=802

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 111/180 (62%), Gaps = 12/180 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIG---NPKMPSGVRPGRQAFAVVNG  221
            MA + QN+PP      SPS+ K   DE  +DK+R++G        +G    RQ FAVVN 
Sbjct  1    MASRIQNRPP-----RSPSSRKELGDENPLDKRRRLGAMGRGAGSTGTARTRQPFAVVNN  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D+   +   +    +C   EF KE+VEA+L EK K K K+++K K +  +E+ ++LK 
Sbjct  56   RQDVNTAAVANAE---ECSNHEFTKEEVEAILNEKPKAK-KFDLKAKYEHAAEHNKKLKL  111

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQQ + N++ + E LKS LESAEKRC + ++  K+KEEELN II ELR N A L++
Sbjct  112  CVKWFQQCDENHVIDAEKLKSSLESAEKRCIDTELEKKNKEEELNTIISELRDNNASLEE  171



>emb|CAA20193.1| kinesin-related protein katA (fragment) [Arabidopsis thaliana]
Length=397

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 103/177 (58%), Gaps = 13/177 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P       G      +S DK+RK+       G    RQAF+ VN    
Sbjct  1    MASRNQNRPPRSPNAKKEGLGG-----ISFDKRRKVETQ----GGTGRRQAFSAVNKQ--  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T      +  +CG ++F K+++ ALL E+ K   K++ K K +QM++ I+RLK C++
Sbjct  50   -DVTMNSDVGSIEECGKVDFTKDEILALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVK  107

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ +  ++ E+E+LK  LES+E++ +  ++  ++KEEEL A I +L +N+  L +
Sbjct  108  WFQQADETHVQEKENLKVSLESSEQKYNHKELEARTKEEELQATISKLEENVVSLHE  164



>ref|XP_010059163.1| PREDICTED: kinesin-3-like [Eucalyptus grandis]
Length=405

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = +3

Query  114  KFTVDEVSVDKKRKIGNPKM--PSGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIE  287
            K  + E+ +DK+R+IG  +   P+     RQAF+ VN   D+  T    S+ GS+   +E
Sbjct  111  KGALVEIPLDKRRRIGAARATGPTSSSRARQAFSEVNNRQDVTSTGEAVSAEGSENIPVE  170

Query  288  FNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksl  467
            F KE+VE LL EK KTK K+++K K + ++++ +RL+ C++WFQ+++  ++ EQE L++ 
Sbjct  171  FTKEEVETLLNEKPKTK-KFDLKGKLEYLTDHNKRLRLCVKWFQRVDEGHLLEQERLRNS  229

Query  468  lesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            LESAEK+C+E +  M+ K  ELN ++ +LR + + LQ+
Sbjct  230  LESAEKKCTETEFEMEKKLGELNEVLAQLRNDNSSLQE  267



>gb|KFK32218.1| hypothetical protein AALP_AA6G213200 [Arabis alpina]
Length=791

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 15/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+ P    P SP+  K  +   S+DK+RK+            RQ    VN    
Sbjct  1    MPLRNQNRAP----PRSPNTKKEGLP--SIDKRRKVETQGTGR-----RQVLGTVNRQ--  47

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I+RLK C+R
Sbjct  48   -DVTANSDVGSIEECGKVEFTKDEVMALLNERAKA-GKFDTKAKIEQMTDIIKRLKVCVR  105

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ+E  +I E+E+L+SLLESAEKR S+ ++  K+KEEEL A I E+++ IA L++
Sbjct  106  WFQQVEETHIQEKENLQSLLESAEKRYSDKELDAKTKEEELQATIAEMKEKIASLKE  162



>ref|XP_009420213.1| PREDICTED: kinesin-5-like [Musa acuminata subsp. malaccensis]
Length=797

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 110/180 (61%), Gaps = 9/180 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPS---SPSNGKFTVDEVS-VDKKRKIGNPKMPSGVRPGRQAFAVVN  218
            M+ + Q+KPP+   P+   SPSN K  + E + +DK+RK+ +P   S  R  RQ  + VN
Sbjct  1    MSSRVQSKPPLPAHPNLSRSPSNKKENLGETTPIDKRRKMVSP--ASNGRAPRQVLSSVN  58

Query  219  GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLK  398
               +        S  GS  GV   ++EDVE LL EK+K KNK + K K +QM EYI++L+
Sbjct  59   AGPN---PGDQASDGGSSSGVEFGSREDVEKLLGEKMKGKNKNDYKGKSEQMIEYIKKLR  115

Query  399  QCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
             CIR + +LE  Y++EQE L+++L+  EKR  E++  MK K +EL++ + E++   ++LQ
Sbjct  116  ICIRCYMELEDGYLAEQEKLRNMLDFEEKRHGEIETQMKFKIDELDSTLKEIQNQYSLLQ  175



>ref|NP_193859.1| kinesin-like motor protein heavy chain [Arabidopsis thaliana]
 sp|Q07970.1|ATK1_ARATH RecName: Full=Kinesin-1; AltName: Full=Kinesin-like protein A 
[Arabidopsis thaliana]
 dbj|BAA01972.1| kinesin-like motor protein heavy chain [Arabidopsis thaliana]
 emb|CAA17546.1| kinesin-related protein katA [Arabidopsis thaliana]
 emb|CAB79127.1| kinesin-related protein katA [Arabidopsis thaliana]
 gb|AEE84434.1| kinesin-like motor protein heavy chain [Arabidopsis thaliana]
Length=793

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 103/177 (58%), Gaps = 13/177 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P       G      +S DK+RK+       G    RQAF+ VN    
Sbjct  1    MASRNQNRPPRSPNAKKEGLGG-----ISFDKRRKVETQ----GGTGRRQAFSAVNKQ--  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T      +  +CG ++F K+++ ALL E+ K   K++ K K +QM++ I+RLK C++
Sbjct  50   -DVTMNSDVGSIEECGKVDFTKDEILALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVK  107

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ +  ++ E+E+LK  LES+E++ +  ++  ++KEEEL A I +L +N+  L +
Sbjct  108  WFQQADETHVQEKENLKVSLESSEQKYNHKELEARTKEEELQATISKLEENVVSLHE  164



>ref|XP_003528413.1| PREDICTED: kinesin-1-like [Glycine max]
Length=786

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 103/170 (61%), Gaps = 12/170 (7%)
 Frame = +3

Query  81   VAPTPSSPSNGKFTVDEVSVDKKRKI-GNPKMP--SGVRPGRQAFAVVNGSADLpptsgp  251
            +A    S +N K   +E S+DK+R+I G  KM    G R  R  F+VV  +A     +  
Sbjct  1    MASRYHSSTNKKVGPEEASLDKRRRILGADKMDRQQGGRV-RTPFSVVTNNAATSDAAEG  59

Query  252  pssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEG  431
             +       V++F K++VE LL EK    N Y+ K+K +QM++ I+RLK C+RWF+++E 
Sbjct  60   AAV------VVDFTKDEVETLLNEK--KGNTYDNKKKIEQMTDLIKRLKLCVRWFKRIEE  111

Query  432  NYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             Y+ E+E L+  LE+AEK+C++ +  MKSK EEL   + +LRK I+ L++
Sbjct  112  GYVQEKEKLRFELEAAEKKCTDTETEMKSKIEELEETVSDLRKTISSLEE  161



>ref|XP_002867856.1| hypothetical protein ARALYDRAFT_914554 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44115.1| hypothetical protein ARALYDRAFT_914554 [Arabidopsis lyrata subsp. 
lyrata]
Length=792

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 102/177 (58%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P       G      +  DK+RK+            RQAF+ VN    
Sbjct  1    MASRNQNRPPRSPNAKKEGLGG-----IPFDKRRKVETQGTGR-----RQAFSAVNKQ--  48

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T      +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I+RLK C++
Sbjct  49   -DVTMNSDVGSIEECGKVEFTKDEVLALLSERAKA-GKFDTKAKIEQMTDIIKRLKICVK  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ +  ++ E+ESL+  LESAE++ +  ++  ++KEEEL+A I  L++N+  L +
Sbjct  107  WFQQADETHVQEKESLRVSLESAEQKYNHKELEARTKEEELHATISNLKENVVSLHE  163



