BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8088

Length=845
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    373   3e-121   Nicotiana sylvestris
ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    372   2e-120   Nicotiana tomentosiformis
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    361   4e-116   Solanum tuberosum [potatoes]
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    360   6e-116   Solanum lycopersicum
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    358   3e-115   Vitis vinifera
emb|CAN71280.1|  hypothetical protein VITISV_027089                     357   1e-114   Vitis vinifera
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   356   1e-114   Citrus sinensis [apfelsine]
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    357   2e-114   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             357   2e-114   
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    349   7e-112   Solanum tuberosum [potatoes]
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                348   1e-111   Erythranthe guttata [common monkey flower]
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             348   2e-111   
gb|AAM13860.1|  unknown protein                                         347   3e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192096.1|  tolB-related protein                                  347   3e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01464.1|  unnamed protein product                                349   3e-111   Coffea canephora [robusta coffee]
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    346   8e-111   Solanum lycopersicum
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             346   1e-110   Capsella rubella
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             344   1e-110   
ref|XP_007051240.1|  TolB protein-related isoform 1                     347   2e-110   
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     344   4e-110   Eucalyptus grandis [rose gum]
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    344   4e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    345   7e-110   Eucalyptus grandis [rose gum]
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    343   8e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    343   5e-109   
ref|XP_002515212.1|  conserved hypothetical protein                     340   2e-108   Ricinus communis
ref|XP_012082970.1|  PREDICTED: uncharacterized protein LOC105642677    341   3e-108   Jatropha curcas
gb|KCW58167.1|  hypothetical protein EUGRSUZ_H008852                    327   3e-108   Eucalyptus grandis [rose gum]
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    338   9e-108   Arabis alpina [alpine rockcress]
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    337   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    337   2e-107   Cucumis melo [Oriental melon]
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    336   6e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    335   1e-106   Elaeis guineensis
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     335   2e-106   Eucalyptus grandis [rose gum]
ref|XP_010091406.1|  hypothetical protein L484_013861                   335   3e-106   
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    334   8e-106   Fragaria vesca subsp. vesca
gb|KJB09508.1|  hypothetical protein B456_001G146700                    334   1e-105   Gossypium raimondii
emb|CDX74396.1|  BnaA03g26510D                                          332   2e-105   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    332   3e-105   Brassica rapa
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    330   7e-105   Cucumis sativus [cucumbers]
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    327   2e-103   Sesamum indicum [beniseed]
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             327   3e-103   
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    323   4e-102   Phoenix dactylifera
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    325   6e-102   Prunus mume [ume]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    311   3e-97    
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    311   7e-97    Pyrus x bretschneideri [bai li]
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    308   7e-96    Brachypodium distachyon [annual false brome]
ref|XP_010456117.1|  PREDICTED: uncharacterized protein LOC104737601    300   8e-96    
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    307   1e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001060406.1|  Os07g0638100                                       306   2e-95    
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    304   2e-94    Zea mays [maize]
gb|EAZ04851.1|  hypothetical protein OsI_27029                          303   3e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_006840287.1|  PREDICTED: uncharacterized protein LOC18430060     302   7e-94    
dbj|BAJ89339.1|  predicted protein                                      300   3e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          300   4e-93    Sorghum bicolor [broomcorn]
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    301   5e-93    Glycine max [soybeans]
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    300   7e-93    Cicer arietinum [garbanzo]
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             300   2e-92    Phaseolus vulgaris [French bean]
dbj|BAJ94262.1|  predicted protein                                      298   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    295   4e-91    Setaria italica
gb|EPS68684.1|  hypothetical protein M569_06083                         294   8e-91    Genlisea aurea
ref|XP_003637686.1|  Protein tolB                                       286   9e-88    
ref|XP_006840288.1|  PREDICTED: uncharacterized protein LOC18430062     284   7e-87    Amborella trichopoda
gb|AJD80981.1|  ABA-activated 1 protein                                 282   4e-86    Lupinus luteus
ref|XP_002515210.1|  conserved hypothetical protein                     278   4e-85    
ref|XP_003637684.1|  Protein tolB                                       276   4e-84    
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622             238   2e-69    
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782             218   2e-61    Selaginella moellendorffii
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603             217   3e-61    
gb|ABR17080.1|  unknown                                                 214   3e-60    Picea sitchensis
ref|XP_003630471.1|  Protein tolB                                       206   3e-57    
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g             205   6e-57    Phaseolus vulgaris [French bean]
dbj|BAJ88545.1|  predicted protein                                      204   9e-57    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    203   5e-56    
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865    202   5e-56    Glycine max [soybeans]
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein                202   5e-56    
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729    201   9e-56    Zea mays [maize]
gb|KJB29176.1|  hypothetical protein B456_005G088400                    201   1e-55    Gossypium raimondii
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    201   2e-55    Setaria italica
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753    200   3e-55    Solanum tuberosum [potatoes]
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    199   7e-55    Nelumbo nucifera [Indian lotus]
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                    199   8e-55    Arabis alpina [alpine rockcress]
ref|XP_001780675.1|  predicted protein                                  199   9e-55    
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096    198   1e-54    Cicer arietinum [garbanzo]
emb|CDP10971.1|  unnamed protein product                                199   1e-54    Coffea canephora [robusta coffee]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456    198   1e-54    Sesamum indicum [beniseed]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg                198   2e-54    Erythranthe guttata [common monkey flower]
emb|CDP10970.1|  unnamed protein product                                198   2e-54    Coffea canephora [robusta coffee]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324    197   3e-54    Solanum lycopersicum
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...    197   3e-54    Tarenaya hassleriana [spider flower]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...    197   3e-54    Tarenaya hassleriana [spider flower]
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505    197   3e-54    Camelina sativa [gold-of-pleasure]
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg             197   4e-54    Citrus clementina [clementine]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    197   4e-54    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058    197   4e-54    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001051846.1|  Os03g0840200                                       196   6e-54    
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg             196   6e-54    Capsella rubella
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          196   6e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880          196   7e-54    Sorghum bicolor [broomcorn]
ref|XP_002520326.1|  conserved hypothetical protein                     196   7e-54    Ricinus communis
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406             196   8e-54    
emb|CDY08186.1|  BnaA06g15400D                                          196   9e-54    Brassica napus [oilseed rape]
emb|CDX84088.1|  BnaC08g07650D                                          196   1e-53    
emb|CDY04662.1|  BnaC05g17000D                                          196   1e-53    
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763    196   1e-53    Populus euphratica
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760    196   1e-53    Populus euphratica
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553    196   1e-53    Citrus sinensis [apfelsine]
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                   196   1e-53    Citrus sinensis [apfelsine]
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814    196   2e-53    Vitis vinifera
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010    196   2e-53    Brassica rapa
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880    195   2e-53    Nicotiana tomentosiformis
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g             195   2e-53    Populus trichocarpa [western balsam poplar]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                   195   2e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978    195   2e-53    Nicotiana sylvestris
emb|CAN73514.1|  hypothetical protein VITISV_037210                     195   3e-53    Vitis vinifera
ref|XP_010269111.1|  PREDICTED: uncharacterized protein LOC104605872    194   3e-53    Nelumbo nucifera [Indian lotus]
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    194   6e-53    Elaeis guineensis
gb|EAY92514.1|  hypothetical protein OsI_14253                          193   8e-53    Oryza sativa Indica Group [Indian rice]
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg             193   1e-52    Eutrema salsugineum [saltwater cress]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                         192   2e-52    Jatropha curcas
ref|XP_012078271.1|  PREDICTED: uncharacterized protein LOC105638961    192   2e-52    Jatropha curcas
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288    192   2e-52    Camelina sativa [gold-of-pleasure]
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   2e-52    Eucalyptus grandis [rose gum]
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088    191   5e-52    Cucumis melo [Oriental melon]
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474    191   5e-52    Fragaria vesca subsp. vesca
ref|XP_007223068.1|  hypothetical protein PRUPE_ppa003730mg             189   7e-52    
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890    191   7e-52    Pyrus x bretschneideri [bai li]
ref|XP_010095431.1|  hypothetical protein L484_013388                   187   1e-50    
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783    187   1e-50    Prunus mume [ume]
ref|XP_004149439.1|  PREDICTED: uncharacterized protein LOC101203758    186   2e-50    Cucumis sativus [cucumbers]
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727    186   2e-50    
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          182   2e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652005.1|  PREDICTED: uncharacterized protein LOC102702184    167   8e-45    
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673    168   7e-44    Tarenaya hassleriana [spider flower]
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   2e-42    
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    158   3e-40    Camelina sativa [gold-of-pleasure]
ref|NP_564146.1|  uncharacterized protein                               157   7e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    157   7e-40    Camelina sativa [gold-of-pleasure]
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    157   8e-40    Camelina sativa [gold-of-pleasure]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    156   9e-40    
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             155   2e-39    Arabidopsis lyrata subsp. lyrata
gb|EAY93383.1|  hypothetical protein OsI_15178                          150   5e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg             150   2e-37    Eutrema salsugineum [saltwater cress]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    150   2e-37    Coccomyxa subellipsoidea C-169
emb|CBI18981.3|  unnamed protein product                                147   1e-36    Vitis vinifera
emb|CDY04661.1|  BnaC05g16990D                                          147   2e-36    
ref|XP_002520327.1|  conserved hypothetical protein                     145   5e-36    
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008    145   8e-36    Brassica rapa
emb|CDY08187.1|  BnaA06g15390D                                          145   9e-36    Brassica napus [oilseed rape]
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                    145   2e-35    Arabis alpina [alpine rockcress]
gb|EMT16880.1|  hypothetical protein F775_15390                         131   1e-31    
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                     132   2e-31    Eucalyptus grandis [rose gum]
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                     127   2e-29    Eucalyptus grandis [rose gum]
ref|XP_002467956.1|  hypothetical protein SORBIDRAFT_01g037140          127   4e-29    
ref|NP_001173830.1|  Os04g0278101                                       122   1e-28    
gb|EMT08438.1|  hypothetical protein F775_30261                         121   6e-27    
gb|AEW08691.1|  hypothetical protein CL1213Contig1_01                   111   6e-27    Pinus lambertiana
ref|XP_002446045.1|  hypothetical protein SORBIDRAFT_06g000930          118   3e-26    Sorghum bicolor [broomcorn]
ref|XP_004963491.1|  PREDICTED: uncharacterized protein LOC101774581    117   9e-26    Setaria italica
ref|XP_010102639.1|  hypothetical protein L484_010931                   117   9e-26    Morus notabilis
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779    117   1e-25    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002519802.1|  conserved hypothetical protein                     115   4e-25    Ricinus communis
ref|XP_002519807.1|  conserved hypothetical protein                     115   5e-25    
ref|XP_008662981.1|  PREDICTED: uncharacterized protein LOC103641407    114   7e-25    Zea mays [maize]
dbj|BAJ92843.1|  predicted protein                                      114   7e-25    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEW08692.1|  hypothetical protein CL1213Contig1_01                   106   8e-25    Pinus radiata
gb|AFG48602.1|  hypothetical protein CL1213Contig1_01                   105   8e-25    Pinus taeda
ref|NP_001049934.1|  Os03g0314500                                       114   8e-25    
gb|EAY89757.1|  hypothetical protein OsI_11300                          114   9e-25    Oryza sativa Indica Group [Indian rice]
ref|XP_004960704.1|  PREDICTED: uncharacterized protein LOC101777811    114   1e-24    Setaria italica
ref|XP_002524160.1|  conserved hypothetical protein                     114   2e-24    Ricinus communis
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772    113   2e-24    Beta vulgaris subsp. vulgaris [field beet]
gb|EAY90391.1|  hypothetical protein OsI_11968                          113   2e-24    Oryza sativa Indica Group [Indian rice]
ref|WP_041858684.1|  hypothetical protein                               112   3e-24    
gb|ABJ88479.1|  WD40 domain protein beta Propeller                      112   4e-24    Candidatus Solibacter usitatus Ellin6076
gb|AFG48601.1|  hypothetical protein CL1213Contig1_01                   104   4e-24    Pinus taeda
ref|XP_002524154.1|  conserved hypothetical protein                     112   4e-24    Ricinus communis
ref|XP_010097765.1|  hypothetical protein L484_023906                   112   5e-24    Morus notabilis
gb|EAZ27259.1|  hypothetical protein OsJ_11196                          112   7e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010676033.1|  PREDICTED: uncharacterized protein LOC104891943    111   1e-23    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001050324.1|  Os03g0403400                                       111   1e-23    
ref|XP_002437598.1|  hypothetical protein SORBIDRAFT_10g030220          110   3e-23    Sorghum bicolor [broomcorn]
gb|EMT14934.1|  hypothetical protein F775_30553                         110   3e-23    
ref|XP_010676032.1|  PREDICTED: uncharacterized protein LOC104891942    109   4e-23    Beta vulgaris subsp. vulgaris [field beet]
gb|EMS49561.1|  hypothetical protein TRIUR3_11240                       107   8e-23    Triticum urartu
dbj|BAK07068.1|  predicted protein                                      108   1e-22    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780    107   1e-22    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT19136.1|  hypothetical protein F775_12749                         107   3e-22    
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773    107   3e-22    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT29283.1|  hypothetical protein F775_17496                         107   4e-22    
ref|XP_010105408.1|  hypothetical protein L484_008562                   103   5e-22    
ref|XP_004980674.1|  PREDICTED: uncharacterized protein LOC101756594    106   6e-22    Setaria italica
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313    105   9e-22    
ref|XP_010087211.1|  hypothetical protein L484_006140                   105   1e-21    Morus notabilis
ref|XP_003575792.1|  PREDICTED: uncharacterized protein LOC100821131    105   1e-21    Brachypodium distachyon [annual false brome]
gb|AFB33555.1|  hypothetical protein 2_7121_02                        98.6    2e-21    Pinus mugo [mountain pine]
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501    103   4e-21    Brachypodium distachyon [annual false brome]
gb|AFG49274.1|  hypothetical protein 2_7121_02                        97.8    4e-21    Pinus taeda
gb|AEW08359.1|  hypothetical protein 2_7121_02                        97.4    4e-21    Pinus radiata
gb|EMS54560.1|  hypothetical protein TRIUR3_19354                     97.1    4e-21    Triticum urartu
gb|AFB33549.1|  hypothetical protein 2_7121_02                        96.7    7e-21    Abies alba [abete-blanco]
gb|EJL34752.1|  periplasmic component of the Tol biopolymer trans...    102   9e-21    Caulobacter sp. AP07
ref|XP_010102640.1|  hypothetical protein L484_010932                   102   1e-20    Morus notabilis
ref|XP_010097467.1|  hypothetical protein L484_024672                   102   1e-20    
ref|XP_010097483.1|  hypothetical protein L484_024689                   100   5e-20    Morus notabilis
gb|AEW08360.1|  hypothetical protein 2_7121_02                        94.4    6e-20    Pinus lambertiana
gb|EMT06488.1|  hypothetical protein F775_06751                         100   7e-20    
ref|WP_035092853.1|  hypothetical protein                             99.4    8e-20    Caulobacter henricii
gb|AFB33553.1|  hypothetical protein 2_7121_02                        94.0    9e-20    Pinus cembra [Arve]
gb|AFB33550.1|  hypothetical protein 2_7121_02                        92.8    2e-19    Larix decidua
emb|CDM86908.1|  unnamed protein product                              97.8    4e-19    Triticum aestivum [Canadian hard winter wheat]
gb|EJE50504.1|  periplasmic component of the Tol biopolymer trans...  96.7    7e-19    Acidovorax sp. CF316
ref|WP_035205184.1|  hypothetical protein                             96.7    8e-19    Acidovorax
ref|WP_020604165.1|  hypothetical protein                             96.3    9e-19    Spirosoma spitsbergense
ref|XP_006658881.1|  PREDICTED: uncharacterized protein LOC102705738  87.8    1e-18    Oryza brachyantha
ref|WP_006298539.1|  hypothetical protein                             95.5    2e-18    
gb|KFY81759.1|  hypothetical protein V500_11119                       94.7    3e-18    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ03462.1|  hypothetical protein V502_10931                       94.4    5e-18    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|WP_029915040.1|  hypothetical protein                             93.6    8e-18    Caulobacter sp. UNC358MFTsu5.1
gb|KFY12538.1|  hypothetical protein V491_06750                       93.6    8e-18    Pseudogymnoascus sp. VKM F-3775
ref|NP_001066679.1|  Os12g0431300                                     92.4    2e-17    
ref|WP_043399319.1|  tolB protein precursor protein                   88.6    6e-17    
gb|KFY42678.1|  hypothetical protein V495_04387                       90.5    7e-17    Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY02373.1|  hypothetical protein O988_02191                       89.7    1e-16    Pseudogymnoascus sp. VKM F-3808
gb|KFX90155.1|  hypothetical protein V490_06619                       89.7    1e-16    Pseudogymnoascus sp. VKM F-3557
gb|KFY15902.1|  hypothetical protein V492_01680                       89.4    2e-16    Pseudogymnoascus sp. VKM F-4246
ref|WP_035035180.1|  hypothetical protein                             88.6    3e-16    
ref|XP_001545913.1|  hypothetical protein BC1G_15641                  88.6    4e-16    Botrytis cinerea B05.10
ref|WP_034400879.1|  translocation protein TolB                       87.0    6e-16    
gb|KFZ05841.1|  hypothetical protein V501_07970                       87.8    7e-16    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY39698.1|  hypothetical protein V494_03875                       87.0    1e-15    Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|WP_020383615.1|  hypothetical protein                             84.7    1e-15    
gb|KFY74302.1|  hypothetical protein V499_05663                       86.7    1e-15    Pseudogymnoascus sp. VKM F-103
gb|ENH85242.1|  WD40 domain protein beta propeller                    86.3    2e-15    
gb|AFK45973.1|  unknown                                               79.7    2e-15    Medicago truncatula
ref|XP_007914327.1|  putative tat pathway signal sequence domain-...  85.1    5e-15    Phaeoacremonium minimum UCRPA7
ref|WP_027978304.1|  hypothetical protein                             84.7    5e-15    
ref|WP_041305462.1|  hypothetical protein                             80.5    6e-15    
gb|ETI58852.1|  hypothetical protein C100_22665                       84.7    6e-15    Sphingobium sp. C100
ref|WP_031310342.1|  hypothetical protein                             84.3    7e-15    Sphingobium sp. C100
emb|CAE05101.3|  OSJNBa0009K15.21                                     79.0    1e-14    Oryza sativa Japonica Group [Japonica rice]
gb|ESZ89568.1|  hypothetical protein SBOR_10048                       83.6    1e-14    Sclerotinia borealis F-4128
gb|AHI25037.1|  hypothetical protein H845_1092                        83.6    2e-14    Komagataeibacter xylinus E25
ref|WP_025438063.1|  hypothetical protein                             83.2    2e-14    Komagataeibacter xylinus
dbj|GAA89133.1|  tat pathway signal sequence domain-containing pr...  83.2    2e-14    Aspergillus kawachii IFO 4308
gb|ABX03625.1|  WD40 domain protein beta Propeller                    81.3    2e-14    Herpetosiphon aurantiacus DSM 785
gb|KEQ78669.1|  tricorn protease N-terminal domain-containing pro...  82.8    2e-14    Aureobasidium pullulans EXF-150
ref|XP_007835900.1|  hypothetical protein PFICI_09128                 82.8    2e-14    Pestalotiopsis fici W106-1
ref|WP_033378529.1|  MULTISPECIES: hypothetical protein               80.5    3e-14    
ref|WP_020384321.1|  hypothetical protein                             80.9    3e-14    
gb|EKD68537.1|  Periplasmic component of the Tol biopolymer trans...  82.4    4e-14    uncultured bacterium
gb|EHA25732.1|  hypothetical protein ASPNIDRAFT_50375                 82.4    4e-14    Aspergillus niger ATCC 1015
ref|WP_026159723.1|  hypothetical protein                             80.5    4e-14    
gb|KEZ20905.1|  Periplasmic component of the Tol biopolymer trans...  82.0    4e-14    Sphingobium yanoikuyae
ref|WP_037517431.1|  hypothetical protein                             82.0    4e-14    Sphingobium yanoikuyae
ref|XP_001395414.2|  hypothetical protein ANI_1_1672104               82.0    4e-14    Aspergillus niger CBS 513.88
ref|WP_030901696.1|  hypothetical protein                             82.0    4e-14    Streptomyces sp. NRRL F-5126
ref|WP_020383554.1|  hypothetical protein                             80.5    4e-14    
ref|WP_037486764.1|  hypothetical protein                             81.6    6e-14    
emb|CAI78611.1|  tolB protein                                         80.9    6e-14    uncultured delta proteobacterium
gb|EJK81239.1|  periplasmic component of the Tol biopolymer trans...  81.6    6e-14    Sphingobium sp. AP49
ref|WP_040479380.1|  translocation protein TolB                       79.3    8e-14    
gb|EMS34061.1|  tolB protein precursor, periplasmic protein invol...  79.7    8e-14    Mariniradius saccharolyticus AK6
ref|WP_019091574.1|  hypothetical protein                             81.3    8e-14    Komagataeibacter europaeus
ref|XP_010091904.1|  hypothetical protein L484_001053                 77.8    1e-13    
dbj|GAN96017.1|  hypothetical protein Geu3261_0045_019                80.9    1e-13    Komagataeibacter europaeus NBRC 3261
ref|XP_007798560.1|  putative tat pathway signal sequence domain-...  80.9    1e-13    
ref|WP_010509656.1|  hypothetical protein                             80.9    1e-13    Komagataeibacter europaeus
ref|WP_019086650.1|  hypothetical protein                             80.9    1e-13    Komagataeibacter europaeus
ref|WP_045121381.1|  tolB protein precursor protein                   79.3    1e-13    
ref|WP_041978883.1|  hypothetical protein                             79.3    1e-13    
ref|WP_041569562.1|  hypothetical protein                             79.0    1e-13    
ref|WP_045434171.1|  hypothetical protein                             78.2    1e-13    
emb|CDM66426.1|  periplasmic component of the Tol biopolymer tran...  79.3    1e-13    Pyrinomonas methylaliphatogenes
ref|WP_015754374.1|  translocation protein TolB                       78.6    1e-13    Robiginitalea biformata
ref|WP_015838788.1|  translocation protein TolB                       79.7    2e-13    Geobacter sp. M21
gb|AEP11793.1|  Periplasmic component of the Tol biopolymer trans...  79.0    2e-13    Chloracidobacterium thermophilum B
dbj|GAD95313.1|  hypothetical protein ANI_1_1672104                   80.1    2e-13    Byssochlamys spectabilis No. 5
gb|ACY18885.1|  beta-propeller repeat-containing to-pal system pr...  79.0    2e-13    Haliangium ochraceum DSM 14365
ref|WP_041576117.1|  translocation protein TolB                       79.7    2e-13    
ref|WP_026842125.1|  translocation protein TolB                       79.3    2e-13    
gb|AGH96540.1|  adventurous gliding motility protein W                79.3    2e-13    
ref|WP_020383555.1|  hypothetical protein                             78.2    2e-13    
ref|XP_007595649.1|  TOXD                                             79.7    3e-13    
gb|EKG10177.1|  Six-bladed beta-propeller TolB-like protein           79.3    4e-13    
ref|WP_013226661.1|  translocation protein TolB                       79.7    4e-13    
ref|XP_007588104.1|  putative tat pathway signal sequence domain-...  79.0    4e-13    
gb|EDT09480.1|  hypothetical protein BgramDRAFT_3858                  79.0    4e-13    
ref|WP_029968882.1|  hypothetical protein                             79.0    4e-13    
ref|WP_044021394.1|  hypothetical protein                             79.0    4e-13    
ref|XP_003040341.1|  hypothetical protein NECHADRAFT_34811            78.6    5e-13    
ref|WP_015718924.1|  translocation protein TolB                       78.2    5e-13    
emb|CAK46110.1|  unnamed protein product                              78.6    6e-13    
ref|WP_000615434.1|  hypothetical protein                             76.6    6e-13    
emb|CBH22796.1|  TolB protein precursor                               77.8    8e-13    
ref|WP_006403962.1|  hypothetical protein                             78.2    9e-13    
ref|WP_036546999.1|  hypothetical protein                             75.5    9e-13    
ref|WP_045593518.1|  hypothetical protein                             77.8    9e-13    
dbj|GAK58097.1|  WD40-like Beta Propeller                             77.8    9e-13    
gb|AJY17087.1|  hypothetical protein NP80_4005                        77.8    9e-13    
ref|WP_035954400.1|  hypothetical protein                             77.8    9e-13    
ref|WP_006399669.1|  hypothetical protein                             77.8    9e-13    
ref|WP_035474624.1|  hypothetical protein                             77.8    1e-12    
ref|WP_039218915.1|  hypothetical protein                             77.8    1e-12    
ref|WP_027818119.1|  hypothetical protein                             77.8    1e-12    
ref|WP_020384323.1|  hypothetical protein                             76.3    1e-12    
ref|WP_012531942.1|  translocation protein TolB                       77.0    1e-12    
ref|WP_033198113.1|  WD40 domain protein beta propeller               75.5    1e-12    
ref|WP_043201552.1|  hypothetical protein                             77.4    1e-12    
ref|WP_044595669.1|  hypothetical protein                             76.3    1e-12    
gb|EQB54739.1|  hypothetical protein CGLO_05391                       77.4    1e-12    
ref|WP_039744998.1|  translocation protein TolB                       76.6    2e-12    
ref|WP_027716026.1|  translocation protein TolB                       76.6    2e-12    
gb|AHG92466.1|  WD40-like beta Propeller containing protein           77.0    2e-12    
ref|WP_015250253.1|  Tol biopolymer transport system periplasmic ...  75.5    2e-12    
ref|XP_007275047.1|  WD40 domain protein beta propeller               77.0    2e-12    
emb|CBE67573.1|  Protein tolB precursor                               76.6    2e-12    
gb|KIL85442.1|  hypothetical protein FAVG1_11399                      77.0    2e-12    
gb|KJJ26557.1|  WD40YVTN repeat-like-containing domain                76.6    2e-12    
ref|WP_020384320.1|  hypothetical protein                             74.7    3e-12    
ref|WP_020258740.1|  hypothetical protein                             75.1    3e-12    
ref|XP_007828048.1|  hypothetical protein PFICI_01276                 76.6    3e-12    
ref|WP_027211084.1|  hypothetical protein                             76.6    3e-12    
dbj|BAL54994.1|  TolB protein                                         74.7    3e-12    
ref|WP_033260684.1|  translocation protein TolB                       76.3    4e-12    
ref|WP_042305737.1|  hypothetical protein                             75.9    4e-12    
ref|WP_044188701.1|  tolB protein precursor protein                   75.1    5e-12    
dbj|BAJ63516.1|  hypothetical protein ANT_14880                       73.9    5e-12    
ref|WP_038036308.1|  translocation protein TolB                       75.5    5e-12    
ref|WP_026181509.1|  MULTISPECIES: translocation protein TolB         75.1    6e-12    
gb|KGO45093.1|  WD40-like Beta Propeller                              75.5    6e-12    
ref|WP_043431595.1|  tolB protein precursor protein                   74.7    7e-12    
ref|WP_012115032.1|  beta-propeller repeat-containing to-pal syst...  75.1    7e-12    
gb|EKD55533.1|  WD40-like protein Beta Propeller                      75.5    7e-12    
ref|WP_004513696.1|  protein TolB                                     74.7    8e-12    
gb|KGO53636.1|  WD40-like Beta Propeller                              75.1    8e-12    
gb|EKV04294.1|  hypothetical protein PDIP_88020                       75.1    8e-12    
gb|EPX59664.1|  tolB protein precursor, periplasmic protein           74.3    9e-12    
gb|AIO73947.1|  hypothetical protein DM80_3777                        74.7    1e-11    
gb|KJK63176.1|  tol-pal system beta propeller repeat protein TolB     74.7    1e-11    
ref|WP_038283157.1|  translocation protein TolB                       74.3    1e-11    
ref|WP_038053671.1|  translocation protein TolB                       74.3    1e-11    
ref|WP_015828440.1|  hypothetical protein                             74.7    1e-11    
gb|EMD82160.1|  TolB protein precursor                                74.3    1e-11    
ref|XP_008082401.1|  DPP6 N-terminal                                  74.3    2e-11    
dbj|GAA92300.1|  tat pathway signal sequence domain-containing pr...  74.3    2e-11    
ref|WP_025779649.1|  hypothetical protein                             71.6    2e-11    
ref|WP_045504081.1|  hypothetical protein                             72.4    2e-11    
emb|CDM26673.1|  Six-bladed beta-propeller, TolB-like                 73.9    2e-11    
ref|WP_035992689.1|  hypothetical protein                             73.9    2e-11    
ref|WP_035513763.1|  hypothetical protein                             73.9    2e-11    
ref|WP_029877303.1|  translocation protein TolB                       73.6    2e-11    
ref|WP_045711895.1|  hypothetical protein                             73.6    2e-11    
gb|KGO75694.1|  WD40-like Beta Propeller                              73.9    2e-11    
ref|WP_045705655.1|  hypothetical protein                             73.6    2e-11    
ref|WP_011550484.1|  hypothetical protein                             73.2    2e-11    
ref|WP_038454721.1|  hypothetical protein                             73.6    3e-11    
ref|WP_043436880.1|  hypothetical protein                             73.6    3e-11    
ref|WP_029557867.1|  translocation protein TolB                       73.2    3e-11    
dbj|GAK49571.1|  WD40-like Beta Propeller                             72.0    3e-11    
gb|KJX86507.1|  Protein tolB                                          70.9    3e-11    
dbj|GAM35983.1|  hypothetical protein TCE0_018f04727                  73.6    3e-11    
gb|EYE99209.1|  TolB, C-terminal domain-containing protein            73.6    3e-11    
ref|XP_010262814.1|  PREDICTED: uncharacterized protein LOC104601238  67.4    3e-11    
ref|WP_043949727.1|  translocation protein TolB                       72.8    3e-11    
ref|WP_041872499.1|  translocation protein TolB                       72.8    3e-11    
ref|WP_043539896.1|  translocation protein TolB                       72.8    3e-11    
ref|WP_023399162.1|  periplasmic component of the Tol biopolymer ...  72.0    4e-11    
gb|EHA23695.1|  hypothetical protein ASPNIDRAFT_180130                73.2    4e-11    
ref|WP_012973608.1|  TolB protein                                     72.8    4e-11    
ref|WP_020678259.1|  hypothetical protein                             72.4    5e-11    
ref|WP_043785949.1|  translocation protein TolB                       73.2    5e-11    
gb|KJJ29939.1|  WD40-like Beta Propeller Repeat                       72.8    5e-11    
ref|WP_040095900.1|  translocation protein TolB                       72.4    5e-11    
ref|WP_013942199.1|  translocation protein TolB                       72.4    5e-11    
dbj|BAQ44058.1|  translocation protein TolB                           72.4    5e-11    
ref|XP_010094534.1|  hypothetical protein L484_024827                 69.7    6e-11    
ref|WP_012640704.1|  TolB protein                                     72.4    6e-11    
gb|KIN05407.1|  hypothetical protein OIDMADRAFT_39656                 72.4    6e-11    
gb|ABW31820.1|  WD40-like Beta Propeller, putative                    71.6    6e-11    
ref|WP_014247215.1|  periplasmic protein of the Tol-Pal system        72.0    6e-11    
ref|WP_010921063.1|  protein TolB                                     72.0    6e-11    
ref|WP_042703626.1|  translocation protein TolB                       71.6    7e-11    
ref|WP_043623202.1|  translocation protein TolB                       72.0    7e-11    
ref|WP_015930945.1|  Tol-Pal system beta propeller repeat-contain...  72.0    7e-11    
ref|WP_034806253.1|  translocation protein TolB                       71.6    8e-11    
ref|XP_003570812.2|  PREDICTED: uncharacterized protein LOC100837266  72.0    8e-11    
ref|WP_039647551.1|  translocation protein TolB                       71.6    9e-11    
ref|WP_040889071.1|  WD40 domain protein beta propeller               70.5    9e-11    
ref|WP_025306923.1|  translocation protein TolB                       71.6    9e-11    
ref|WP_036196430.1|  hypothetical protein                             70.1    9e-11    
ref|XP_002378780.1|  hypothetical protein AFLA_060360                 68.9    9e-11    
ref|WP_026331166.1|  translocation protein TolB                       71.2    1e-10    
ref|WP_002615693.1|  hypothetical protein                             70.9    1e-10    
ref|WP_006000501.1|  translocation protein TolB                       71.2    1e-10    
ref|WP_012169055.1|  twin-arginine translocation pathway signal       71.2    1e-10    
ref|WP_035277427.1|  hypothetical protein                             71.2    1e-10    
gb|ETW93507.1|  hypothetical protein ETSY1_38930                      70.9    1e-10    
ref|WP_014240516.1|  periplasmic protein of the Tol-Pal system        71.2    1e-10    
ref|XP_002559211.1|  Pc13g07820                                       71.6    1e-10    
ref|XP_001391151.1|  hypothetical protein ANI_1_1414064               71.6    1e-10    
ref|WP_002638920.1|  translocation protein TolB                       71.2    1e-10    
gb|EQB62921.1|  hypothetical protein RBG1_1C00001G0500                71.2    1e-10    
ref|WP_041187541.1|  hypothetical protein                             70.5    1e-10    
gb|EGL66673.1|  translocation protein                                 70.9    2e-10    
ref|WP_026091053.1|  translocation protein TolB                       70.9    2e-10    
ref|WP_038037302.1|  MULTISPECIES: translocation protein TolB         70.9    2e-10    
gb|AEB09960.1|  Protein tolB                                          70.9    2e-10    
ref|WP_038035303.1|  MULTISPECIES: translocation protein TolB         70.9    2e-10    
ref|WP_028484711.1|  translocation protein TolB                       70.9    2e-10    
ref|WP_010973273.1|  MULTISPECIES: protein TolB                       70.9    2e-10    
ref|WP_029638152.1|  translocation protein TolB                       70.9    2e-10    
emb|CBK43047.1|  Protein TolB precursor                               70.9    2e-10    
gb|AJK53249.1|  translocation protein TolB                            71.2    2e-10    
ref|WP_041726769.1|  hypothetical protein                             69.7    2e-10    
ref|WP_036514540.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_029010378.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_041870465.1|  hypothetical protein                             69.3    2e-10    
ref|WP_045429262.1|  hypothetical protein                             70.5    2e-10    
gb|ADG09198.1|  Tol-Pal system beta propeller repeat protein TolB     70.5    2e-10    
ref|WP_030055158.1|  MULTISPECIES: hypothetical protein               70.5    2e-10    
gb|AIE98934.1|  WD40-like beta propeller repeat-containing protei...  70.5    2e-10    
ref|WP_019872746.1|  hypothetical protein                             70.5    2e-10    
ref|WP_040498617.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_017943217.1|  hypothetical protein                             70.5    2e-10    
ref|WP_041538454.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_015345983.1|  beta-propeller repeat-containing to-pal syst...  70.1    2e-10    
ref|WP_007678383.1|  TolB protein                                     68.2    2e-10    
ref|WP_038028868.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_043262479.1|  hypothetical protein                             70.5    2e-10    
ref|WP_045510078.1|  hypothetical protein                             69.3    2e-10    
ref|WP_038527217.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_024902097.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_009521907.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_045434165.1|  hypothetical protein                             69.3    2e-10    
ref|WP_025322946.1|  hypothetical protein                             70.1    2e-10    
ref|WP_041787794.1|  translocation protein TolB                       70.5    2e-10    
ref|WP_012187572.1|  WD40 domain-containing protein                   70.5    3e-10    
gb|ADU66304.1|  TolB protein                                          70.5    3e-10    
emb|CDI10460.1|  Protein tolB precursor                               70.1    3e-10    
gb|ADP72488.1|  Tol-Pal system beta propeller repeat protein TolB     70.1    3e-10    
ref|WP_028318597.1|  hypothetical protein                             70.1    3e-10    
gb|EFF88542.1|  tat pathway signal sequence domain-containing pro...  70.5    3e-10    
ref|WP_011555707.1|  protein TolB                                     70.1    3e-10    
ref|WP_013088521.1|  MULTISPECIES: translocation protein TolB         70.1    3e-10    
emb|CBH39656.1|  conserved hypothetical secreted protein, contain...  69.3    3e-10    
ref|WP_006697167.1|  MULTISPECIES: translocation protein TolB         70.1    3e-10    
dbj|GAK55986.1|  protein tolB                                         70.1    3e-10    
ref|WP_010813737.1|  MULTISPECIES: translocation protein TolB         70.1    3e-10    
ref|WP_044278321.1|  tolB protein precursor protein                   69.7    3e-10    
ref|WP_004445729.1|  MULTISPECIES: tol-pal system beta propeller ...  70.1    3e-10    
ref|WP_029131120.1|  translocation protein TolB                       70.1    3e-10    
ref|WP_009208751.1|  tolB protein, periplasmic component, biopoly...  70.1    3e-10    
ref|WP_007661449.1|  tol-pal system beta propeller repeat protein...  70.1    3e-10    
gb|EYE95611.1|  dipeptidyl peptidase IV/CD26, N-terminal domain-c...  70.5    3e-10    
dbj|GAK58088.1|  WD40-like Beta Propeller                             69.3    3e-10    
ref|WP_024348846.1|  translocation protein TolB                       70.1    3e-10    
ref|WP_018288388.1|  hypothetical protein                             69.7    3e-10    
dbj|GAK52271.1|  WD40-like Beta Propeller                             70.1    3e-10    
gb|KJR43999.1|  Tol-Pal system beta propeller repeat-containing p...  69.7    4e-10    
ref|WP_025585162.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_036002953.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_007584949.1|  MULTISPECIES: translocation protein TolB         69.7    4e-10    
ref|WP_003511387.1|  MULTISPECIES: translocation protein TolB         69.7    4e-10    
ref|WP_036316959.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_007068778.1|  translocation protein TolB precursor             69.7    4e-10    
gb|ADY66818.1|  protein tolB precursor                                69.7    4e-10    
ref|WP_045580584.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_012353553.1|  translocation protein TolB                       69.7    4e-10    
dbj|GAK88347.1|  TolB protein precursor                               69.3    4e-10    
ref|WP_011582484.1|  protein TolB                                     69.7    4e-10    
ref|WP_042291254.1|  hypothetical protein                             69.3    4e-10    
ref|WP_029914308.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_028371949.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_012401832.1|  protein TolB                                     69.7    4e-10    
ref|WP_003523242.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_028223068.1|  translocation protein TolB                       69.7    4e-10    
ref|WP_026279915.1|  translocation protein TolB                       69.7    5e-10    
ref|WP_045774696.1|  translocation protein TolB                       69.7    5e-10    
ref|WP_038523674.1|  translocation protein TolB                       70.1    5e-10    
ref|WP_020402308.1|  hypothetical protein                             69.7    5e-10    
ref|WP_031448221.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_038032937.1|  MULTISPECIES: translocation protein TolB         69.3    5e-10    
ref|WP_003506242.1|  protein TolB                                     69.3    5e-10    
ref|WP_041970151.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_038045813.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_026190563.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_026364039.1|  MULTISPECIES: protein TolB                       69.3    5e-10    
ref|WP_006726830.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_013957626.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_020383553.1|  hypothetical protein                             67.8    5e-10    
ref|WP_035680557.1|  translocation protein TolB                       69.3    5e-10    
ref|WP_012333176.1|  beta-propeller repeat-containing to-pal syst...  69.3    5e-10    
ref|WP_041785250.1|  translocation protein TolB                       69.3    6e-10    
ref|WP_045786260.1|  translocation protein TolB                       69.3    6e-10    
gb|ACI99197.1|  protein TolB precursor                                69.3    6e-10    
ref|WP_023666083.1|  translocation protein TolB                       69.3    6e-10    
gb|AIF22130.1|  WD40-like beta propeller repeat-containing protei...  68.9    6e-10    
dbj|GAM34283.1|  hypothetical protein TCE0_015r01756                  69.3    6e-10    
ref|WP_012431818.1|  protein TolB                                     68.9    6e-10    
ref|WP_027196776.1|  translocation protein TolB                       68.9    7e-10    