>ref|XP_003532576.1| PREDICTED: kinesin-1-like isoform X1 [Glycine max]
Length=790

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 98/155 (63%), Gaps = 7/155 (5%)
 Frame = +3

Query  126  DEVSVDKKRKI-GNPKMP--SGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNK  296
            +E S+DK+R+I G  KM    G    R  F+VV  +A    T+     A     V++F K
Sbjct  15   EEASLDKRRRILGADKMDRQQGGSRVRTPFSVVTNTAATSDTANAAEGAAV---VVDFTK  71

Query  297  EDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslkslles  476
            ++VEALL EK K  N Y+ K+K +QM + I+RLK C+RWF+++E  Y+ E+E L+S LE+
Sbjct  72   DEVEALLNEK-KKGNTYDNKKKIEQMMDLIKRLKLCVRWFKRIEEGYMQEKEKLQSELET  130

Query  477  aeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            AEK+C++    MKSK EEL   + +LRK I+ L++
Sbjct  131  AEKKCTDTGTEMKSKIEELEETVSDLRKTISSLEE  165



>ref|XP_010439497.1| PREDICTED: kinesin-1 [Camelina sativa]
Length=792

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 65/177 (37%), Positives = 104/177 (59%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SP++ K  +  +  DK+RK+            RQAF+ VN    
Sbjct  1    MASRNQNRPP-----RSPNSKKEGLGSIPFDKRRKVETQGTGR-----RQAFSAVNKQ--  48

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  +CG ++F K++V ALL E+ K   K++ K K +QM++ I+RLK C+R
Sbjct  49   -DITTTSDVGSIEECGKVDFTKDEVLALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVR  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+LK  LESAE++ +  ++   +KEEEL A I  L +N+  L D
Sbjct  107  WFQQVDETHVQEKENLKVSLESAEQKYNHKELEAMTKEEELQATISNLEENVVSLHD  163



>ref|XP_006584943.1| PREDICTED: kinesin-1-like isoform X2 [Glycine max]
Length=791

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 98/155 (63%), Gaps = 7/155 (5%)
 Frame = +3

Query  126  DEVSVDKKRKI-GNPKMP--SGVRPGRQAFAVVNGSADLpptsgppssagsDCGVIEFNK  296
            +E S+DK+R+I G  KM    G    R  F+VV  +A    T+     A     V++F K
Sbjct  15   EEASLDKRRRILGADKMDRQQGGSRVRTPFSVVTNTAATSDTANAAEGAAV---VVDFTK  71

Query  297  EDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslkslles  476
            ++VEALL EK K  N Y+ K+K +QM + I+RLK C+RWF+++E  Y+ E+E L+S LE+
Sbjct  72   DEVEALLNEK-KKGNTYDNKKKIEQMMDLIKRLKLCVRWFKRIEEGYMQEKEKLQSELET  130

Query  477  aeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            AEK+C++    MKSK EEL   + +LRK I+ L++
Sbjct  131  AEKKCTDTGTEMKSKIEELEETVSDLRKTISSLEE  165



>ref|XP_010931850.1| PREDICTED: kinesin-5 isoform X3 [Elaeis guineensis]
Length=773

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 7/137 (5%)
 Frame = +3

Query  192  GRQAFAVVN------GSADLpptsgppssagsDCGVIEF-NKEDVEALLVEKLKTKNKYN  350
             RQ  + VN      G  D    + P S AGS+ G IEF ++EDVE LL EK+K KNK +
Sbjct  10   ARQVLSTVNAGPNPGGHGDHAAGTAPSSDAGSNGGGIEFGSREDVERLLGEKMKGKNKND  69

Query  351  MKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEE  530
             K K +QM EYI++L+ CIRWF +LE  Y++EQE L+++L+S EKR ++++  M++K EE
Sbjct  70   YKGKSEQMIEYIKKLRTCIRWFMELEDGYMAEQEKLRNMLDSEEKRHADIEAEMRAKVEE  129

Query  531  LNAIIMELRKNIAVLQD  581
            L  II EL+   A LQ+
Sbjct  130  LTTIIQELQSQHASLQE  146



>ref|XP_002518570.1| kinesin, putative [Ricinus communis]
 gb|EEF43957.1| kinesin, putative [Ricinus communis]
Length=798

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 111/179 (62%), Gaps = 7/179 (4%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M+ ++QN+PP +P+ +    G      V +DK+R+IG  ++ +     R+ F  VN   D
Sbjct  3    MSSRNQNRPPRSPS-TKDGGGAGGGGGVPLDKRRRIGAGRIGA---TDRKPFGSVNKRQD  58

Query  231  Lppt--sgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQC  404
            +     S   S+  S+C  IEF+KE+V+AL+ E+ K K K++ K   + ++E   RLK C
Sbjct  59   VTAAPGSDTGSTEASECESIEFSKEEVDALVNERPKMK-KFDHKGNMEVVNELNNRLKVC  117

Query  405  IRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            I+WFQ+ +  ++ EQ  L++ L+S+EK+C++M++ MK KEE+ NAII ELR   + LQ+
Sbjct  118  IKWFQKRDEAHLDEQGKLRAALDSSEKKCADMEVEMKDKEEKCNAIISELRGENSSLQE  176



>gb|AID21575.1| AT4G21270p [Arabidopsis halleri]
Length=796

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 102/177 (58%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P       G      +  DK+RK+            RQAF+ VN    
Sbjct  1    MASRNQNRPPRSPNAKKEGLGG-----IPFDKRRKVETQGTGR-----RQAFSAVNKQ--  48

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T      +  +CG +EF+K++V ALL E+ K   K++ K K +QM++ I+RLK C++
Sbjct  49   -DVTMNSDVGSIEECGKVEFSKDEVLALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVK  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ +  ++ E+ESLK  LESAE++ +  ++  ++KEEEL A I  L++N+  L +
Sbjct  107  WFQQTDETHLQEKESLKVSLESAEQKYNIKELEARTKEEELQATISNLKENVVSLHE  163



>dbj|BAF01074.1| kinesin like protein [Arabidopsis thaliana]
Length=415

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 109/180 (61%), Gaps = 22/180 (12%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVN---G  221
            M  ++QN+   AP PS P+  K  +  +  DK+RK       +G    RQ  + VN    
Sbjct  1    MPLRNQNR---APLPS-PNVKKEALSSIPFDKRRK---ETQGTG---RRQVLSTVNRQDA  50

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
            ++D+  T         +CG +EF K++V ALL E+ K   K++ K K +QM++ I++LK 
Sbjct  51   NSDVGSTE--------ECGKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIKKLKV  101

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C+RW+QQ++  ++ ++E+L S L+SAEKR S+ ++  K+KEEEL A I E+++NI  LQ+
Sbjct  102  CVRWYQQVDETHVQDKENLSSSLQSAEKRYSDKELDAKTKEEELRATITEMKENIESLQE  161



>ref|XP_010431590.1| PREDICTED: kinesin-5 [Camelina sativa]
Length=793

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 105/187 (56%), Gaps = 33/187 (18%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVN----  218
            M  ++QN+   AP PS P+  K  +  V  ++++++            RQ  + VN    
Sbjct  1    MPLRNQNR---APLPS-PNVKKEALASVPFERRKRVETQGTGR-----RQVLSTVNRQDV  51

Query  219  ------GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSE  380
                  GS D             DCG +EF K++V ALL E+ K   K++ K K +QM++
Sbjct  52   TANSDVGSTD-------------DCGKVEFTKDEVLALLTERAKA-GKFDTKAKIEQMTD  97

Query  381  YIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRK  560
             I++LK C+RWFQQ+E  ++ E+E+L S LESA+KR S+ ++  K+KE+ L A I E+++
Sbjct  98   IIKKLKVCVRWFQQVEETHVQEKENLTSSLESAKKRFSDQELDAKTKEDRLQATIAEMKE  157

Query  561  NIAVLQD  581
            NI  LQ+
Sbjct  158  NIVSLQE  164



>ref|NP_192428.2| kinesin 5 [Arabidopsis thaliana]
 sp|F4JGP4.1|ATK5_ARATH RecName: Full=Kinesin-5 [Arabidopsis thaliana]
 gb|AEE82489.1| kinesin 5 [Arabidopsis thaliana]
Length=790

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 106/177 (60%), Gaps = 16/177 (9%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+   AP PS P+  K  +  +  DK+RK       +G    RQ  + VN    
Sbjct  1    MPLRNQNR---APLPS-PNVKKEALSSIPFDKRRK---ETQGTG---RRQVLSTVN----  46

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
                +     +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I++LK C+R
Sbjct  47   -RQDANSDVGSTEECGKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIKKLKVCVR  104

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            W+QQ++  ++ ++E+L S L+SAEKR S+ ++  K+KEEEL A I E+++NI  LQ+
Sbjct  105  WYQQVDETHVQDKENLSSSLQSAEKRYSDKELDAKTKEEELRATITEMKENIESLQE  161



>emb|CDY39158.1| BnaC09g21860D [Brassica napus]
Length=793

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 105/177 (59%), Gaps = 13/177 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+ P +P        +  +  + +D++RK+       G    RQA + VN    
Sbjct  1    MPIRNQNRAPRSPIAR-----REPLSSIPIDRRRKVETQ----GGTARRQAPSTVNRQ--  49

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  +C  +EF K++V ALL E+ K   K++ K K +QM++ IRRLK C++
Sbjct  50   -DVTANSDVGSVEECSKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIRRLKVCVK  107

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+L+S LESAEKR  E ++  K+KEEEL A I E+++ IA LQ+
Sbjct  108  WFQQVDETHVQEKENLRSSLESAEKRFCEKELDAKTKEEELQATIAEMKEKIASLQE  164



>ref|XP_009114495.1| PREDICTED: kinesin-5 [Brassica rapa]
Length=794

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 106/177 (60%), Gaps = 12/177 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+ P +P        +  +  + +D++RK+   +   G    RQA + VN    
Sbjct  1    MPIRNQNRAPRSPVAR-----REPLSSIPIDRRRKV---ETTQGGTARRQAPSTVNRQ--  50

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  +C  +EF K++V ALL E+ K   K++ K K +QM++ IRRLK C++
Sbjct  51   -DVTANSDVGSVEECSKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIRRLKVCVK  108

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+L+S LESAEKR  E ++  K+KEEEL A I E+++ IA LQ+
Sbjct  109  WFQQVDETHVQEKENLRSSLESAEKRFCEKELDAKTKEEELQANIAEMKEKIASLQE  165



>gb|AAQ82843.1| At4g05190 [Arabidopsis thaliana]
 dbj|BAD43476.1| kinesin - like protein [Arabidopsis thaliana]
Length=790

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 106/177 (60%), Gaps = 16/177 (9%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+   AP PS P+  K  +  +  DK+R+       +G    RQ  + VN    
Sbjct  1    MPLRNQNR---APLPS-PNVKKEALSSIPFDKRRE---ETQGTG---RRQVLSTVN----  46

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
                +     +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I++LK C+R
Sbjct  47   -RQDANSDVGSTEECGKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIKKLKVCVR  104

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            W+QQ++  ++ ++E+L S L+SAEKR S+ ++  K+KEEEL A I E+++NI  LQ+
Sbjct  105  WYQQVDETHVQDKENLSSSLQSAEKRYSDKELDAKTKEEELRATITEMKENIESLQE  161



>gb|KJB57694.1| hypothetical protein B456_009G175800 [Gossypium raimondii]
Length=798

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 72/180 (40%), Positives = 111/180 (62%), Gaps = 13/180 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRK---IGNPKMPSGVRPGRQAFAVVNG  221
            MA ++QN+PP      SPS  K   DE  +DK+R+   +G    P+     R+AF+ VN 
Sbjct  1    MASRNQNRPP-----RSPSTRKEIGDENPLDKRRRLGAVGRGVGPTATGRTRRAFSAVNN  55

Query  222  SADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
              D    +   ++        EF KE+VEA+L E+ K K K+++K K +  +E+ +RLK 
Sbjct  56   LQDATTAANAENAEECH----EFTKEEVEAILNERPKAK-KFDLKAKYEHAAEHNKRLKL  110

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            C++WFQQ + N++ ++E LK+ LESAEK+C + ++  K+KEEELNA+I ELR + A LQ+
Sbjct  111  CVKWFQQCDENHVLDKEKLKNSLESAEKKCIDTELEKKNKEEELNAVISELRDSNASLQE  170



>ref|XP_007148296.1| hypothetical protein PHAVU_006G196400g [Phaseolus vulgaris]
 gb|ESW20290.1| hypothetical protein PHAVU_006G196400g [Phaseolus vulgaris]
Length=799

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 99/178 (56%), Gaps = 11/178 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA +++N+PP      S SN K   +E   DK+R+ G  +       GR     +   A+
Sbjct  1    MASRTENRPP-----RSLSNKKGGAEEAFSDKRRRTGTERTERQGGRGRAPLGALKADAN  55

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTK-NKYNMKEKCDQMSEYIRRLKQCI  407
                       GS+C V+EF KE VEALL EK  TK N+Y+ K K +QM + I+RLK C+
Sbjct  56   -----EVAIVEGSECSVVEFTKEKVEALLNEKTNTKENRYDNKRKTEQMGDLIKRLKLCV  110

Query  408  RWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            RW  ++E  ++ E+E L++ LESAEK+  + +  M+ K  EL+  I  L+  I+ L++
Sbjct  111  RWCMKVEEGHVQEKEKLQTDLESAEKKLLDTENKMEIKIAELDETISNLKAIISSLEE  168



>emb|CDY46372.1| BnaA09g19860D [Brassica napus]
Length=794

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 105/177 (59%), Gaps = 12/177 (7%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+ P +P        +  +  + +D++RK+   +   G    RQA + VN    
Sbjct  1    MPIRNQNRAPRSPIAR-----REPLSSIPIDRRRKV---ETTQGGTARRQAPSTVNRQ--  50

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  +C  +EF K++V ALL E+ K   K++ K K +QM++ IRRLK C++
Sbjct  51   -DVTANSDVGSVEECSKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIRRLKVCVK  108

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+L+S LESAEKR  E ++  K+KEE L A I E+++ IA LQ+
Sbjct  109  WFQQVDETHVQEKENLRSSLESAEKRFCEKELDAKTKEEALQANIAEMKEKIASLQE  165



>emb|CAB81061.1| kinesin-like protein [Arabidopsis thaliana]
Length=777

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  270  DCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseq  449
            +CG +EF K++V ALL E+ K   K++ K K +QM++ I++LK C+RW+QQ++  ++ ++
Sbjct  46   ECGKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIKKLKVCVRWYQQVDETHVQDK  104

Query  450  eslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            E+L S L+SAEKR S+ ++  K+KEEEL A I E+++NI  LQ+
Sbjct  105  ENLSSSLQSAEKRYSDKELDAKTKEEELRATITEMKENIESLQE  148



>ref|XP_002872739.1| hypothetical protein ARALYDRAFT_490168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48998.1| hypothetical protein ARALYDRAFT_490168 [Arabidopsis lyrata subsp. 
lyrata]
Length=787

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 102/177 (58%), Gaps = 19/177 (11%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            M  ++QN+ P+ P+P+               KK  +   K  + V   RQ F+ VN    
Sbjct  1    MPLRNQNRAPL-PSPNV--------------KKEALSRRKAETQVTGRRQVFSTVNRQ--  43

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I++LK C+R
Sbjct  44   -DVTANSDVGSTEECGKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIKKLKVCVR  101

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            WFQQ++  ++ E+E+L S L+SAEKR  + ++  K+KEE L A I E+++ IA LQ+
Sbjct  102  WFQQVDETHVQEKENLCSSLQSAEKRYCDKELDAKTKEEVLQATIAEMKEKIASLQE  158



>emb|CAJ86215.1| H0323C08.7 [Oryza sativa Indica Group]
 emb|CAJ86431.1| H0303G06.20 [Oryza sativa Indica Group]
Length=762

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 89/153 (58%), Gaps = 7/153 (5%)
 Frame = +3

Query  144  KKRKIGNPKMPSGVRPG--RQAFAVVNG----SADLpptsgppssagsDCGVIEFN-KED  302
            KK  +GN +   GV+PG  R   + +N     ++D     G    AG    VIEF  +ED
Sbjct  13   KKENLGNARRGMGVKPGPRRNVLSAINNGGGTNSDTASVDGGEGGAGPAAPVIEFTGRED  72