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   373 bits (958),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 200/233 (86%), Gaps = 2/233 (1%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP NLT++      EIPVEIKVLTKE TGNNAFPSCSPDGKH+VFRSGRSGHKNLYI+D
Sbjct  432  FDPLNLTNEDCAG--EIPVEIKVLTKEETGNNAFPSCSPDGKHVVFRSGRSGHKNLYIVD  489

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++ GEL+GG IRQLT G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYVV PDGTGL
Sbjct  490  AIKGELEGGEIRQLTKGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFSIYVVHPDGTGL  549

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI+VAG EGS+E ++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PNQ+QPYGDLY++
Sbjct  550  RRIYVAGPEGSDEADKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPNQYQPYGDLYLV  609

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            +LDG+GLQRLTWNGYENGTPAWHP A   +        G+KLRG+FD+ LW+N
Sbjct  610  KLDGSGLQRLTWNGYENGTPAWHPSATTTVEVKRSLLVGDKLRGEFDDVLWMN  662



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 197/220 (90%), Gaps = 4/220 (2%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIPVEIKVLTKE TGNNAFPSCSPDGKH+VFRSGRSGHKNLYI+D++ GEL+GG I QLT
Sbjct  482  EIPVEIKVLTKEETGNNAFPSCSPDGKHVVFRSGRSGHKNLYIVDAVKGELEGGEICQLT  541

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYVV PDGTGLRRIHVAG EGS+EV+
Sbjct  542  EGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFSIYVVHPDGTGLRRIHVAGPEGSDEVD  601

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            +ERLNHVCFS D EW+LFTANLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GLQRLTWNGY
Sbjct  602  KERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLQRLTWNGY  661

Query  198  ENGTPAWHPKA--EVDLARLSLGKSGEKLRGKFDEPLWIN  85
            ENGTPAWHP A   VD+ R  L   G+KLRG+FD+ LW+N
Sbjct  662  ENGTPAWHPSATITVDVKRSLL--VGDKLRGEFDDVLWMN  699



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   361 bits (927),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 197/221 (89%), Gaps = 4/221 (2%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            +IPVEI+VLTKE TGNNAFPSCSPDGKHIVFRSGRSGHKNLYI+D++ GEL+GGGIRQLT
Sbjct  478  KIPVEIEVLTKEETGNNAFPSCSPDGKHIVFRSGRSGHKNLYIMDAVKGELEGGGIRQLT  537

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYV+ P+GTGLRRIHVAG EGS+EV+
Sbjct  538  EGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFSIYVIHPNGTGLRRIHVAGPEGSDEVD  597

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            +ERLNHVCFS D EW+LFT NLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GL+RLT N Y
Sbjct  598  KERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLRRLTCNAY  657

Query  198  ENGTPAWHPKAEVDLARLSLGKS---GEKLRGKFDEPLWIN  85
            ENGTPAWHP A + +  L + ++   G+KLRG+FD+ LW+N
Sbjct  658  ENGTPAWHPSA-MPMTALDIERNVIVGDKLRGEFDDVLWMN  697



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   360 bits (925),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 195/222 (88%), Gaps = 6/222 (3%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIPVEI+VLTKE TGNNAFPSCSPDGKHIVFRSGRSGHKNLYI+DS+ GEL+GGGIRQLT
Sbjct  477  EIPVEIEVLTKEETGNNAFPSCSPDGKHIVFRSGRSGHKNLYIMDSVKGELEGGGIRQLT  536

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYV+ P+GTGLRRIHVAG EGS+EV+
Sbjct  537  EGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFSIYVIHPNGTGLRRIHVAGPEGSDEVD  596

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            +ERLNHVCFS D EW+LFT NLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GL++LT N Y
Sbjct  597  KERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLRQLTCNAY  656

Query  198  ENGTPAWHPK----AEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            ENGTPAWHP       +D+ R  +   G+KLRG+FD+ LW+N
Sbjct  657  ENGTPAWHPSGTPMTALDIERNVI--VGDKLRGEFDDVLWMN  696



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   358 bits (919),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 210/237 (89%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS L    DDD ++IP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSG+KNLYIID
Sbjct  446  FDPSYL----DDDREDIPADVKILTREETGNNAFPSCSPDGKSVVFRSGRSGNKNLYIID  501

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGEL+GG IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FSIYV+RPDG+ L
Sbjct  502  AVNGELEGG-IRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFSIYVIRPDGSDL  560

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR++VAG+EGS +V+RER+NHVCFS+D EW+LF ANLGG+TAEP+S+PNQFQPYGDL+++
Sbjct  561  RRVYVAGSEGSVDVDRERINHVCFSADCEWLLFAANLGGMTAEPISLPNQFQPYGDLFVV  620

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLTWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDEPLWI+ + 
Sbjct  621  RLDGSGLKRLTWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDEPLWISCEL  677



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/237 (72%), Positives = 209/237 (88%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS L    DDD ++IP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSG+KNLYIID
Sbjct  446  FDPSYL----DDDREDIPADVKILTREETGNNAFPSCSPDGKSVVFRSGRSGNKNLYIID  501

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGEL+GG IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FSIYV+RPDG+ L
Sbjct  502  AVNGELEGG-IRQLTEGXWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFSIYVIRPDGSDL  560

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR++VAG+EGS +V+RER+NHVCFS+D EW+LF ANLGG TAEP+S+PNQFQPYGDL+++
Sbjct  561  RRVYVAGSEGSVDVDRERINHVCFSADCEWLLFAANLGGXTAEPISLPNQFQPYGDLFVV  620