Query  303  VEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesae  482
            VE LL EK+K K+K + K + +QMSEYI++L+ CIRW+ +LE  Y+ EQE L+S +++  
Sbjct  73   VERLLAEKMKGKSKTDYKGRTEQMSEYIKKLRACIRWYIELEDGYLVEQEKLRSTMDAEN  132

Query  483  KRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             + +E++  + S  EEL A  + L +    L++
Sbjct  133  AQHAELEAQLSSDLEELKAAHLNLTRQCDSLEE  165



>gb|KHN45723.1| Kinesin-1 [Glycine soja]
Length=710

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +3

Query  279  VIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqesl  458
            V++F K++VEALL EK K  N Y+ K+K +QM + I+RLK C+RWF+++E  Y+ E+E L
Sbjct  35   VVDFTKDEVEALLNEK-KKGNTYDNKKKIEQMMDLIKRLKLCVRWFKRIEEGYMQEKEKL  93

Query  459  ksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +S LE+AEK+C++    MKSK EEL   + +LRK I+ L++
Sbjct  94   QSELEAAEKKCTDTGTEMKSKIEELEETVSDLRKTISSLEE  134



>emb|CAE04256.3| OSJNBa0089N06.17 [Oryza sativa Japonica Group]
Length=818

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 89/153 (58%), Gaps = 7/153 (5%)
 Frame = +3

Query  144  KKRKIGNPKMPSGVRPG--RQAFAVVNG----SADLpptsgppssagsDCGVIEFN-KED  302
            KK  +GN +   GV+PG  R   + +N     ++D     G    AG    VIEF  +ED
Sbjct  13   KKENLGNARRGMGVKPGPRRNVLSAINNGGGTNSDTASVDGGEGGAGPAAPVIEFTGRED  72

Query  303  VEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesae  482
            VE LL EK+K K+K + K + +QMSEYI++L+ CIRW+ +LE  Y+ EQE L+S +++  
Sbjct  73   VERLLAEKMKGKSKTDYKGRTEQMSEYIKKLRACIRWYIELEDGYLVEQEKLRSTMDAEN  132

Query  483  KRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             + ++++  + S  EEL A  + L +    L++
Sbjct  133  AQHAKLEAQLSSDLEELKAAHLNLTRQCDSLEE  165



>ref|NP_001053970.1| Os04g0629700 [Oryza sativa Japonica Group]
 dbj|BAF15884.1| Os04g0629700 [Oryza sativa Japonica Group]
 dbj|BAH00835.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78073.1| hypothetical protein OsI_17542 [Oryza sativa Indica Group]
 gb|EEE61745.1| hypothetical protein OsJ_16274 [Oryza sativa Japonica Group]
Length=788

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 89/153 (58%), Gaps = 7/153 (5%)
 Frame = +3

Query  144  KKRKIGNPKMPSGVRPG--RQAFAVVNG----SADLpptsgppssagsDCGVIEFN-KED  302
            KK  +GN +   GV+PG  R   + +N     ++D     G    AG    VIEF  +ED
Sbjct  13   KKENLGNARRGMGVKPGPRRNVLSAINNGGGTNSDTASVDGGEGGAGPAAPVIEFTGRED  72

Query  303  VEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesae  482
            VE LL EK+K K+K + K + +QMSEYI++L+ CIRW+ +LE  Y+ EQE L+S +++  
Sbjct  73   VERLLAEKMKGKSKTDYKGRTEQMSEYIKKLRACIRWYIELEDGYLVEQEKLRSTMDAEN  132

Query  483  KRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             + ++++  + S  EEL A  + L +    L++
Sbjct  133  AQHAKLEAQLSSDLEELKAAHLNLTRQCDSLEE  165



>ref|XP_006282798.1| hypothetical protein CARUB_v10006408mg [Capsella rubella]
 gb|EOA15696.1| hypothetical protein CARUB_v10006408mg [Capsella rubella]
Length=792

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 62/177 (35%), Positives = 102/177 (58%), Gaps = 14/177 (8%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      SP+  K   + +  DK+RK+            RQAF+ VN    
Sbjct  1    MASRNQNRPP-----RSPNTKKEGRNGIPFDKRRKVEAQGTGR-----RQAFSSVNKQ--  48

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T+     +  D G +EF K++V ALL E+ K   K++ K K +Q+++ I+RLK C++
Sbjct  49   -DITTNSDVGSTEDFGKVEFTKDEVLALLSERAKA-GKFDTKAKIEQLTDIIKRLKGCVK  106

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            W+QQ +  ++ ++E+LK  LESAE++ +  ++  K+KEEEL A I  L +++  L D
Sbjct  107  WYQQADETHVQDKENLKVSLESAEQKYNHKELEAKTKEEELQATISILEEHVESLHD  163



>ref|XP_004504898.1| PREDICTED: kinesin-1-like [Cicer arietinum]
Length=746

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 100/182 (55%), Gaps = 25/182 (14%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKR--KIGNPKMPSGVRPGRQAF---AVV  215
            M+ ++QN+PP      S SN K   +EV  DK+   +I   K+      GR      A+V
Sbjct  1    MSSRNQNRPP-----HSNSNKKVGAEEVVKDKRSSIEIEAEKLEKQGVAGRARAPLSAMV  55

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRL  395
            N +           S G+D   IEF KED+E+LL EK+K  N YN K K DQM + I+RL
Sbjct  56   NNTT--------SDSDGTDLNNIEFTKEDIESLLNEKMKKGNPYNNKIKVDQMVDLIKRL  107

Query  396  KQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
            K C+RW        + E E L+S +ESA K+  + ++ MK+K EELN  I ++R+ I+ L
Sbjct  108  KLCVRWC-------VHENEKLQSAVESAVKKSCDSEIEMKNKTEELNDTISDMRETISFL  160

Query  576  QD  581
            ++
Sbjct  161  EE  162



>ref|XP_006653796.1| PREDICTED: kinesin-5-like [Oryza brachyantha]
Length=789

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 85/147 (58%), Gaps = 8/147 (5%)
 Frame = +3

Query  144  KKRKIGNPKMP-SGVRPG--RQAFAVVNGSADLpptsgppssagsDCG----VIEFN-KE  299
            KK  +GN +    GV+PG  R   + +N        +          G    VIEF  +E
Sbjct  13   KKENLGNARRGMVGVKPGPRRNVLSAINNGGGANSDTASVDGGEGGAGSVAPVIEFTGRE  72

Query  300  DVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesa  479
            DVE LL EK+K K+K + K + +QMS+YI++L+ CIRW+ +LE +Y++EQE L+S +++ 
Sbjct  73   DVERLLAEKMKGKSKTDFKGRAEQMSDYIKKLRACIRWYIELEDDYLAEQEKLRSTMDAE  132

Query  480  eKRCSEMDMLMKSKEEELNAIIMELRK  560
              + +E++  + S  EEL +  +EL +
Sbjct  133  NAQHAELEAQLSSDLEELKSAHLELTR  159



>ref|XP_006287092.1| hypothetical protein CARUB_v10000254mg [Capsella rubella]
 gb|EOA19990.1| hypothetical protein CARUB_v10000254mg [Capsella rubella]
Length=795

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 65/174 (37%), Positives = 105/174 (60%), Gaps = 12/174 (7%)
 Frame = +3

Query  60   KSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSADLpp  239
            ++QN+   AP PS P+  K  +  V++D++R++      +G R  RQ  + VN       
Sbjct  5    RNQNR---APLPS-PNVKKEALSSVTLDRRRRV--EAQGNGGR--RQVLSTVNRQ---DV  53

Query  240  tsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQ  419
            T+     +  DC  +EF K++V ALL E+ K   K++ K K +QM++ I++LK C+RW  
Sbjct  54   TANSDVGSTDDCSKVEFTKDEVLALLNERAKA-GKFDTKGKIEQMTDIIKKLKVCVRWQL  112

Query  420  QLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            Q+E  ++ E+E+L S LESAEKR +E ++  K+ EE L A I E+++ IA LQ+
Sbjct  113  QVEETHVQERENLTSSLESAEKRYNEKELDAKNTEERLQATIAEMKEKIASLQE  166