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLTWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDEPLWI+ + 
Sbjct  621  RLDGSGLKRLTWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDEPLWISCEL  677



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 195/222 (88%), Gaps = 2/222 (1%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIP ++K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D++NGE +G  IRQLT
Sbjct  422  EIPCDVKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-IRQLT  480

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG EGS +V+
Sbjct  481  DGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEGSGDVD  540

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+RLTWNGY
Sbjct  541  RERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRLTWNGY  600

Query  198  ENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  76
            ENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  601  ENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  642



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 195/222 (88%), Gaps = 2/222 (1%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIP ++K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D++NGE +G  IRQLT
Sbjct  480  EIPCDVKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-IRQLT  538

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG EGS +V+
Sbjct  539  DGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEGSGDVD  598

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+RLTWNGY
Sbjct  599  RERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRLTWNGY  658

Query  198  ENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  76
            ENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  659  ENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  700



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   357 bits (915),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 195/222 (88%), Gaps = 2/222 (1%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIP ++K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D++NGE +G  IRQLT
Sbjct  480  EIPCDVKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-IRQLT  538

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG EGS +V+
Sbjct  539  DGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEGSGDVD  598

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+RLTWNGY
Sbjct  599  RERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRLTWNGY  658

Query  198  ENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  76
            ENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  659  ENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  700



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   349 bits (895),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 194/223 (87%), Gaps = 8/223 (4%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIPV+IKVLT E TGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID++NGE++GG IRQLT
Sbjct  436  EIPVDIKVLTGEETGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDAVNGEMEGGEIRQLT  495

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +GAWIDTMP+WSPDGKLIAFSSN HNP + +CFSIYVV PDG+GLRRI+VAG EGSEEV+
Sbjct  496  NGAWIDTMPNWSPDGKLIAFSSNMHNPDDINCFSIYVVHPDGSGLRRIYVAGPEGSEEVD  555

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            +ERLNHVCFS DSEW+LFT NL GVTAEPVS+PNQFQPYGDLY+++LDG+GL+RLT NGY
Sbjct  556  KERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPNQFQPYGDLYVVKLDGSGLRRLTCNGY  615

Query  198  ENGTPAWHPKAEVDLARLSLGKS------GEKLRGKFDEPLWI  88
            ENGTPAWH  +       + G++      GEKL+G+FD+ LW+
Sbjct  616  ENGTPAWH--SSTMPMETTTGETERNVLVGEKLKGEFDDVLWM  656



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 201/239 (84%), Gaps = 11/239 (5%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+++DD D    EIPVEIK+LTKE TGNNAFP CSPDGK +VFRSGRSGHKNLYI+D
Sbjct  424  FDPSHMSDDRD----EIPVEIKILTKEETGNNAFPCCSPDGKSVVFRSGRSGHKNLYIMD  479

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGEL+GG +RQLTDG WIDTMPSWSPDGKLIAFSSNRHNP N   F IY+V P+G G+
Sbjct  480  AVNGELEGGMVRQLTDGNWIDTMPSWSPDGKLIAFSSNRHNPENEGAFGIYLVEPNGKGV  539

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+ VA  E  EE  RERLNHVCFS+D EW+LFT+NLGGVTAEPVSIPNQFQPYGD+Y++
Sbjct  540  RRVQVAVIE--EE--RERLNHVCFSADGEWLLFTSNLGGVTAEPVSIPNQFQPYGDMYLV  595

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL--GKSGE-KLRGKFDEPLWINSDF  76
            RLDG+GLQRLTWNGYENGTPAWHP   + L+ LSL   K GE KL+G+FDEPLWI  D 
Sbjct  596  RLDGSGLQRLTWNGYENGTPAWHPTPGLSLSALSLEGNKDGEDKLKGQFDEPLWILCDL  654



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   348 bits (892),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 199/237 (84%), Gaps = 5/237 (2%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+LT D +    E+P ++K+LT E TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D
Sbjct  420  FDPSDLTADKE----ELPCDVKILTLENTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIVD  475

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N D F  YVVRPDG+GL
Sbjct  476  AVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPANIDAFGAYVVRPDGSGL  535

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI ++G EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQPYGDLY++
Sbjct  536  RRILISGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQPYGDLYVV  595

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  76
            +LDGTGL+RLTWNGYE+GTP WH   E+DL+R+SL G+ G+KL G+F+EPLWI+ D 
Sbjct  596  KLDGTGLRRLTWNGYEDGTPTWHTADELDLSRMSLNGQDGDKLDGQFEEPLWISCDI  652



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 202/249 (81%), Gaps = 5/249 (2%)
 Frame = -3

Query  822  SPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFR  643
            SP++   +     FDPS+LT D +    ++P ++K+LT E TGNNAFPSCSPDGK IVFR
Sbjct  412  SPARIAVQIARIKFDPSDLTADKE----DLPCDVKILTLENTGNNAFPSCSPDGKSIVFR  467

Query  642  SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  463
            SGRSGHKNLYI+D++NGE +GGGIR+LTDG WIDTMP WSP G LI FSSNRHNP N   
Sbjct  468  SGRSGHKNLYIVDAVNGESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAV  527

Query  462  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            F  YVVRPDGTGLRRI ++G EGSEE  RER+NHV F+ D +W++F ANL GVTAEPV++
Sbjct  528  FGAYVVRPDGTGLRRIQISGPEGSEEAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTM  587

Query  282  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKF  106
            PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL++L+L G+ G+KL G+F
Sbjct  588  PNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQF  647

Query  105  DEPLWINSD  79
            +EPLWI+ D
Sbjct  648  EEPLWISCD  656



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 202/249 (81%), Gaps = 5/249 (2%)
 Frame = -3

Query  822  SPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFR  643
            SP++   +     FDPS+LT D +    ++P ++K+LT E TGNNAFPSCSPDGK IVFR
Sbjct  407  SPARIAVQIARIKFDPSDLTADKE----DLPCDVKILTLENTGNNAFPSCSPDGKSIVFR  462

Query  642  SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  463
            SGRSGHKNLYI+D++NGE +GGGIR+LTDG WIDTMP WSP G LI FSSNRHNP N   
Sbjct  463  SGRSGHKNLYIVDAVNGESNGGGIRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAV  522

Query  462  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            F  YVVRPDGTGLRRI ++G EGSEE  RER+NHV F+ D +W++F ANL GVTAEPV++
Sbjct  523  FGAYVVRPDGTGLRRIQISGPEGSEEAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTM  582

Query  282  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKF  106
            PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL++L+L G+ G+KL G+F
Sbjct  583  PNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQF  642

Query  105  DEPLWINSD  79
            +EPLWI+ D
Sbjct  643  EEPLWISCD  651



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   349 bits (895),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 203/240 (85%), Gaps = 10/240 (4%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP+NLT D D    EIPV+IK+LT E TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D
Sbjct  483  FDPANLTADRDA---EIPVDIKILTNEDTGNNAFPSCSPDGKFIVFRSGRSGHKNLYIVD  539

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +GG IR+LTDG WIDTMPSWSPDGK IAFSSN HNP + + FSIYV+  DG+GL
Sbjct  540  AVNGEFNGGSIRRLTDGPWIDTMPSWSPDGKWIAFSSNMHNPDDVEHFSIYVIGADGSGL  599

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI +AG EGS  ++RERLNHVC+S+D EW+LFTANLGGVTAEPVS+PNQFQPYGDLYM+
Sbjct  600  RRIRIAGNEGSGRLDRERLNHVCWSADCEWLLFTANLGGVTAEPVSLPNQFQPYGDLYMV  659

Query  243  RLDGTGLQRLTWNGYENGTPAWHPK---AEVDLARL-SLGKS---GEKLRGKFDEPLWIN  85
            R+DGTGL+RLTWNGYENGTPAW+P     E+D+ RL +L +S   G+KL+G F EPLW++
Sbjct  660  RVDGTGLRRLTWNGYENGTPAWYPTGGDVELDMGRLMNLKRSETVGDKLKGDFIEPLWLH  719



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   346 bits (888),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 193/225 (86%), Gaps = 12/225 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIPVEIKVLT E TGNNAFPSCSPDGKH+VFRSGRSG+KNLYIID +NGE++GG +RQLT
Sbjct  438  EIPVEIKVLTGEETGNNAFPSCSPDGKHLVFRSGRSGYKNLYIIDGVNGEMEGGEVRQLT  497

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +GAWIDTMP+WSPDGKLIAFSSNRHNP + + FSIYVV PDG+GLRRI+VAG EGSEEV+
Sbjct  498  NGAWIDTMPNWSPDGKLIAFSSNRHNPNDINRFSIYVVHPDGSGLRRIYVAGPEGSEEVD  557

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            +ERLNHVCFS DSEW+LFT NL GVTAEPVS+PNQFQPYGDLY+++LDG+GL+RLT NGY
Sbjct  558  KERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPNQFQPYGDLYVVKLDGSGLRRLTCNGY  617

Query  198  ENGTPAWHPKA--------EVDLARLSLGKSGEKLRGKFDEPLWI  88
            ENGTPAWHP          E + + L     GEKL+G+FD+ LW+
Sbjct  618  ENGTPAWHPSTMPMETTAGETERSVL----VGEKLKGEFDDLLWM  658



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = -3

Query  822  SPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFR  643
            SP+    +     FDPS+LT D +    E+P ++K+LT + TGNNAFPSCSPDGK IVFR
Sbjct  405  SPASMAVQIARIKFDPSDLTADKE----ELPCDVKILTLDNTGNNAFPSCSPDGKSIVFR  460

Query  642  SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  463
            SGRSGHKNLYI+D++NGE DGG IR+LT+G WIDTMP WSP G LI FSSNRHNP +   
Sbjct  461  SGRSGHKNLYIVDAVNGESDGGEIRRLTEGEWIDTMPCWSPKGDLIGFSSNRHNPADTSA  520

Query  462  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV++
Sbjct  521  FGAYVVRPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAM  580

Query  282  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKF  106
            PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   E+DL+RLSL G+ G+KL G+F
Sbjct  581  PNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDELDLSRLSLNGQDGDKLEGQF  640

Query  105  DEPLWINSDF  76
            +EPLWI+ D 
Sbjct  641  EEPLWISCDI  650



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 197/237 (83%), Gaps = 7/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+LT D +    E+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLY++D
Sbjct  371  FDPSDLTADKE----ELPCEVKYLTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYVVD  426

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE DG  IR+LTDG WIDTMP WSP G LI FSSNRHNP N + F +YVVRPDG+GL
Sbjct  427  AVNGESDG--IRRLTDGPWIDTMPCWSPKGDLIGFSSNRHNPANTEAFGVYVVRPDGSGL  484

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI VAG EGSEE  RER+NHV F+ D +W++FTANLGGV AEPV++PNQFQPYG+LY++
Sbjct  485  RRIQVAGPEGSEEAARERVNHVSFNKDGDWLVFTANLGGVMAEPVAMPNQFQPYGELYVV  544

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  76
            +LDGTGL+RLTWNGYENGTP WH   +VDL++LSL G+ G+KL G+F+EPLWI+ D 
Sbjct  545  KLDGTGLRRLTWNGYENGTPTWHTVDDVDLSQLSLNGQDGDKLEGQFEEPLWISCDI  601



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   347 bits (889),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 197/237 (83%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+   D +    EIP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D
Sbjct  472  FDPSDFNGDLE----EIPCDVKMLTREDTGNNAFPSCSPDGKSLVFRSGRSGHKNLYILD  527

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +GG IR+LTDG WIDTMPSWSP G LIAFSSN HNP   D FSIYV++PDG+ L
Sbjct  528  AVNGEFNGG-IRKLTDGPWIDTMPSWSPSGDLIAFSSNMHNPDRVDAFSIYVIKPDGSDL  586

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI VAG  GS +V+RER+NHVCFS D EW+LF  N+GGVT EPVS PNQFQPYGDLY++
Sbjct  587  RRIFVAGPRGSSDVDRERINHVCFSQDGEWLLFATNIGGVTVEPVSWPNQFQPYGDLYVV  646

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLTWNG+ENGTPAWHP +E+D+ RL LG ++G KL+G F+EPLWI  DF
Sbjct  647  RLDGSGLRRLTWNGFENGTPAWHPWSELDMGRLCLGNEAGVKLKGDFEEPLWITCDF  703



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   344 bits (883),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 192/223 (86%), Gaps = 5/223 (2%)
 Frame = -3

Query  735  IPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  556
            +  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR+GHKNLY +D++NGE  GGGIRQLTD
Sbjct  436  VKCDVKVLTREDTGNNAFPSCSPDGKWLVFRSGRTGHKNLYAVDAVNGEF-GGGIRQLTD  494

Query  555  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            G WIDTMPSWSP+G LIAFSSNRHNP N + FSIY+++PDG+GLRR+HVAG EGS EV+R
Sbjct  495  GPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSIYLIKPDGSGLRRVHVAGPEGSPEVDR  554

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
            ER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GLQRLTWNG+E
Sbjct  555  ERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLQRLTWNGFE  614

Query  195  NGTPAWHPKAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  79
            NGTPAWH   +V  + L  G S    G+KLRG+F+EPLWI+ D
Sbjct  615  NGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQFEEPLWISCD  657



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   344 bits (883),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 201/250 (80%), Gaps = 5/250 (2%)
 Frame = -3

Query  822  SPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFR  643
            SP+    +     FDPS+LT D +    E+P ++K+LT + TGNNAFPSCSPDGK +VFR
Sbjct  406  SPASMAVQIARIKFDPSDLTADKE----ELPCDVKILTLDNTGNNAFPSCSPDGKSVVFR  461

Query  642  SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  463
            SGRSGHKNLYI+D++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   
Sbjct  462  SGRSGHKNLYILDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAA  521

Query  462  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANL G+TAEPV+I
Sbjct  522  FGAYVVRPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLCGITAEPVAI  581

Query  282  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKF  106
            PNQFQPYGDLY++++DGTGL+RLTWNGYE+GTP WH   E+DL RLSL G+ G+KL G+F
Sbjct  582  PNQFQPYGDLYIVKVDGTGLRRLTWNGYEDGTPTWHTVDELDLTRLSLNGQDGDKLGGQF  641

Query  105  DEPLWINSDF  76
            +EPLWI+ D 
Sbjct  642  EEPLWISCDI  651



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   345 bits (885),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 192/223 (86%), Gaps = 5/223 (2%)
 Frame = -3

Query  735  IPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  556
            +  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR+GHKNLY +D++NGE  GGGIRQLTD
Sbjct  480  VKCDVKVLTREDTGNNAFPSCSPDGKWLVFRSGRTGHKNLYAVDAVNGEF-GGGIRQLTD  538

Query  555  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            G WIDTMPSWSP+G LIAFSSNRHNP N + FSIY+++PDG+GLRR+HVAG EGS EV+R
Sbjct  539  GPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSIYLIKPDGSGLRRVHVAGPEGSPEVDR  598

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
            ER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GLQRLTWNG+E
Sbjct  599  ERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLQRLTWNGFE  658

Query  195  NGTPAWHPKAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  79
            NGTPAWH   +V  + L  G S    G+KLRG+F+EPLWI+ D
Sbjct  659  NGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQFEEPLWISCD  701



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   343 bits (881),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 164/250 (66%), Positives = 200/250 (80%), Gaps = 5/250 (2%)
 Frame = -3

Query  822  SPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFR  643
            SP+    +     FDPS+LT D +    E+P ++K+LT   TGNNAFPSCSPDGK IVFR
Sbjct  406  SPASMAVQIARIKFDPSDLTADKE----ELPCDVKILTLANTGNNAFPSCSPDGKSIVFR  461

Query  642  SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  463
            SGRSGHKNLYIID++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   
Sbjct  462  SGRSGHKNLYIIDAVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAA  521

Query  462  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ + +W++FTANL G+TAEPV+I
Sbjct  522  FGAYVVRPDGSGLRRIQIAGPEGSEEAARERVNHVSFNKEGDWIVFTANLCGITAEPVAI  581

Query  282  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKF  106
            PNQFQPYGDLY++++DGTGL+RLTWNGYE+GTP WH   E+DL +LSL G+ G+KL G+F
Sbjct  582  PNQFQPYGDLYVVKVDGTGLRRLTWNGYEDGTPTWHTVDELDLTQLSLNGQDGDKLEGQF  641

Query  105  DEPLWINSDF  76
            +EPLWI+ D 
Sbjct  642  EEPLWISCDI  651



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   343 bits (880),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 192/224 (86%), Gaps = 5/224 (2%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            +IP E+K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D+++GE +GG IRQLT
Sbjct  492  DIPAEVKILTKEETGNNAFPSCSPDGKFVVFRSGRSGHKNLYIMDAVDGEFNGG-IRQLT  550

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMP+WSPDGKLI FSSNRHNP N + FSIY++RPDGT LRR++VAG EGS E  
Sbjct  551  DGPWIDTMPNWSPDGKLIVFSSNRHNPSNVEAFSIYLIRPDGTDLRRVYVAGVEGSAEAE  610

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS DS W++FTANLGGV  EPVS+PNQFQPYGDLY++RLDG+GL+RLTWNGY
Sbjct  611  RERINHVCFSPDSLWLVFTANLGGVLTEPVSMPNQFQPYGDLYVVRLDGSGLKRLTWNGY  670

Query  198  ENGTPAWHP---KAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  79
            ENGTP W+    + ++D+ RLS+    G++L G+FDEPLWI+ D
Sbjct  671  ENGTPTWNSTTGEMDMDMDRLSVETVVGDRLMGQFDEPLWISCD  714



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   340 bits (872),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 195/236 (83%), Gaps = 6/236 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            F PS+L  D +    E+  ++K+LT+E TGNNAFPSCSPDG+ +VFRSGRSGHKNLYIID
Sbjct  435  FKPSDLKSDHN----EVSCDVKILTREDTGNNAFPSCSPDGESLVFRSGRSGHKNLYIID  490

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++ GE +GG IRQLT+G WIDTMPSWSP G LIAFSSNRHNP N + FSIYV+RPDG+GL
Sbjct  491  AVEGEFNGG-IRQLTEGPWIDTMPSWSPKGDLIAFSSNRHNPNNVNAFSIYVIRPDGSGL  549

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            +RIHVAG+EGS E  R R+NHVCFS D EW+LFT NLG VTAEPVS PNQFQPYGDL++ 
Sbjct  550  KRIHVAGSEGSSEGERGRINHVCFSRDGEWLLFTGNLGSVTAEPVSWPNQFQPYGDLHVT  609

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGE-KLRGKFDEPLWINSD  79
            RLDG+GL RLTWNG+ENGTPAWHP++E++L  L L +  E KL G+FD+PLWIN D
Sbjct  610  RLDGSGLSRLTWNGFENGTPAWHPRSELELDSLCLDEDVEDKLTGQFDDPLWINCD  665



>ref|XP_012082970.1| PREDICTED: uncharacterized protein LOC105642677 [Jatropha curcas]
 gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   341 bits (874),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/237 (72%), Positives = 195/237 (82%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+L  D +    EIP E+K+LT+E TGNNAFPSCSPDGK IVFRSGRSGHKNLYIID
Sbjct  472  FDPSHLNGDRE----EIPSEVKILTREDTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIID  527

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++ GE +G  +RQLT+GAWIDTMPSWSP G LIAFSSNRHNP N   FSIYV++PDG+ L
Sbjct  528  TVYGEFNGT-VRQLTNGAWIDTMPSWSPKGDLIAFSSNRHNPDNPAVFSIYVIKPDGSDL  586

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRIHVAGAEGS EV RER+NHVCFS D EW+LF +NL  VTAEPVS  NQFQPYGDL+++
Sbjct  587  RRIHVAGAEGSSEVVRERINHVCFSKDGEWLLFASNLDSVTAEPVSWANQFQPYGDLHVV  646

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLT NGYENGTPAW    E+DL RLSL K  G+KL G+FDEPLWI+ D 
Sbjct  647  RLDGSGLRRLTCNGYENGTPAWFSGNELDLDRLSLDKQVGDKLTGQFDEPLWISCDL  703



>gb|KCW58167.1| hypothetical protein EUGRSUZ_H008852, partial [Eucalyptus grandis]
Length=276

 Score =   327 bits (838),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 187/225 (83%), Gaps = 5/225 (2%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            ++  ++KVLT+E TGNNAFP+CSPDGK +VFRSGR+GHKNL+I+D+ NGE DGG IRQLT
Sbjct  53   DVACDVKVLTREDTGNNAFPACSPDGKWLVFRSGRTGHKNLFIVDAANGEFDGG-IRQLT  111

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMPSWSP+  LIAFSSNRHN G+A  FSIY++RPDG+ LRR+H+AG EGS EV+
Sbjct  112  DGPWIDTMPSWSPNNDLIAFSSNRHNSGDASTFSIYLIRPDGSDLRRVHLAGPEGSPEVD  171

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY+ RLDG+GL+RLTWNG+
Sbjct  172  RERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVARLDGSGLKRLTWNGF  231

Query  198  ENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKFDEPLWINSDF  76
            ENGTPAWH    V L    +    G   +KLRG+F+EPLWI+ + 
Sbjct  232  ENGTPAWHSTHAVGLGDPWSATGEGWDEDKLRGQFEEPLWISCNI  276



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   338 bits (867),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 195/237 (82%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP NL  D +    EIP E+K LT E TGNNAFPSCSPDGK +VFRSGRSG+KNLYI+D
Sbjct  415  FDPVNLVADKE----EIPCEVKFLTLENTGNNAFPSCSPDGKSVVFRSGRSGYKNLYILD  470

Query  603  SLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTG  427
            ++NGE +GG GIR+LT+G WIDTMP WSP G LI FSSNRHNP N + F  YVVRPDG+G
Sbjct  471  AVNGESNGGDGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPTNTEAFGAYVVRPDGSG  530

Query  426  LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            LRRI +AG EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY+
Sbjct  531  LRRIEIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVTIPNQFQPYGDLYV  590

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  79
            +++DGTGL+RLTWNGYE+GTP WH   ++DL+ LSL G+ G+KL G+F+EPLWI  D
Sbjct  591  VKVDGTGLKRLTWNGYEDGTPTWHSVDDLDLSGLSLNGQDGDKLEGQFEEPLWITCD  647



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 200/250 (80%), Gaps = 8/250 (3%)
 Frame = -3

Query  819  PSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRS  640
            P+K   +     FDPS+LTDD +    EIP E+K+LT+E TGNNAFPSCSPDGK +VFRS
Sbjct  406  PAKTAVQIARIKFDPSDLTDDKE----EIPCEVKILTEEDTGNNAFPSCSPDGKSVVFRS  461

Query  639  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  460
            GRS HKNLYI+D++ GE   GGIR+LT+G WIDTMP WSP G LIAFSSNRHN GN + F
Sbjct  462  GRSSHKNLYIVDAIAGE--SGGIRRLTEGPWIDTMPCWSPKGDLIAFSSNRHNQGNTEGF  519

Query  459  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP  280
              YVVRPDG+G+RRI VAG EGSEE  RER+NH+ FS D EW++FTANLGGVT EPV++P
Sbjct  520  GAYVVRPDGSGVRRIKVAGTEGSEEAERERINHLSFSKDGEWLVFTANLGGVTVEPVAVP  579

Query  279  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH-PKAEVDLARLSL-GKSGEKLRGKF  106
            NQFQPYG++Y++R+DGTGL+RLTWNGYE+GTP WH    E+DL RLSL G+ G+KL G+ 
Sbjct  580  NQFQPYGEVYVVRVDGTGLRRLTWNGYEDGTPTWHTADDELDLTRLSLDGQDGDKLTGQI  639

Query  105  DEPLWINSDF  76
            DEPLWI+ D 
Sbjct  640  DEPLWISCDL  649



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   337 bits (865),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 187/222 (84%), Gaps = 3/222 (1%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E+  E+K+LTK+ TGNNAFP+CSPDGK +VFRSGRSGHKNLYI+D++ GE +G  +R+LT
Sbjct  427  EVSSEVKILTKDDTGNNAFPACSPDGKFLVFRSGRSGHKNLYIVDAVKGEFEGE-LRRLT  485

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DGAWIDTMP+WSP G LI FSSN HNP N + FSIYV+RPDG+GLRR++VAG EGS EV+
Sbjct  486  DGAWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFSIYVIRPDGSGLRRVYVAGPEGSSEVD  545

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D +W+LFTANL GVTAEPVS PNQFQPYGDL+++RLDGTGL RLTWNGY
Sbjct  546  RERINHVCFSRDGKWLLFTANLSGVTAEPVSWPNQFQPYGDLFVVRLDGTGLSRLTWNGY  605

Query  198  ENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSD  79
            ENGTP W+  +EV L+ LSL     GEKL+G FDEPLWI  D
Sbjct  606  ENGTPTWYYGSEVALSGLSLKDEVVGEKLKGNFDEPLWITFD  647



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   336 bits (862),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 188/237 (79%), Gaps = 5/237 (2%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP++L        +E+  E+KVLT+   GNNAF +CSPDG+++VFRSGRSGHKNLYI+D
Sbjct  422  FDPADL---DGSRDEEVKTEMKVLTRADAGNNAFAACSPDGRYLVFRSGRSGHKNLYIVD  478

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++ GE  GGG+R+LT+G WIDTMP WSPDG+LIAFSSNRH+P N D F IY+VRPDGTGL
Sbjct  479  AVEGETSGGGVRRLTEGEWIDTMPVWSPDGELIAFSSNRHDPSNPDVFGIYLVRPDGTGL  538

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+HVAG  GS EV RERLNHVCFS DS W++F ANLG VTAEPVS+PN FQPYGDLY  
Sbjct  539  RRVHVAGPPGSAEVGRERLNHVCFSPDSRWLVFAANLGAVTAEPVSLPNHFQPYGDLYAC  598

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEV-DLARLSLGKS-GEKLRGKFDEPLWINSD  79
            RLDGTGL RLT+N YENGTP WH   +V  L  LSLG   GEKLRG+FDEPLWI  D
Sbjct  599  RLDGTGLTRLTYNCYENGTPTWHSGGDVPSLGSLSLGPHVGEKLRGQFDEPLWITFD  655



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 195/238 (82%), Gaps = 7/238 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP++LTDD +    E+PV +K+LT+   GNNAFP+CSPDGK +VFRSGRSG KNLYI+D
Sbjct  422  FDPNDLTDDRE----EVPVAVKILTRSDAGNNAFPACSPDGKSLVFRSGRSGQKNLYILD  477

Query  603  SLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTG  427
            ++NGE DGG GIRQLT+G W DTMP+WSPDG+LIAFSSNRH P N D FSIY++RPDGTG
Sbjct  478  AVNGESDGGEGIRQLTEGKWTDTMPTWSPDGELIAFSSNRHAPSNPDVFSIYLIRPDGTG  537

Query  426  LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            LRR+HVAG  GS  V+RER+NHVCFS DS+W+LFTANLG VT+EPVS PNQFQPYGDLY+
Sbjct  538  LRRVHVAGPAGSSYVDRERINHVCFSPDSKWLLFTANLGSVTSEPVSWPNQFQPYGDLYV  597

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSD  79
             RLDGTGL+RLT   YENGTPAW  +    DL  LSL   +G+KLRG+FDEPLWI  D
Sbjct  598  CRLDGTGLRRLTCGSYENGTPAWSSRGGPDDLGSLSLRSPTGDKLRGQFDEPLWITCD  655



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 189/224 (84%), Gaps = 5/224 (2%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            ++  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR+GHKNL+I+D+ NGE DGG IRQLT
Sbjct  425  DVACDVKVLTREDTGNNAFPSCSPDGKWLVFRSGRTGHKNLFIVDAANGEFDGG-IRQLT  483

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMPSWSP+  LIAFSSNRHNPG+A  FSIY++RPDG+ LRR+H+AG EGS EV+
Sbjct  484  DGPWIDTMPSWSPNNDLIAFSSNRHNPGDASTFSIYLIRPDGSDLRRVHLAGPEGSPEVD  543

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GL+RLTWNG+
Sbjct  544  RERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLKRLTWNGF  603

Query  198  ENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKFDEPLWINSD  79
            ENGTPAWH    V L    +    G   +KLRG+F+EPLWI+ D
Sbjct  604  ENGTPAWHSMHAVGLGDPWSATGEGWDEDKLRGQFEEPLWISCD  647



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   335 bits (858),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 188/226 (83%), Gaps = 6/226 (3%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            +I  ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE DGG +RQLT
Sbjct  436  DITCDVKILTREETGNNAFPSCSPDGKSLVFRSGRSGHKNLYILDAVNGEFDGGSLRQLT  495

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMP WSP G LIAFSSNRHNP + + F+IYV+  DG+ LRRI++AG EGS + +
Sbjct  496  DGPWIDTMPCWSPKGDLIAFSSNRHNPDDVNAFNIYVITSDGSELRRIYLAGPEGSGDAD  555

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D EW+LFTANLGGVTAEPV+ PNQFQPYGDLYM+RLDG+GL+RLTWNGY
Sbjct  556  RERINHVCFSEDGEWLLFTANLGGVTAEPVTWPNQFQPYGDLYMVRLDGSGLRRLTWNGY  615

Query  198  ENGTPAWHP--KAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  79
            ENGTPAW    + +VD+  LSL       GE+LRG+FDEPLWI  D
Sbjct  616  ENGTPAWKNFGRDDVDMGPLSLAGDDRLVGEELRGQFDEPLWITCD  661



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   334 bits (856),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 197/238 (83%), Gaps = 12/238 (5%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+L  D +    +IP  +K+LT+E TGNNAF SCSPDGK +VFRSGR+G+KNLY++D
Sbjct  456  FDPSDLNGDKE----DIPCTVKILTREDTGNNAFASCSPDGKSLVFRSGRTGNKNLYVVD  511

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +GG I +LT+G  IDTMPSWSP G LIAFSSNRH P +A  FSIYV++PDG+GL
Sbjct  512  AVNGEFNGG-IHRLTEGPCIDTMPSWSPKGDLIAFSSNRHKPEDAAVFSIYVIKPDGSGL  570

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRIHVAG    ++V+RER+NHVCFS+D EW+LFTANLGGVTAEPVS PNQFQPYGDLY M
Sbjct  571  RRIHVAG----DDVDRERINHVCFSNDGEWLLFTANLGGVTAEPVSFPNQFQPYGDLYTM  626