>gb|AID21622.1| At4g21270*p-like protein [Arabidopsis lyrata]
Length=146

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 69/130 (53%), Gaps = 14/130 (11%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP +P       G      +  DK+RK+            RQAF+ VN    
Sbjct  1    MASRNQNRPPRSPNAKKEGLGG-----IPFDKRRKVETQGTGR-----RQAFSAVNKQ--  48

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
               T      +  +CG +EF K++V ALL E+ K   K++ K K +QM++ I+RLK C++
Sbjct  49   -DVTMNSDVGSIEECGKVEFTKDEVLALLSERAKA-GKFDTKAKIEQMTDIIKRLKVCVK  106

Query  411  WFQQLEGNYI  440
            WFQQ +  ++
Sbjct  107  WFQQADETHV  116



>gb|KJB62643.1| hypothetical protein B456_009G427400 [Gossypium raimondii]
Length=684

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +3

Query  372  MSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIME  551
            M EYI+RL+ CIRWFQ+LEG Y  EQE L+S LE  E+RC EM+M +K+K+EE+N II+E
Sbjct  1    MMEYIKRLRLCIRWFQELEGEYAFEQEKLRSALELTERRCYEMEMALKNKDEEMNLIILE  60

Query  552  LRKNIAVLQD  581
            LR ++A LQ+
Sbjct  61   LRNSLASLQE  70



>ref|XP_010456930.1| PREDICTED: kinesin-5-like [Camelina sativa]
Length=765

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +3

Query  270  DCG-VIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIse  446
            DCG  +EF K++V ALL E+ K   K++ K K +QM++ I++LK C+RWFQQ+E  ++ E
Sbjct  32   DCGGKVEFTKDEVLALLNERAKAA-KFDTKAKIEQMTDIIKKLKVCVRWFQQVEETHVQE  90

Query  447  qeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +E L+S LESAE+R ++ ++  K+KE+ L A I E+ +NIA LQ+
Sbjct  91   KELLRSSLESAEQRYNDKELDAKTKEDRLQATIAEMEENIASLQE  135



>ref|XP_010422415.1| PREDICTED: kinesin-5-like [Camelina sativa]
Length=794

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 106/184 (58%), Gaps = 33/184 (18%)
 Frame = +3

Query  60   KSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVN-------  218
            ++QN+   AP PS P+  K  +  V ++++R+     + + V   RQ  + VN       
Sbjct  5    RNQNR---APLPS-PNVKKEALSSVPLERRRR-----LETQVTGRRQVLSTVNRQDVTAN  55

Query  219  ---GSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIR  389
               GS D             +CG +EF K++V ALL E+ K   K++ K K +QM++ I+
Sbjct  56   SDVGSTD-------------ECGKVEFTKDEVLALLNERAKA-GKFDTKAKIEQMTDIIK  101

Query  390  RLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIA  569
            +LK C+RWFQQ+E   + E+E+L+S LESAE+R ++ ++  K+KE+ L   I E+++++ 
Sbjct  102  KLKFCVRWFQQVEETNVQEKENLRSSLESAEQRYNDKELDAKTKEDRLQETIAEMKESMT  161

Query  570  VLQD  581
             LQ+
Sbjct  162  SLQE  165



>ref|XP_004309668.1| PREDICTED: kinesin-1 isoform X1 [Fragaria vesca subsp. vesca]
Length=791

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 98/171 (57%), Gaps = 9/171 (5%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKI-GNPKMPSGVRPGRQAFAVVNGSA  227
            MA ++QN+PP      SPS  K   DEV +DKKR++ G     S +   R     VN   
Sbjct  1    MASRNQNRPP-----RSPSTKKIGGDEVPLDKKRRLTGKADSQSSMGRPRLPLKSVNKRQ  55

Query  228  DLpptsgppssagsDCGVIE--FNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
            ++   S   S  GS+C   E  F KE+VE LL +K   K K++ K    Q + Y + LK 
Sbjct  56   EVGAASETASVEGSECSEAEREFTKEEVEELLNKKYIEK-KFDHKGNAQQRAAYHKNLKD  114

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            CI+W+Q++E  ++ E E L++LL ++EK+C++ +  MK+  +ELNAI ++L
Sbjct  115  CIKWYQKVEKAHLLEVERLQNLLNASEKKCTDTEEKMKNMVDELNAINLKL  165



>ref|XP_003580611.1| PREDICTED: kinesin-5-like [Brachypodium distachyon]
Length=788

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 87/153 (57%), Gaps = 8/153 (5%)
 Frame = +3

Query  147  KRKIGNPKMPSG--VRPGRQAFAV-----VNGSADLpptsgppssagsDCGVIEFN-KED  302
            K  +GN +   G  V P R   +      VNG   + P+ G           +EF+ +ED
Sbjct  13   KENLGNVRRGMGFKVAPRRNVLSAINNDGVNGEPAMAPSEGGSVGEVPTAPAVEFSGRED  72

Query  303  VEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesae  482
            VE LL EK+K K+K + K + +QMSEYI+RL+ CIRW+ +LE  Y++EQE L+  +++  
Sbjct  73   VERLLNEKMKGKSKNDYKGRTEQMSEYIKRLRACIRWYVELEDGYLAEQEKLRGSIDAEN  132

Query  483  KRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
             R +E +M + S  EELNA   ++ +  A L++
Sbjct  133  TRHAEFEMQLSSAIEELNATNSDMIRRCASLEE  165



>ref|XP_008668838.1| PREDICTED: kinesin-5 [Zea mays]
 gb|ACG29735.1| kinesin-1 [Zea mays]
Length=777

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            VIEF+ +EDVE LL EK+K K+K + K + DQMS+YI++L+ CIRW+ +LE  Y++EQE 
Sbjct  67   VIEFSGREDVERLLAEKMKGKSKNDFKGRVDQMSDYIKKLRACIRWYMELEDGYLAEQEK  126

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L   ++S   R +E++  + +  EEL A  ++L +    L++
Sbjct  127  LLGAMDSENTRHTELEAQLSTAIEELKATNLDLTRRCESLEE  168



>tpg|DAA35856.1| TPA: kinesin heavy chain [Zea mays]
Length=754

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            VIEF+ +EDVE LL EK+K K+K + K + DQMS+YI++L+ CIRW+ +LE  Y++EQE 
Sbjct  44   VIEFSGREDVERLLAEKMKGKSKNDFKGRVDQMSDYIKKLRACIRWYMELEDGYLAEQEK  103

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L   ++S   R +E++  + +  EEL A  ++L +    L++
Sbjct  104  LLGAMDSENTRHTELEAQLSTAIEELKATNLDLTRRCESLEE  145



>ref|XP_011470975.1| PREDICTED: kinesin-1 isoform X2 [Fragaria vesca subsp. vesca]
Length=790

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 98/171 (57%), Gaps = 10/171 (6%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKI-GNPKMPSGVRPGRQAFAVVNGSA  227
            MA ++QN+PP +P+       K   DEV +DKKR++ G     S +   R     VN   
Sbjct  1    MASRNQNRPPRSPST------KIGGDEVPLDKKRRLTGKADSQSSMGRPRLPLKSVNKRQ  54

Query  228  DLpptsgppssagsDCGVIE--FNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQ  401
            ++   S   S  GS+C   E  F KE+VE LL +K   K K++ K    Q + Y + LK 
Sbjct  55   EVGAASETASVEGSECSEAEREFTKEEVEELLNKKYIEK-KFDHKGNAQQRAAYHKNLKD  113

Query  402  CIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            CI+W+Q++E  ++ E E L++LL ++EK+C++ +  MK+  +ELNAI ++L
Sbjct  114  CIKWYQKVEKAHLLEVERLQNLLNASEKKCTDTEEKMKNMVDELNAINLKL  164



>ref|XP_004490719.1| PREDICTED: kinesin-3-like isoform X2 [Cicer arietinum]
Length=147

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  354  KEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEEL  533
            KE+C+ M +YI+RLK  IRWFQ LE NY  EQE LK+ LE  +++  E+++L+K KE+EL
Sbjct  10   KERCENMVDYIKRLKVYIRWFQDLEINYSLEQEKLKNSLEMTQQKSIEIELLLKIKEDEL  69