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKFDEPLWINSD  79
            RLDG+GL RLTWNGYENGTP WH   +VDL RL LG++   G+KL+G+FDEPLWI+ D
Sbjct  627  RLDGSGLTRLTWNGYENGTPTWHTGDDVDLGRLRLGEACEVGDKLKGQFDEPLWISCD  684



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   334 bits (856),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 193/237 (81%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            F+PS L  D      EIP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D
Sbjct  478  FEPSYLNSDLQ----EIPCDVKILTREDTGNNAFPSCSPDGKSLVFRSGRSGHKNLYILD  533

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE + G IR+LT G WIDTMPSWSP+G LIAFSSN HNP N D FSIYV++PDG+ L
Sbjct  534  AVNGEFNDG-IRKLTAGPWIDTMPSWSPNGDLIAFSSNMHNPNNVDAFSIYVIKPDGSDL  592

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI+ AG +GS +V+ ER+NHVCFS + EW++F AN+GGVTAEPVS PNQFQPYGDLY+M
Sbjct  593  RRIYAAGPKGSSDVDMERINHVCFSPNGEWLVFAANIGGVTAEPVSFPNQFQPYGDLYVM  652

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLT +GYENGTP WH   E+D+ RL LG  +G +L G FDEPLWI SDF
Sbjct  653  RLDGSGLRRLTCDGYENGTPTWHFGGELDMRRLCLGNDAGVELTGGFDEPLWITSDF  709



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 195/237 (82%), Gaps = 6/237 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            F PS+L DD D    E+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D
Sbjct  417  FSPSDLIDDRD----EVPCEVKFLTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYILD  472

Query  603  SLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTG  427
            ++NGE +GG GIR+LT+GAWIDTMP WSP G LI FSSNRH+P N   F  YVVRPDG+G
Sbjct  473  AVNGESEGGEGIRRLTEGAWIDTMPCWSPKGDLIGFSSNRHDPSNDAAFGAYVVRPDGSG  532

Query  426  LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            LRRI +AG EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY+
Sbjct  533  LRRIEIAGPEGSEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVAIPNQFQPYGDLYV  592

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  79
            ++LDGTGL+RLTWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+EPLWI  D
Sbjct  593  VKLDGTGLRRLTWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFEEPLWITCD  649



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 198/249 (80%), Gaps = 6/249 (2%)
 Frame = -3

Query  819  PSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRS  640
            P++   +     F PS+L DD D    E+P E+K LT + TGNNAFPSCSPDGK +VFRS
Sbjct  405  PARIAVQIARIQFSPSDLIDDRD----EVPCEVKFLTLDNTGNNAFPSCSPDGKSVVFRS  460

Query  639  GRSGHKNLYIIDSLNGELDGG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADC  463
            GRSGHKNLYI+D++NGE +GG GIR+LT+G WIDTMP WSP G LI FSSNRH+P N   
Sbjct  461  GRSGHKNLYILDAVNGESEGGEGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHDPSNDAA  520

Query  462  FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            F  YVVRPDG+GLRRI +AG EGSEE  RER+NHV F+ D +W++FTANLGG+TAEPV+I
Sbjct  521  FGAYVVRPDGSGLRRIEIAGPEGSEEAARERVNHVSFNKDGDWIVFTANLGGITAEPVAI  580

Query  282  PNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKF  106
            PNQFQPYGDLY+++LDGTGL+RLTWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F
Sbjct  581  PNQFQPYGDLYVVKLDGTGLRRLTWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQF  640

Query  105  DEPLWINSD  79
            +EPLWI  D
Sbjct  641  EEPLWITCD  649



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   330 bits (847),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 185/222 (83%), Gaps = 3/222 (1%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E+  E+K+LTK+ TGNNAFP+CSPDGK +VFRSGR+GHKNLYI+D++ GE +G  +RQLT
Sbjct  422  EVSNEVKILTKDNTGNNAFPACSPDGKFLVFRSGRTGHKNLYIVDAMKGEFEGE-LRQLT  480

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMP+WSP G LI FSSN HNP N + FSIYV+RPDG+GLRR++VAG EGS EV+
Sbjct  481  DGPWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFSIYVIRPDGSGLRRVYVAGPEGSSEVD  540

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D  W+LFTANL GVTAEPVS+PNQFQPYGDL+++RLDGTGL+RLT N Y
Sbjct  541  RERINHVCFSRDGNWLLFTANLSGVTAEPVSLPNQFQPYGDLFVVRLDGTGLRRLTCNAY  600

Query  198  ENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSD  79
            ENGTP W+  +E+ L+ LSL     GEKL+G FDEPLWI  D
Sbjct  601  ENGTPTWYYGSELALSGLSLKDEVVGEKLKGDFDEPLWIKFD  642



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/261 (66%), Positives = 206/261 (79%), Gaps = 19/261 (7%)
 Frame = -3

Query  831  LYSSPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHI  652
            ++ SP   +  + V+ FDP +L++D D    +IPV+IK+LTKE TGNN FPSCSPDGK +
Sbjct  409  IFQSPRASVQIARVT-FDPEHLSNDRD----KIPVDIKILTKEETGNNGFPSCSPDGKSV  463

Query  651  VFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN  472
            VFRSGRSGHKNLYI+D++ GE++GG IRQLT+G WIDTMPSWSP+G+LIAFSSNRHNP N
Sbjct  464  VFRSGRSGHKNLYIVDAIKGEVEGG-IRQLTEGPWIDTMPSWSPNGELIAFSSNRHNPDN  522

Query  471  ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEP  292
             D F IY+++PDGTGLRR+ VA  E  EE  RERLNHVCFS D EW+LF ANLGGVT EP
Sbjct  523  VDAFGIYLIKPDGTGLRRVKVA--EFEEE--RERLNHVCFSGDGEWLLFAANLGGVTVEP  578

Query  291  VSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK------AEVDLARLSLGKS  130
            V++PN FQPYGDLY++RLDG+GL+RLTWNGYENGTPAWHP        E+ L  LSLG  
Sbjct  579  VALPNHFQPYGDLYLVRLDGSGLRRLTWNGYENGTPAWHPNRVLGGAEELKLCGLSLGGG  638

Query  129  G---EKLRGKFDEPLWINSDF  76
                E+L+G+FDEPLWI  DF
Sbjct  639  KKGEEELKGQFDEPLWIKCDF  659



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 195/239 (82%), Gaps = 12/239 (5%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            F+PS+L    D D +EIP  +K+LTKE TGNNAFPSCSPDGK +VFRSGR+GHKNLYIID
Sbjct  432  FNPSDL----DGDKEEIPCNVKILTKEDTGNNAFPSCSPDGKSLVFRSGRTGHKNLYIID  487

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +G   R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F IYV++PDG+GL
Sbjct  488  AVNGEFNGDA-RRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFGIYVIKPDGSGL  546

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+H AG    ++V RER+NHVCFS D EW+LFTANLGGVTAEPVS+PNQFQPYGDLY++
Sbjct  547  RRVHAAG----DDVERERINHVCFSKDGEWLLFTANLGGVTAEPVSLPNQFQPYGDLYVV  602

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAE-VDLARLSLGKS--GEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLTWNGYENGTPAW    E VD+ RL L     G+KL+G+F+EPLWI+ DF
Sbjct  603  RLDGSGLRRLTWNGYENGTPAWLEGDEVVDMGRLRLENEVGGDKLKGRFEEPLWISCDF  661



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   323 bits (829),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 193/238 (81%), Gaps = 7/238 (3%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+LTDD +     +PV +K+LT+   GNNAFP+CSPDGK +VFRSGRSGHKNLYI+D
Sbjct  422  FDPSDLTDDREV----VPVAVKILTRSDAGNNAFPACSPDGKSLVFRSGRSGHKNLYILD  477

Query  603  SLNGELDG-GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTG  427
            ++NGE DG  GIR+LT+G W DTMP WSPDG+LIAFSSNRH P + D FSIY++RPDGTG
Sbjct  478  AVNGESDGREGIRRLTEGEWTDTMPCWSPDGELIAFSSNRHAPTSPDVFSIYLIRPDGTG  537

Query  426  LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            LRR+HVAG  GS  V++ER+NHVCFS DS+W+LFTANLG VTAEPVS PN FQPYGDL++
Sbjct  538  LRRVHVAGPAGSCYVDKERVNHVCFSQDSKWLLFTANLGSVTAEPVSWPNHFQPYGDLFL  597

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSD  79
             RLDGTGL+RLT + YENGTPAW  +    DL  LSL   +G+KL+G+FDEPLWI  D
Sbjct  598  CRLDGTGLRRLTCDPYENGTPAWSSRGGPDDLETLSLRSPTGDKLQGQFDEPLWITCD  655



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   325 bits (832),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 194/239 (81%), Gaps = 12/239 (5%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            F+PS+L    D D +EIP  +K+LTKE TGNNAFPSCSPDGK +VFRSGR+GHKNLYIID
Sbjct  483  FNPSDL----DGDKEEIPCNVKILTKEDTGNNAFPSCSPDGKSLVFRSGRTGHKNLYIID  538

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +G   R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F IYV++PDG+GL
Sbjct  539  AVNGEFNGDA-RRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFGIYVIKPDGSGL  597

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR++ AG    ++V RER+NHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDLY++
Sbjct  598  RRVYAAG----DDVERERINHVCFSKDGEWLLFTANLGGVIAEPVSLPNQFQPYGDLYVV  653

Query  243  RLDGTGLQRLTWNGYENGTPAW-HPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSDF  76
            RLDG+GL+RLTWNGYENGTPAW     EVD+ RL L     G+KL+G+F+EPLWI+ DF
Sbjct  654  RLDGSGLRRLTWNGYENGTPAWLEGDEEVDMGRLRLDNEVGGDKLKGQFEEPLWISCDF  712



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   311 bits (797),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 181/224 (81%), Gaps = 8/224 (4%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            ++P  +K LT E TGNNAFPSCSPDG  +VFRSGR+GHKNLYIID+++GE +G  +RQLT
Sbjct  443  DVPCNVKXLTXEETGNNAFPSCSPDGMSLVFRSGRTGHKNLYIIDAVDGEFNGS-VRQLT  501

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +G  IDTMPSWSP G LIAFSSNRHNP +A  F IYVV+PDGTGLRRI VAG E     +
Sbjct  502  EGPCIDTMPSWSPKGDLIAFSSNRHNPDDAAVFGIYVVKPDGTGLRRIPVAGNES----H  557

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D EW+LFTANL GV AEPVS+PNQFQPYGDLY++R DG+GL+RLTWNGY
Sbjct  558  RERINHVCFSKDXEWLLFTANLSGVIAEPVSLPNQFQPYGDLYVVRXDGSGLRRLTWNGY  617

Query  198  ENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKFDEPLWINSDF  76
            ENGTPAWH    E+D+  L LG    G++L+G+F++P WI+ DF
Sbjct  618  ENGTPAWHEGGDELDMGGLRLGNEVGGDELKGQFEDPHWISCDF  661



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   311 bits (798),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 182/224 (81%), Gaps = 8/224 (4%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            ++P  +K+LTKE TGNNAFPSCSPDG  +VFRSGR+GHKNLYIID+++GE +   +RQLT
Sbjct  497  DVPCNVKMLTKEETGNNAFPSCSPDGMSLVFRSGRTGHKNLYIIDAVDGEFNDS-VRQLT  555

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +G  IDTMPSWSP G LI FSSNRHNP +A  F IYVV+PDGT LRRI VAG E     +
Sbjct  556  EGPCIDTMPSWSPKGDLIVFSSNRHNPDDAAVFGIYVVKPDGTDLRRIPVAGNES----H  611

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RER+NHVCFS D EW+LFTANL GVTAEPVS PNQFQPYG+LY++RLDG+GL+RLTWNGY
Sbjct  612  RERINHVCFSKDGEWLLFTANLSGVTAEPVSWPNQFQPYGELYVVRLDGSGLRRLTWNGY  671

Query  198  ENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKFDEPLWINSDF  76
            ENGTPAWH    E+D+  L LG    G++L+G+F+EPLWI+ DF
Sbjct  672  ENGTPAWHEGGDELDMGGLRLGNEVGGDELKGRFEEPLWISCDF  715



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   308 bits (788),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 194/256 (76%), Gaps = 9/256 (4%)
 Frame = -3

Query  831  LYSSPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHI  652
            ++ SP K   R     FDP+ L    D+++D++ V +KVLT+   GN+AFP+ SP G+ +
Sbjct  422  IFESP-KATVRIARVEFDPAQL---RDNNNDKVDVALKVLTRPEAGNDAFPAVSPCGRWV  477

Query  651  VFRSGRSGHKNLYIIDSLNGELDGGG--IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP  478
            VFRSGRSGHKNLYIID+ +GE +     I++LTDG WIDTMP W+PDGKL+AFSSNRH+P
Sbjct  478  VFRSGRSGHKNLYIIDAAHGENEPATAPIQRLTDGEWIDTMPCWAPDGKLVAFSSNRHDP  537

Query  477  GNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTA  298
            GNA  FSIY+VRPDGTGLRR+HVAG  GSEE ++ER+NHVCFS D EW+LFTANLGGV A
Sbjct  538  GNAAVFSIYLVRPDGTGLRRVHVAGPPGSEEADKERINHVCFSPDGEWLLFTANLGGVNA  597

Query  297  EPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLG---KSG  127
            EPVS PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P  +++    SLG    + 
Sbjct  598  EPVSGPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPALDLEDGVGSLGLGNPAA  657

Query  126  EKLRGKFDEPLWINSD  79
            E   G+FDEPLW+  D
Sbjct  658  EDSLGEFDEPLWLTCD  673



>ref|XP_010456117.1| PREDICTED: uncharacterized protein LOC104737601 [Camelina sativa]
Length=426

 Score =   300 bits (769),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 168/199 (84%), Gaps = 4/199 (2%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+LT D +    E+P ++K+LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D
Sbjct  221  FDPSDLTADKE----ELPCDVKILTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYILD  276

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +GGGIR+LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GL
Sbjct  277  AVNGESNGGGIRRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGL  336

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI +AG EGSEE  RER+NHV F+ D +W +FTANL G+TAEPV+IPNQFQPYGDLY++
Sbjct  337  RRIQIAGLEGSEEAARERVNHVSFNKDGDWTVFTANLCGITAEPVAIPNQFQPYGDLYVV  396

Query  243  RLDGTGLQRLTWNGYENGT  187
            ++DGTGL+RLTWNGYE+GT
Sbjct  397  KVDGTGLRRLTWNGYEDGT  415



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 179/230 (78%), Gaps = 19/230 (8%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V+IK++TK+ TGNNAFP+CSPDGK +VFRSGRSGHKNLYI+D++ GE D   IRQLT+G 
Sbjct  446  VKIKIMTKQDTGNNAFPACSPDGKLVVFRSGRSGHKNLYIMDAVEGE-DSNNIRQLTNGP  504

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            WIDTMPSWSPDGKLIAFSSNRH+P N   F IY+V  DG+ L+R+HV+      +V  ER
Sbjct  505  WIDTMPSWSPDGKLIAFSSNRHDPSNMVTFGIYLVAVDGSDLKRVHVS------DVAMER  558

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
            +NHVCFS + EW+LFTAN+GGVTAEPVS PNQFQPYGDL++ +LDGTGL+RLTW+GYENG
Sbjct  559  INHVCFSPNGEWLLFTANMGGVTAEPVSFPNQFQPYGDLFIAKLDGTGLRRLTWSGYENG  618

Query  189  TPAWHPKAEVDLARLSLGKSG------------EKLRGKFDEPLWINSDF  76
            TPAWH +  +D+   +L   G            +KL+GKFDEPLWI  DF
Sbjct  619  TPAWHSRQLLDIPLGNLSLEGIEKADAHHQVDADKLKGKFDEPLWITCDF  668



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 184/252 (73%), Gaps = 10/252 (4%)
 Frame = -3

Query  816  SKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  637
            +K   R     FD   LT   D    E+   +KVLT+   GN+AFP+ SP GK +VFRSG
Sbjct  411  TKATVRIARLEFDAGELTTGRD----EVAATLKVLTRPEAGNDAFPAVSPCGKWVVFRSG  466

Query  636  RSGHKNLYIIDSLNGELDGGG---IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD  466
            RSGHKNLYI+D+ +GE  G G   IR+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA 
Sbjct  467  RSGHKNLYIVDAAHGEDVGAGEGTIRRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAA  526

Query  465  CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVS  286
             FSIY+VRPDG+GLRR+HVAG  GS   +RER+NHVCFS DS W+LFTAN GGV AEP+S
Sbjct  527  VFSIYLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPIS  586

Query  285  IPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLR  115
             PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  LSLG  +G++  
Sbjct  587  APNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESLSLGPGAGDESL  646

Query  114  GKFDEPLWINSD  79
            G+FDEPLW+  D
Sbjct  647  GEFDEPLWLTCD  658



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 193/253 (76%), Gaps = 6/253 (2%)
 Frame = -3

Query  831  LYSSPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHI  652
            ++ +P K   R     FDP++LTDDG  +  E+   ++ LT+   GN+AFP+ SP G+ +
Sbjct  418  IFETP-KATVRIARVEFDPADLTDDGRGEG-EVRATVRPLTRPEAGNDAFPAVSPCGRWL  475

Query  651  VFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN  472
            VFRSGR+GHKNLY++D+  GE   GG+R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N
Sbjct  476  VFRSGRTGHKNLYVVDTARGEE--GGVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPAN  533

Query  471  ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEP  292
               FSIY+VRPDG+GLRR++VAGAEGS E ++ER+NHVCFS DS+W+LFTANLG V AEP
Sbjct  534  PAVFSIYLVRPDGSGLRRVYVAGAEGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEP  593

Query  291  VSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKL  118
            +S PNQFQPYGDLY+ RLDG+ L+RLT N YENGTP W P  A + L  LS+G  SGE  
Sbjct  594  ISGPNQFQPYGDLYVCRLDGSDLRRLTCNAYENGTPVWGPASAGLGLESLSMGPPSGEDA  653

Query  117  RGKFDEPLWINSD  79
             G+FDEPLW+  D
Sbjct  654  LGQFDEPLWLTCD  666



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   303 bits (777),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 183/252 (73%), Gaps = 10/252 (4%)
 Frame = -3

Query  816  SKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  637
            +K   R     FD   LT   D    E+   +KVLT+   GN+AFP+ SP GK +VFRSG
Sbjct  411  TKATVRIARLEFDAGELTTGRD----EVAATLKVLTRPEAGNDAFPAVSPCGKWVVFRSG  466

Query  636  RSGHKNLYIIDSLNGELDGGG---IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD  466
            RSGHKNLYI+D+ +GE  G G   IR+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA 
Sbjct  467  RSGHKNLYIVDAAHGEDVGAGEGTIRRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAA  526

Query  465  CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVS  286
             FSIY+VRPDG+GLRR+HVAG  GS   +RER+NHVCFS DS W+LFTAN GGV AEP+S
Sbjct  527  VFSIYLVRPDGSGLRRVHVAGPAGSAAADRERINHVCFSPDSRWLLFTANFGGVMAEPIS  586

Query  285  IPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLR  115
             PNQFQPYGDLY+ RLDG+GL RLT N YENGTPAW P +     L  LSL   +G++  
Sbjct  587  APNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTPAWGPASSPAAGLESLSLVPGAGDESL  646

Query  114  GKFDEPLWINSD  79
            G+FDEPLW+  D
Sbjct  647  GEFDEPLWLTCD  658



>ref|XP_006840287.1| PREDICTED: uncharacterized protein LOC18430060 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 178/233 (76%), Gaps = 13/233 (6%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FD +NL     D  ++I  +IK+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D
Sbjct  420  FDLTNL-----DSQEDITAKIKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLYIMD  474

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            + NGE   GGIRQLT+G WIDTMPSWSPDGK IAFSSNRH+P N + F IYV+ PDGTGL
Sbjct  475  ATNGE--DGGIRQLTEGPWIDTMPSWSPDGKFIAFSSNRHSPENTEVFGIYVIHPDGTGL  532

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+HVA     E+++  R NHVCFS DS+W+LFTAN G V+AEP+S+PNQFQPYGDLY+ 
Sbjct  533  RRVHVA-----EDMDMVRTNHVCFSPDSKWLLFTANFGAVSAEPISLPNQFQPYGDLYVC  587

Query  243  RLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLGKSGEKLRGKFDEPLWI  88
             L+GT L+RLT N YENGTPAWH      D+  L L   GE L+G F EP W+
Sbjct  588  GLEGTHLKRLTCNAYENGTPAWHSGDGGPDIGSLCLNDVGEDLKGDFGEPHWL  640



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   300 bits (769),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 186/252 (74%), Gaps = 11/252 (4%)
 Frame = -3

Query  831  LYSSPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHI  652
            ++ +P K   R     FDPS LTDD      ++ V +K LT+   GN+AFP+ SP G+ +
Sbjct  412  IFETP-KATVRVARIEFDPSELTDDRG----DVDVAVKELTRPEAGNDAFPAVSPCGRWV  466

Query  651  VFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN  472
            VFRSGRSGHKNLYI+D+  GE     IR++TDG WIDTMPSWSPDG+LIAFSSNRH P N
Sbjct  467  VFRSGRSGHKNLYIVDAARGEET---IRRVTDGEWIDTMPSWSPDGELIAFSSNRHEPAN  523

Query  471  ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEP  292
            A  FSIY+VRPDGTGLRR+HVAG  GS E ++ER+NHVCFS D +W+LFTANLGGV AEP
Sbjct  524  AAVFSIYLVRPDGTGLRRVHVAGPAGSAEADKERINHVCFSPDGQWLLFTANLGGVMAEP  583

Query  291  VSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLR  115
            +S PNQFQPYGDLY+ RLDG+G+ RLT N YENGTP W P   VD   LSLG  + +   
Sbjct  584  ISGPNQFQPYGDLYVCRLDGSGVLRLTCNAYENGTPTWGPALGVD--SLSLGAPAADDSL  641

Query  114  GKFDEPLWINSD  79
            G+FDEPLW+  +
Sbjct  642  GQFDEPLWLTCN  653



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   300 bits (769),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 187/248 (75%), Gaps = 5/248 (2%)
 Frame = -3

Query  816  SKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSG  637
            +K   R     FDP++LTDD       +   ++ LT+   GN+AFP+ SP G+ +VFRSG
Sbjct  424  TKATVRIARVEFDPADLTDDDSRVEVGV-ATVRPLTRPEAGNDAFPAVSPCGRWLVFRSG  482

Query  636  RSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFS  457
            R+GHKNLY++D+  GE   GG+ +LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FS
Sbjct  483  RTGHKNLYVVDTARGE--DGGVLRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFS  540

Query  456  IYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPN  277
            IY+VRPDG+GLRR++VAG EGS E ++ER+NHVCFS DS+W+LFTANLG V AEP+S PN
Sbjct  541  IYLVRPDGSGLRRVYVAGPEGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPN  600

Query  276  QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFD  103
            QFQPYGDLY+ RLDG+GL+RLT N YENGTPAW P  A + L  L++G  +GE   G+FD
Sbjct  601  QFQPYGDLYVCRLDGSGLRRLTCNAYENGTPAWGPASAGLGLESLAIGPPAGEDALGQFD  660

Query  102  EPLWINSD  79
            EPLW+  D
Sbjct  661  EPLWLTCD  668



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   301 bits (771),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 187/243 (77%), Gaps = 20/243 (8%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP +LT+D +    E+P ++ +LT+E TGNNAFPSCSPDGK IVFRSGR G+KNLYI+D
Sbjct  473  FDPVHLTNDRE----EVPFKLTILTREDTGNNAFPSCSPDGKSIVFRSGREGYKNLYIVD  528

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++ GE DGG IR+LT+G WIDTMP WSP G LIAFSSNRH+P N++ F IY+V P+G+GL
Sbjct  529  AVKGEFDGG-IRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDPKNSEVFGIYLVGPNGSGL  587

Query  423  RRIHVA-GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            RR+ VA G EG     +ERLNHVCFS D EW+LFTANLGGV+AEPV +PNQFQPYGDLY+
Sbjct  588  RRVEVAKGVEGM----KERLNHVCFSRDGEWLLFTANLGGVSAEPVGLPNQFQPYGDLYV  643

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSL-------GKSGEKLRGKFDEPLWI  88
            +RLDG+GL+RLT N YENGTP WH     DLA  +        G+  +KL+G+F EPLWI
Sbjct  644  VRLDGSGLRRLTCNAYENGTPTWH---HGDLALCAPREDDGEGGQDWDKLKGEFQEPLWI  700

Query  87   NSD  79
              D
Sbjct  701  TCD  703



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   300 bits (767),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 180/235 (77%), Gaps = 9/235 (4%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP +L     +D +EIP  I +LT+E TGNNAFPSCSPDGK +VFRSGRSG+KNLYI+D
Sbjct  427  FDPVHL----REDCEEIPFTINILTREETGNNAFPSCSPDGKFVVFRSGRSGYKNLYIMD  482

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            +L+GE +GG +R+LT+G WIDTMP WSP G  IAFSSNRH+ GN++ F IYVVRPDG+ L
Sbjct  483  ALDGEFNGG-LRRLTEGEWIDTMPCWSPKGDWIAFSSNRHDAGNSEVFGIYVVRPDGSDL  541

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+ V      E   RERLNHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDL+++
Sbjct  542  RRVEVGKGVDGE---RERLNHVCFSGDGEWLLFTANLGGVMAEPVSMPNQFQPYGDLFVV  598

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  79
            RLDG+GL+RLT N YENGTP WH +    L R   G   + L+G F+EPLWI  +
Sbjct  599  RLDGSGLKRLTCNAYENGTPMWHAREGAALLRSGKGDE-DVLKGGFEEPLWITCE  652



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 184/239 (77%), Gaps = 14/239 (6%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP + TDD +    E+P ++ +LT+E TGNNAFP+CSPDGK +VFRSGRSGHKNLYI+D
Sbjct  458  FDPVHFTDDRE----EVPFKLTILTREETGNNAFPACSPDGKSVVFRSGRSGHKNLYIVD  513

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
             + GE +GG IR+LT+GAWIDTMP WSP G LIAFSSNRH P N++ F IY+VRPDG+GL
Sbjct  514  GVEGEFNGG-IRRLTEGAWIDTMPCWSPKGDLIAFSSNRHEPKNSEVFGIYLVRPDGSGL  572

Query  423  RRIHVA-GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            RR+ VA G EG     RERLNHV FS D EW++FTANLGGVTAEP+ +PNQFQPYGDLY+
Sbjct  573  RRVEVAMGVEGG----RERLNHVSFSGDGEWLVFTANLGGVTAEPIGLPNQFQPYGDLYV  628

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGE---KLRGKFDEPLWINSD  79
            +R+DG+GL+RLT N YENGTP WH   ++ L  +     GE   KL+ +F EPLWI  D
Sbjct  629  VRVDGSGLRRLTCNAYENGTPTWH-NGDLVLCHVDGDGEGENWDKLKAEFAEPLWITCD  686



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   298 bits (764),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 185/252 (73%), Gaps = 11/252 (4%)
 Frame = -3

Query  831  LYSSPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHI  652
            ++ +P K   R     FDPS LTDD      ++ V +K LT+   GN+AFP+ SP G+ +
Sbjct  412  IFETP-KATVRVARIEFDPSGLTDDRG----DVDVAVKELTRPEAGNDAFPAVSPCGRWV  466

Query  651  VFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGN  472
            VFRSGRSGHKNLYI+D+  GE     IR++TDG WIDTMPSWSPDG+LIAFSSNRH P N
Sbjct  467  VFRSGRSGHKNLYIVDAARGEET---IRRVTDGEWIDTMPSWSPDGELIAFSSNRHEPAN  523

Query  471  ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEP  292
            A  FSIY+VRPDGTGLRR+HVAG  GS E ++ER+NHVCFS D +W+LFTA LGGV AEP
Sbjct  524  AAVFSIYLVRPDGTGLRRVHVAGPAGSAEADKERINHVCFSPDGQWLLFTATLGGVMAEP  583

Query  291  VSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLR  115
            +S PNQFQPYGDLY+ RLDG+G+ RLT N YENGTP W P   VD   LSLG  + +   
Sbjct  584  ISGPNQFQPYGDLYVCRLDGSGVLRLTCNAYENGTPTWGPALGVD--SLSLGAPAADDSL  641

Query  114  GKFDEPLWINSD  79
            G+FDEPLW+  +
Sbjct  642  GQFDEPLWLTCN  653



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 189/256 (74%), Gaps = 9/256 (4%)
 Frame = -3

Query  831  LYSSPSKPLCRSLVSXFDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHI  652
            ++ +P K   R     FDPS LTDD  + S      ++ LT+   GN+AFP+ SP G+ +
Sbjct  414  IFETP-KATVRIARVEFDPSELTDDRKEVSA---ATVRALTRPEAGNDAFPAVSPCGRWL  469

Query  651  VFRSGRSGHKNLYIIDSLNGELDG---GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHN  481
            VFRSGR+GHKNLY+ID+  GE +      +R+LT+G WIDTMPSWSPDG LIAFSSNRH+
Sbjct  470  VFRSGRTGHKNLYVIDTARGEEEEGGGAAVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHD  529

Query  480  PGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVT  301
            P N   FSIY+VRPDG+ LRR++VAG EGS E ++ER+NHVCFS DS W+LFTANLGGV 
Sbjct  530  PANPAVFSIYLVRPDGSRLRRVYVAGPEGSAEADKERINHVCFSPDSRWLLFTANLGGVM  589

Query  300  AEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP-KAEVDLARLSLGK-SG  127
            AEPVS PNQFQPYGDLY+ RLDG+GLQRLT N YENGTPAW P  A + +  +SLG  +G
Sbjct  590  AEPVSGPNQFQPYGDLYVCRLDGSGLQRLTCNAYENGTPAWGPSSAGLGVEAMSLGAPAG  649

Query  126  EKLRGKFDEPLWINSD  79
            E   G+FDEPLW+  D
Sbjct  650  EDPMGQFDEPLWLTCD  665



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 172/221 (78%), Gaps = 16/221 (7%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            EIPV+IK LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D+L GE  GG IRQLT
Sbjct  428  EIPVDIKFLTKENTGNNAFPSCSPDGKSVVFRSGRSGHKNLFVVDALEGEF-GGDIRQLT  486