Query  534  NAIIMELRKNIAVLQD  581
            N+II+E+R+N + LQ+
Sbjct  70   NSIIVEMRRNCSSLQE  85



>ref|XP_004490718.1| PREDICTED: kinesin-3-like isoform X1 [Cicer arietinum]
Length=155

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +3

Query  354  KEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEEL  533
            KE+C+ M +YI+RLK  IRWFQ LE NY  EQE LK+ LE  +++  E+++L+K KE+EL
Sbjct  10   KERCENMVDYIKRLKVYIRWFQDLEINYSLEQEKLKNSLEMTQQKSIEIELLLKIKEDEL  69

Query  534  NAIIMELRKNIAVLQD  581
            N+II+E+R+N + LQ+
Sbjct  70   NSIIVEMRRNCSSLQE  85



>ref|XP_002448583.1| hypothetical protein SORBIDRAFT_06g029500 [Sorghum bicolor]
 gb|EES12911.1| hypothetical protein SORBIDRAFT_06g029500 [Sorghum bicolor]
Length=789

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            VIEF+ +EDVE LL EK+K K+K + K + DQMS+YI++L+ CIRW+ +LE  Y+ EQE 
Sbjct  64   VIEFSGREDVERLLAEKMKGKSKNDFKGRVDQMSDYIKKLRACIRWYIELEDAYLVEQEK  123

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L+  ++S   R +E++  + +  EEL A  ++L +    L++
Sbjct  124  LRGAMDSENARHTELETQLSNAIEELKAANLDLTRRCESLEE  165



>ref|XP_008780377.1| PREDICTED: kinesin-2-like isoform X3 [Phoenix dactylifera]
Length=98

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDM  506
            +K KN+ + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++ 
Sbjct  1    MKGKNQNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEA  60

Query  507  LMKSKEEELNAIIMELRKNIAVL  575
             M++K EELNAII +L++  A L
Sbjct  61   QMRAKVEELNAIIQDLQRQHASL  83



>ref|XP_008780379.1| PREDICTED: kinesin-3-like isoform X5 [Phoenix dactylifera]
Length=81

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDM  506
            +K KN+ + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++ 
Sbjct  1    MKGKNQNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEA  60

Query  507  LMKSKEEELNAIIMELRKN  563
             M++K EELNAII +L+K 
Sbjct  61   QMRAKVEELNAIIQDLQKG  79



>ref|XP_004976910.1| PREDICTED: kinesin-5-like isoform X1 [Setaria italica]
Length=823

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            V+EF+ +EDVE LL EK+K K+K + K + +QMS+YI++L+ CIRW+ +LE  Y+ EQE 
Sbjct  70   VVEFSGREDVERLLAEKMKGKSKNDYKGRVEQMSDYIKKLRACIRWYMELEDGYLVEQEK  129

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L+  +++   R ++++  + +  EEL A  ++L +    L++
Sbjct  130  LRGAMDAENTRHTDLEAQLSTAIEELKAANLDLTRRCEFLEE  171



>ref|XP_004976911.1| PREDICTED: kinesin-5-like isoform X2 [Setaria italica]
Length=795

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
            V+EF+ +EDVE LL EK+K K+K + K + +QMS+YI++L+ CIRW+ +LE  Y+ EQE 
Sbjct  70   VVEFSGREDVERLLAEKMKGKSKNDYKGRVEQMSDYIKKLRACIRWYMELEDGYLVEQEK  129

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L+  +++   R ++++  + +  EEL A  ++L +    L++
Sbjct  130  LRGAMDAENTRHTDLEAQLSTAIEELKAANLDLTRRCEFLEE  171



>gb|KHG01598.1| Kinesin-3 -like protein [Gossypium arboreum]
Length=718

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 72/121 (60%), Gaps = 12/121 (10%)
 Frame = +3

Query  51   MAPKSQNKPPV----------APTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQ  200
            M+ K+QNKPP           + T  SPS  K    EVS +K +K+G  KM      GR 
Sbjct  1    MSSKNQNKPPFHHNTTSSSTTSTTTPSPSKNKCIAAEVSEEKGQKLGFEKMIGTPNNGRL  60

Query  201  --AFAVVNGSADLpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQM  374
              AF++VN S DL P S P S AGS+CG IEF +EDVEAL+ EK+K+KNK+N K   D +
Sbjct  61   RLAFSLVNSSQDLGPDSTPVSHAGSECGAIEFTREDVEALVSEKMKSKNKFNYKAAMDSL  120

Query  375  S  377
            +
Sbjct  121  A  121



>ref|XP_007159206.1| hypothetical protein PHAVU_002G218100g [Phaseolus vulgaris]
 gb|ESW31200.1| hypothetical protein PHAVU_002G218100g [Phaseolus vulgaris]
Length=774

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 101/185 (55%), Gaps = 26/185 (14%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM-PSG----VRPGRQAFAVV  215
            MA ++Q+   + P  ++P+            ++R IG  KM P G        R  F+VV
Sbjct  1    MASRNQSNKKLGPDEATPNM-----------RRRGIGAEKMEPQGGAASAGRARTPFSVV  49

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALL--VEKLKTKNKY-NMKEKCDQMSEYI  386
               +DL  TS            ++F KE+VE LL   ++ K  N Y N K+  DQM+  I
Sbjct  50   TNRSDLNTTSDVTE-------AVDFTKEEVETLLNEKKEKKKGNTYDNNKKNMDQMTVLI  102

Query  387  RRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNI  566
            +RLK C+RW++++E  ++ E+E L+S LE++EK+C++ +  MK+K +EL   + +LR   
Sbjct  103  KRLKACVRWYKRIEEGHVQEKEKLQSELEASEKKCNDTETEMKNKIDELKETLSDLRMKN  162

Query  567  AVLQD  581
            + L++
Sbjct  163  SSLEE  167



>ref|XP_007159205.1| hypothetical protein PHAVU_002G218100g [Phaseolus vulgaris]
 gb|ESW31199.1| hypothetical protein PHAVU_002G218100g [Phaseolus vulgaris]
Length=775

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 97/177 (55%), Gaps = 26/177 (15%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKM-PSG----VRPGRQAFAVV  215
            MA ++Q+   + P  ++P+            ++R IG  KM P G        R  F+VV
Sbjct  1    MASRNQSNKKLGPDEATPNM-----------RRRGIGAEKMEPQGGAASAGRARTPFSVV  49

Query  216  NGSADLpptsgppssagsDCGVIEFNKEDVEALL--VEKLKTKNKY-NMKEKCDQMSEYI  386
               +DL  TS            ++F KE+VE LL   ++ K  N Y N K+  DQM+  I
Sbjct  50   TNRSDLNTTSDVTE-------AVDFTKEEVETLLNEKKEKKKGNTYDNNKKNMDQMTVLI  102

Query  387  RRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELR  557
            +RLK C+RW++++E  ++ E+E L+S LE++EK+C++ +  MK+K +EL   + +LR
Sbjct  103  KRLKACVRWYKRIEEGHVQEKEKLQSELEASEKKCNDTETEMKNKIDELKETLSDLR  159



>ref|XP_009419596.1| PREDICTED: kinesin-5-like [Musa acuminata subsp. malaccensis]
Length=801

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 96/175 (55%), Gaps = 6/175 (3%)
 Frame = +3

Query  66   QNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSADLppts  245
            Q+KP  AP  SS  +       ++V  K  +G+   P  +RP        + S      +
Sbjct  7    QSKPLNAPRSSSNVSCPRCARGIAVMGK-MVGSATNPRALRPVVFPVNADSNSGVSSDQT  65

Query  246  gppssagsDCGVI---EFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRW  413
               ++  SD G +   EF  +EDVE LL EK+K K + + K K + M EYI+RL+ C+RW
Sbjct  66   TVFAAVSSDGGSMAGTEFGCREDVERLLAEKMKGK-RTDYKGKSELMIEYIKRLRICVRW  124

Query  414  FQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQ  578
            + +LE  Y+ EQ  L+++L S EKR  E++  +++K +EL+A   ELR+  + LQ
Sbjct  125  YMELEDGYMEEQAKLRNMLGSEEKRHGELEFQLRAKMDELDATSRELREQNSSLQ  179



>ref|XP_008780376.1| PREDICTED: kinesin-2-like isoform X2 [Phoenix dactylifera]
Length=99

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEM-D  503
            +K KN+ + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E+ +
Sbjct  1    MKGKNQNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIVE  60

Query  504  MLMKSKEEELNAIIMELRKNIAVL  575
              M++K EELNAII +L++  A L
Sbjct  61   AQMRAKVEELNAIIQDLQRQHASL  84



>ref|XP_008780378.1| PREDICTED: kinesin-3-like isoform X4 [Phoenix dactylifera]
Length=82

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEM-D  503
            +K KN+ + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E+ +
Sbjct  1    MKGKNQNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIVE  60

Query  504  MLMKSKEEELNAIIMELRKN  563
              M++K EELNAII +L+K 
Sbjct  61   AQMRAKVEELNAIIQDLQKG  80



>gb|EMT04945.1| Kinesin-1 [Aegilops tauschii]
Length=785

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
              EF+ +EDV+ LL EK+K K+K + K + +QMSEYI+RL+ CIRW  +LE  Y++EQE 
Sbjct  59   AFEFSGREDVDRLLSEKMKGKSKNDYKGRTEQMSEYIKRLRACIRWLVELEDGYLAEQEK  118

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            L+  ++S   R +E +  +    EEL A  +E+
Sbjct  119  LRGQIDSDNARHAEFEAQLGGALEELKAANLEM  151



>dbj|BAK04104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=786

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 8/142 (6%)
 Frame = +3

Query  144  KKRKIGNPKMPSGVR--PGRQAFAVVN--GSADLpptsgppssagsDCGVIEFN-KEDVE  308
            KK  +GN +   G    P R   + +N  G A+       PS AGS+    EF+ ++DV+
Sbjct  13   KKENLGNARRGMGYNAPPRRNVLSAINNGGGAN---ADPAPSEAGSEAPAFEFSGRDDVD  69

Query  309  ALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKR  488
             LL EK+K K+K + K + +QMSEYI+RL+ CIRW  +LE  Y++EQE L+  ++S   R
Sbjct  70   RLLNEKMKGKSKNDYKGRTEQMSEYIKRLRACIRWLVELEDGYLAEQEKLRGQIDSDNAR  129

Query  489  CSEMDMLMKSKEEELNAIIMEL  554
             +E +  +    EEL A  +E+
Sbjct  130  HAEFEAQLSGALEELKAANLEM  151



>gb|EMS64454.1| Kinesin-1 [Triticum urartu]
Length=773

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +3

Query  279  VIEFN-KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
              EF+ +EDV+ LL EK+K K+K + K + +QMSEYI+RL+ CIRW  +LE  Y++EQE 
Sbjct  47   AFEFSGREDVDRLLNEKMKGKSKNDYKGRTEQMSEYIKRLRACIRWLVELEDGYLAEQEK  106

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMEL  554
            L+  ++S   R +E +  +    EEL A  +E+
Sbjct  107  LRGQIDSDNARHAEFEAQLSGALEELKAANLEM  139



>ref|XP_008779320.1| PREDICTED: kinesin-2-like isoform X2 [Phoenix dactylifera]
Length=110

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDM  506
            +K KNK + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++ 
Sbjct  1    MKGKNKNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEA  60

Query  507  LMKSKEEELNAII  545
             M++K EELNA +
Sbjct  61   QMRAKVEELNAFV  73



>gb|EAZ38419.1| hypothetical protein OsJ_22797 [Oryza sativa Japonica Group]
Length=787

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +3

Query  282  IEF-NKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqesl  458
            IEF  ++DV+ALL EK+K KNK + K K +QM EYI++L+ CI+W  + E   ++E   L
Sbjct  51   IEFAGRDDVDALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACIKWLLEREDTNLAEIGKL  110

Query  459  ksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
              LLE+AEK  SE+   +KS  EE  AI  EL++  A L++
Sbjct  111  NGLLEAAEKHHSEIVAQLKSAIEESKAINEELQRQYASLEE  151



>ref|XP_008779319.1| PREDICTED: kinesin-2-like isoform X1 [Phoenix dactylifera]
Length=144

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDM  506
            +K KNK + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E++ 
Sbjct  1    MKGKNKNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIEA  60

Query  507  LMKSKEEELNAII  545
             M++K EELNA +
Sbjct  61   QMRAKVEELNAFV  73



>gb|EEC81381.1| hypothetical protein OsI_24592 [Oryza sativa Indica Group]
Length=764

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 46/101 (46%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = +3

Query  282  IEF-NKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqesl  458
            IEF  ++DV+ALL EK+K KNK + K K +QM EYI++L+ CI+W  + E   ++E   L
Sbjct  51   IEFAGRDDVDALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACIKWLLEREDTNLAEIGKL  110

Query  459  ksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
              LLE+AEK  SE+   +KS  EE  AI  EL++  A L++
Sbjct  111  NGLLEAAEKHHSEIVAQLKSAIEESKAINEELQRQYASLEE  151



>ref|XP_004987260.1| PREDICTED: kinesin-5-like [Setaria italica]
Length=762

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  294  KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslkslle  473
            +EDVEALL EK+K KNK + K K +QM EYI++L+ CI+W  + E  +++E  ++   LE
Sbjct  56   REDVEALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACIKWLLEREDEHLTEIRNITGQLE  115

Query  474  saeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +  K+ SE    +K+   E  A+  EL+K  A LQ+
Sbjct  116  AQGKQNSETVAELKNTLNEARAVNEELQKQHASLQE  151



>ref|XP_006658202.1| PREDICTED: kinesin-5-like, partial [Oryza brachyantha]
Length=722

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 66/102 (65%), Gaps = 1/102 (1%)
 Frame = +3

Query  279  VIEFNK-EDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqes  455
             I F++ +DV ALL EK+K KNK + K K +QM EYI++L+ CI+W  + E   ++E   
Sbjct  8    AIHFSRRDDVHALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACIKWLLEREDANLAEIGK  67

Query  456  lksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L +LLE+AEK  SE+   +KS  EE  AI  EL+K  A L+D
Sbjct  68   LNALLEAAEKHHSEIVAQLKSAIEESKAINEELQKQYASLED  109



>ref|XP_002965713.1| hypothetical protein SELMODRAFT_84710 [Selaginella moellendorffii]
 gb|EFJ33133.1| hypothetical protein SELMODRAFT_84710 [Selaginella moellendorffii]
Length=788

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 81/153 (53%), Gaps = 9/153 (6%)
 Frame = +3

Query  129  EVSVDKKRKIGNPKMPSGVRPG---------RQAFAVVNGSADLpptsgppssagsDCGV  281
            +V   KKRK+G  + P+   P          R++ A +  S+     S   S      GV
Sbjct  23   DVPAGKKRKLGISREPAARAPRETLSALNVPRESIASIQASSVPAVPSTVSSGQVEWEGV  82

Query  282  IEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslk  461
                 ++VEALL  K+  K+K+++K + ++M EYI+ L+ CIR F Q+E  Y+ +QE  +
Sbjct  83   ARMASDEVEALLNTKMAGKSKFDLKGRNEKMMEYIKNLRTCIRQFLQVESVYVMQQEQAQ  142

Query  462  sllesaeKRCSEMDMLMKSKEEELNAIIMELRK  560
            + ++  ++R  E +  M +K  EL A ++E R+
Sbjct  143  NQIKEEKQRHEESEQKMSAKYGELEAKLVEARQ  175



>ref|XP_002971618.1| hypothetical protein SELMODRAFT_95452 [Selaginella moellendorffii]
 gb|EFJ27367.1| hypothetical protein SELMODRAFT_95452 [Selaginella moellendorffii]
Length=775

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 81/153 (53%), Gaps = 9/153 (6%)
 Frame = +3

Query  129  EVSVDKKRKIGNPKMPSGVRPG---------RQAFAVVNGSADLpptsgppssagsDCGV  281
            +V   KKRK+G  + P+   P          R++ A +  S+     S   S      GV
Sbjct  23   DVPAGKKRKLGISREPAARAPRETLSALNVPRESIASIQASSVPAVPSTVSSGQVEWEGV  82

Query  282  IEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslk  461
                 ++VEALL  K+  K+K+++K + ++M EYI+ L+ CIR F Q+E  Y+ +QE  +
Sbjct  83   ARMASDEVEALLNTKMAGKSKFDLKGRNEKMMEYIKNLRTCIRQFLQVESVYVMQQEQAQ  142

Query  462  sllesaeKRCSEMDMLMKSKEEELNAIIMELRK  560
            + ++  ++R  E +  M +K  EL A ++E R+
Sbjct  143  NQIKEEKQRHEESEQKMSAKYGELEAKLVEARQ  175



>ref|XP_008651920.1| PREDICTED: kinesin-5 [Zea mays]
 tpg|DAA59345.1| TPA: hypothetical protein ZEAMMB73_936761 [Zea mays]
Length=760

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  294  KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslkslle  473
            +EDV+ALL EK+K KNK + K K +QM EYI++L+ C +W  + E   + E E +   L+
Sbjct  54   REDVDALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACTKWLLEREDANLVEIERITGQLD  113

Query  474  saeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +  K+ SE+  ++K+  EE  +I  EL+K  A LQ+
Sbjct  114  ATHKQHSEIVAVLKNTIEETKSICEELQKQCASLQE  149



>ref|XP_002461304.1| hypothetical protein SORBIDRAFT_02g000560 [Sorghum bicolor]
 gb|EER97825.1| hypothetical protein SORBIDRAFT_02g000560 [Sorghum bicolor]
Length=758

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +3

Query  294  KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslkslle  473
            +EDVEALL EK+K KNK + K K +QM EYI++++ CIRW  + E   ++E + +   LE
Sbjct  52   REDVEALLNEKMKGKNKMDYKGKSEQMMEYIKKVRACIRWLLEREDINLAEIKRINGQLE  111

Query  474  saeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +  K+ SE+   +++  EE  ++  EL+K  A LQ+
Sbjct  112  ATHKQHSEIVADLENNIEETKSVYEELQKQCASLQE  147



>gb|KHN33612.1| Kinesin-1 [Glycine soja]
Length=717

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  336  KNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDMLMK  515
            +N+Y+ K+K DQM + I+RLK C+RWF+++E  YI E+E L++ LESAEK+C +++  MK
Sbjct  5    ENRYDNKKKMDQMGDLIKRLKLCLRWFKRVEEGYIQEKEKLQTDLESAEKKCLDIENEMK  64

Query  516  SKEEELNAIIMELRKNIAVLQD  581
             K  EL+  I  LR  I+ L++
Sbjct  65   IKIAELDETISNLRATISSLEE  86



>gb|ACL53698.1| unknown [Zea mays]
Length=427

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  294  KEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslkslle  473
            +EDV+ALL EK+K KNK + K K +QM EYI++L+ C +W  + E   + E E +   L+
Sbjct  54   REDVDALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACTKWLLEREDANLVEIERITGQLD  113

Query  474  saeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            +  K+ SE+  ++K+  EE  +I  EL+K  A LQ+
Sbjct  114  ATHKQHSEIVAVLKNTIEETKSICEELQKQCASLQE  149



>gb|KEH31186.1| kinesin motor catalytic domain protein [Medicago truncatula]
Length=672

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 88/163 (54%), Gaps = 29/163 (18%)
 Frame = +3

Query  51   MAPKSQNKPPVAPTPSSPSNGKFTVDEVSVDKKRKIGNPKMPSGVRPGRQAFAVVNGSAD  230
            MA ++QN+PP      + SN    V    ++++R  G  K  + +       A+VN +  
Sbjct  1    MASRNQNRPP-----QNHSN----VGSEDIERQRVSGRAKARAPLT------AMVNNAT-  44

Query  231  LpptsgppssagsDCGVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIR  410
                    +  G D  +IEF K+D+EALL EK+K    ++ K+K +QM + I+RLK C++
Sbjct  45   ------AGNIEGIDSSMIEFTKDDIEALLNEKMKKGTPFDNKKKMEQMVDLIKRLKLCVQ  98

Query  411  WFQQLEGNYIseqeslksllesaeKRCSEMDMLMKSKEEELNA  539
            W      N I   E+L S +ESA ++CS  ++ MK+K EEL +
Sbjct  99   WC----ANKI---ETLHSEVESAVEKCSATEIEMKNKTEELQS  134



>dbj|BAJ90626.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +3

Query  282  IEF-NKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqesl  458
            IEF  +EDV+ALL EK+K KNK + K + +QM EYI++L+ CI+W  + E   ++E   L
Sbjct  54   IEFAGREDVDALLNEKIKGKNKMDYKGRSEQMIEYIKKLRACIKWLLEREDANLAEIGKL  113

Query  459  ksllesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVL  575
              L+++A+K  +E+   ++ K +E  ++  EL+K  A L
Sbjct  114  NGLIDAADKHHAEIVAQLECKIQESVSMKEELQKQYATL  152



>ref|XP_002865499.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41758.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=71

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  348  NMKEKCDQMSEYIRRLKQCIRWFQQLEGNYI  440
            ++KE+C+ M EY++RL+ CIRWFQ+LE +Y+
Sbjct  8    SLKERCENMIEYVKRLRLCIRWFQELELDYV  38



>ref|XP_008780375.1| PREDICTED: kinesin-3-like isoform X1 [Phoenix dactylifera]
Length=117

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 53/76 (70%), Gaps = 8/76 (11%)
 Frame = +3

Query  327  LKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksllesaeKRCSEMDM  506
            +K KN+ + K K +QM EYI++L+ CIRWF +LE  Y+++QE L+S+L+S EKR +E+D+
Sbjct  1    MKGKNQNDYKGKSEQMIEYIKKLRTCIRWFMELEDGYLADQEKLRSMLDSEEKRHAEIDL  60

Query  507  --------LMKSKEEE  530
                    LM+ KE +
Sbjct  61   KNDRPSLNLMRRKERQ  76



>ref|XP_002962919.1| hypothetical protein SELMODRAFT_78306 [Selaginella moellendorffii]
 gb|EFJ36382.1| hypothetical protein SELMODRAFT_78306 [Selaginella moellendorffii]
Length=816

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = +3

Query  288  FNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksl  467
             ++ DV+ALL  K+  K K++ K K +QMS+YI++L+ CIR FQ  E     E+E+L+S 
Sbjct  79   LSRADVDALLAMKMAGKTKFDFKGKNEQMSDYIKKLRVCIRQFQDQEEKLSFEKENLESA  138

Query  468  lesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L+   +     +   + K++EL   + EL+     L+D
Sbjct  139  LDGERRDREVTEAFRRQKQDELEQGLSELKNLCTSLED  176



>ref|XP_002962358.1| hypothetical protein SELMODRAFT_78149 [Selaginella moellendorffii]
 gb|EFJ35821.1| hypothetical protein SELMODRAFT_78149 [Selaginella moellendorffii]
Length=816

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = +3

Query  288  FNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYIseqeslksl  467
             ++ DV+ALL  K+  K K++ K K +QMS+YI++L+ CIR FQ  E     E+E+L+S 
Sbjct  79   LSRADVDALLAMKMAGKTKFDFKGKNEQMSDYIKKLRVCIRQFQDQEVKLSFEKENLESA  138

Query  468  lesaeKRCSEMDMLMKSKEEELNAIIMELRKNIAVLQD  581
            L+   +     +   + K++EL   + EL+     L+D
Sbjct  139  LDGERRDREVTEAFRRQKQDELEQGLSELKNLCTSLED  176



>gb|EYU21183.1| hypothetical protein MIMGU_mgv1a026255mg, partial [Erythranthe 
guttata]
Length=414

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  276  GVIEFNKEDVEALLVEKLKTKNKYNMKEKCDQMSEYIRRLKQCIRWFQQLEGNYI  440
              +EF++E ++ALL EKL+ K+ +   EK   + EY++ LKQCI+WFQQ EGN +
Sbjct  36   STVEFSREHIDALLNEKLRVKDTHCFMEKVVVVEEYVKNLKQCIKWFQQREGNLV  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 941888806496