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            DG WIDTMP WSPDGKLIAFSSNRH       F IY++  DG+GLRR+  AG++  EE  
Sbjct  487  DGPWIDTMPCWSPDGKLIAFSSNRHT-SKEGAFGIYLINSDGSGLRRVKFAGSD--EE--  541

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
            RERLNHVCFS DSEW+LFT+N  GVTAEPVS+PN FQPYGDLY  RLDG+GL+RLT+NGY
Sbjct  542  RERLNHVCFSPDSEWLLFTSNFAGVTAEPVSLPNHFQPYGDLYTARLDGSGLRRLTFNGY  601

Query  198  ENGTPAWHPKAEVDLARLSLGK----SGEKLRGKFDEPLWI  88
            ENGTPAW      D   L + K      ++L G+F+EPLW+
Sbjct  602  ENGTPAW------DREFLQVSKRHAADEDELEGQFEEPLWL  636



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   286 bits (732),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 176/239 (74%), Gaps = 12/239 (5%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            F+P +L+ D +    EIP  +K+LTK  +GNNAFPSCSPDGK IVFRSGR+G KNLYI+D
Sbjct  419  FEPDHLSKDRE----EIPFTLKILTKYDSGNNAFPSCSPDGKFIVFRSGRTGFKNLYIVD  474

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE   GG+R+LT+G WIDTMP WSP G LIAFSSNRH+  N++ F IYVV  DG+G+
Sbjct  475  AVNGEEVDGGLRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDAKNSEVFGIYVVNVDGSGV  534

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+ +      E   RERLNHVCFS D EW+LFTANLGGV+AEPV +PNQFQPYGDL+++
Sbjct  535  RRVEIGKGVDGE---RERLNHVCFSGDGEWLLFTANLGGVSAEPVGLPNQFQPYGDLFVV  591

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLA----RLSLGKSGEKLRGKFDEPLWINSD  79
            +LDG+GL+RLT N YENGTP WH   E+ L             +KL+G F EPLWI  D
Sbjct  592  KLDGSGLRRLTCNAYENGTPTWH-HGELLLCNDGDEDGDNGDWDKLKGAFQEPLWITCD  649



>ref|XP_006840288.1| PREDICTED: uncharacterized protein LOC18430062 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   284 bits (726),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 179/241 (74%), Gaps = 16/241 (7%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP++L     D  DEI   +K+LTKE TGNNAFPSCSPDGK +VFRSGRSG+KNLYIID
Sbjct  420  FDPTHL-----DSKDEISTHVKILTKEGTGNNAFPSCSPDGKFLVFRSGRSGYKNLYIID  474

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            +++GE   G IR+LT+G WIDTMP WSPDGK IAFSSNR +P +   FS+Y+  PDGT L
Sbjct  475  AIDGE--DGSIRRLTEGPWIDTMPHWSPDGKYIAFSSNRESPKSTQGFSVYLTNPDGTDL  532

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
              +HV  A    E+ +ER+NHVCFS DS+++LFTANLG V AE +S+PNQFQPYGDLY+ 
Sbjct  533  HHVHVTAASAFNEMAKERINHVCFSPDSKFLLFTANLGAVNAEAISLPNQFQPYGDLYIC  592

Query  243  RLDGTGLQRLTWNGYENGTPAWH-----PKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  79
             LDG+GL+RLT N YE+GTPAW+     P+    L  +     GE+L+G+F+EPLW+ S 
Sbjct  593  GLDGSGLRRLTCNAYEDGTPAWNSGWWGPEPGSSLEDV----VGEELKGEFEEPLWLGST  648

Query  78   F  76
            F
Sbjct  649  F  649



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 175/237 (74%), Gaps = 17/237 (7%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDP +LTDD +    EIP  + +LT+  TGNNAFPSCSPDGK IVFRSGRSG    Y +D
Sbjct  422  FDPVHLTDDNE----EIPFTLTILTRNDTGNNAFPSCSPDGKSIVFRSGRSG----YTVD  473

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE +G  +R+LT+G WIDTMP WSP G +IAFSSN HNP N + F IYVV PDG GL
Sbjct  474  AVNGEFNGS-LRRLTEGNWIDTMPCWSPKGDVIAFSSNMHNPENGEGFGIYVVGPDGNGL  532

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RRI VA      E  RERLNHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDLY++
Sbjct  533  RRIEVAKGV---EAERERLNHVCFSGDGEWLLFTANLGGVQAEPVSLPNQFQPYGDLYVV  589

Query  243  RLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSG--EKLRGKFDEPLWINSD  79
            RLDG+GL+RLT N YENGTP WH +   DL   S    G  +K++G+F EPLWI  +
Sbjct  590  RLDGSGLRRLTCNSYENGTPTWHDR---DLVLCSGDGDGDRDKVKGEFQEPLWITCE  643



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 168/207 (81%), Gaps = 8/207 (4%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FDPS+L  D +    EIP ++K+LT E +GNNAFP+CSPDGK++VFRSGRSGHKNLYI+D
Sbjct  363  FDPSDLKPDRN----EIPCDVKMLTGEDSGNNAFPACSPDGKYLVFRSGRSGHKNLYIMD  418

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++ GE  G  IR LT+GA IDTMP WSP G LIAFSSNRH P +A+ FSIYV++PDG+GL
Sbjct  419  AVEGEFKGD-IRPLTEGACIDTMPCWSPKGDLIAFSSNRHKPEHANPFSIYVIKPDGSGL  477

Query  423  RRIHVAGAEGSEEVN---RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDL  253
            RRIH+ G+E   E      ER+NHV FSSD EW+LFTANLGG++AEPV++P Q QPYGD+
Sbjct  478  RRIHLEGSERLSEEEREWMERINHVTFSSDGEWLLFTANLGGLSAEPVAVPRQIQPYGDI  537

Query  252  YMMRLDGTGLQRLTWNGYENGTPAWHP  172
            Y+ RLDG+GL+RLTWNGYENGTP W+P
Sbjct  538  YVARLDGSGLRRLTWNGYENGTPVWYP  564



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   276 bits (707),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 175/242 (72%), Gaps = 16/242 (7%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID  604
            FD  +LT+D +    EIP  +K+LTK+ +GNNAFPSCSPDGK +VFRSGRSG KNLYI+D
Sbjct  421  FDSVHLTNDQE----EIPYTLKILTKDDSGNNAFPSCSPDGKFVVFRSGRSGFKNLYIVD  476

Query  603  SLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGL  424
            ++NGE DGG +R+LT+G WIDTMP WSP G LIAFSSNRH+ GN+  F IYVVR DG+GL
Sbjct  477  AVNGEFDGG-LRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDGGNSQAFGIYVVRVDGSGL  535

Query  423  RRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMM  244
            RR+ V      E   RE LNHV FS D EW+LFT NL G+TAEP SIPNQ+QPYGDL+++
Sbjct  536  RRVEVGKGVDGE---REMLNHVRFSGDGEWLLFTGNLVGLTAEPASIPNQYQPYGDLFVV  592

Query  243  RLDGTGLQRLTWNGYENGTPAWH--------PKAEVDLARLSLGKSGEKLRGKFDEPLWI  88
            +LDG+GL+RLT N YENGTPAWH           + D          +KL+G F+E LWI
Sbjct  593  KLDGSGLRRLTCNAYENGTPAWHYGDLLLSNDDDDDDDDDDGDACDWDKLKGAFEESLWI  652

Query  87   NS  82
             +
Sbjct  653  TT  654



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 154/214 (72%), Gaps = 12/214 (6%)
 Frame = -3

Query  723  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            +KVL+K  T NNAFPSCSPDGK++VFRSGRSGHKNLYI+D+  GE   GGIR LT+G W+
Sbjct  457  VKVLSKPGTNNNAFPSCSPDGKNLVFRSGRSGHKNLYIMDAELGE--DGGIRALTEGPWV  514

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  364
            DTMP WSPDG  IAFSS+R  P N + F+IY+V PDG+ L R+        E   R R N
Sbjct  515  DTMPCWSPDGNWIAFSSSRDGPSN-EFFAIYLVHPDGSELHRVF------PESSTRGRCN  567

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            HVCFS DS+ +LFTA+ GG++AEPVS+ NQFQPYG+L+  +LDG+ L+R T N YE+GTP
Sbjct  568  HVCFSPDSQTLLFTADCGGISAEPVSLANQFQPYGELFSCKLDGSELRRWTHNAYEDGTP  627

Query  183  AWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINS  82
             W P   + L   S+ K G++L   F + LW+++
Sbjct  628  CWGP---LRLDPSSISKQGQELHANFQDCLWLSA  658



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 148/215 (69%), Gaps = 13/215 (6%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V+ K+LTK  T NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GA
Sbjct  512  VKWKILTKSGTKNNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAIHGE--EASLRRLTEGA  569

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G       R
Sbjct  570  WTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------R  621

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
            +NH  FS DS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+G
Sbjct  622  VNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDG  681

Query  189  TPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            TP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  682  TPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 148/215 (69%), Gaps = 13/215 (6%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V+ K+LTK  T NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GA
Sbjct  512  VKWKILTKSGTKNNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAIHGE--EASLRRLTEGA  569

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G       R
Sbjct  570  WTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------R  621

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
            +NH  FS DS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+G
Sbjct  622  VNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDG  681

Query  189  TPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            TP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  682  TPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 152/218 (70%), Gaps = 15/218 (7%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K LTKE  GNNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  500  ESEISYKTLTKE--GNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGE--EGGLWQLT  555

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            +G W DTM +WSPDG+ IAF+S+R +PG+   F++Y + P+GTGL R+  +   G     
Sbjct  556  EGPWTDTMCNWSPDGEWIAFASDRDSPGSGG-FAMYFIHPNGTGLHRVLNSSTAG-----  609

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
              R+NH  FS DS+ ++FT++  GV+AEP+S+P+QFQPYG+++M R+DG+ LQRLT N Y
Sbjct  610  --RVNHPWFSPDSKSLVFTSDYAGVSAEPISVPHQFQPYGEIFMARVDGSELQRLTHNAY  667

Query  198  ENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            E+GTP+W     + +A   L   GE ++  FD+  W+ 
Sbjct  668  EDGTPSW---GRIFIAASDLTGEGESVKCDFDDDHWLQ  702



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 147/203 (72%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE +G  +++LT+G W DTM +WSPDG
Sbjct  478  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVHGEKNG--LKRLTEGPWSDTMCNWSPDG  535

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+RH+PG+   F IY++ PDGTGLR++  +G+ G       R NH  FS D + 
Sbjct  536  EWIAFASDRHDPGSG-SFEIYLIHPDGTGLRKLIHSGSGG-------RTNHPYFSPDGKS  587

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  588  MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  646

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
              + + K G      F++  W+N
Sbjct  647  VNVEMPKGGPYC--SFEDCHWLN  667



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score =   205 bits (521),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE  G  +R+LT+G W DTM +WSPDG
Sbjct  484  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVDGERKG--LRRLTEGPWTDTMCNWSPDG  541

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            K IAF+S+RH PG+   F++Y++  DG+GLR++  +G+ G       R NH  FS D + 
Sbjct  542  KWIAFASDRHAPGSG-SFALYLIEADGSGLRKVFESGSGG-------RTNHPYFSPDGKS  593

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G+QRLT N YE+GTPAW PK
Sbjct  594  LTFTSDYAGISAEPISNPHHYQPYGEIFSVRLDGSGIQRLTHNSYEDGTPAWSPK  648



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 138/186 (74%), Gaps = 11/186 (6%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGIR+LTDG 
Sbjct  482  VSIKKLTVGGE-NNAFPSPSPDGKWLVFRSGRSGHKNLYIMDAEEGE--AGGIRRLTDGP  538

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+ TGLRR+ V  A+G       R
Sbjct  539  WTDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNSTGLRRV-VHSADGG------R  590

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
             NH  FS DS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+GLQRLT N +E+G
Sbjct  591  TNHPWFSPDSKRMVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSGLQRLTHNSFEDG  650

Query  189  TPAWHP  172
            TP+W P
Sbjct  651  TPSWTP  656



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 139/186 (75%), Gaps = 11/186 (6%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G 
Sbjct  524  VSIKKLTLGGK-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTNGP  580

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM +WSPDG+ IAF+S+RHNPG    F+IY++ P+GTGLRR+ V  A+G       R
Sbjct  581  WSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYLIHPNGTGLRRL-VHSADGG------R  632

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
             NH  FS DS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+GLQRLT N +E+G
Sbjct  633  TNHPWFSPDSKSIVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSGLQRLTHNSFEDG  692

Query  189  TPAWHP  172
            TP+W P
Sbjct  693  TPSWTP  698



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 146/203 (72%), Gaps = 15/203 (7%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+G W DTM +WSPDG
Sbjct  516  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVDGE--KKELRRLTEGPWTDTMCNWSPDG  573

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+RH+PG+   F IY++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  574  EWIAFASDRHDPGSG-SFEIYLIHPNGTGLRKLIQSGSGG-------RTNHPYFSPDGKS  625

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G++RLT N YE+GTPAW PK    +
Sbjct  626  LTFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGIKRLTHNSYEDGTPAWSPKY---M  682

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
              +++ K G      FD+  W+N
Sbjct  683  PPVNVPKGGPYC--SFDDCHWLN  703



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 131/174 (75%), Gaps = 10/174 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D++ GE   GG+R+LT+G W DTM +WSPDG
Sbjct  501  NNAFPSPSPDGKWIVFRSGRTGHKNLYIMDAIEGE--AGGLRRLTEGPWTDTMCNWSPDG  558

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              IAF+S+R NPG+   F +Y++ P+GTGLRR+  +G+ G       R NH  FS D  +
Sbjct  559  DWIAFASDRDNPGSG-SFELYLIHPNGTGLRRLVKSGSAG-------RANHPSFSPDGTY  610

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            V+FT++  G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  611  VVFTSDFAGISAEPISNPHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGTPTWAP  664



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score =   201 bits (512),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 150/219 (68%), Gaps = 21/219 (10%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGIR+LT+G 
Sbjct  474  VSIKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIRRLTEGP  530

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+GTGLRR+ V  A+G       R
Sbjct  531  WSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNGTGLRRV-VHSADGG------R  582

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
             NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G++RLT N +E+G
Sbjct  583  TNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSGIRRLTHNSFEDG  642

Query  189  TPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  85
            TP+W P        L     GE L+      F++  W+N
Sbjct  643  TPSWTPY------HLKAEDVGETLQASGTCAFEDCHWLN  675



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 141/203 (69%), Gaps = 14/203 (7%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D++ GE     I +LTDG W DTM +WSPDG
Sbjct  502  NNAFPSPSPDGKRIVFRSGRSGHKNLYIMDAIEGETSW--IERLTDGPWTDTMCNWSPDG  559

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              IAFSS+RH+PG+   F +Y++ P+GTGLRR+  +G+ G       R+NH  F  D + 
Sbjct  560  DWIAFSSDRHDPGSG-SFELYMIHPNGTGLRRLLRSGSSG-------RVNHPSFRPDGKL  611

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT + GG++AEP+S P+ +QPYG+++ M+LDG+ L+RLT N YE+GTP W P   ++ 
Sbjct  612  LVFTTDYGGISAEPISNPHHYQPYGEIFTMKLDGSDLKRLTHNSYEDGTPTWAP-LYINP  670

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
              +   + GE     F++  W+N
Sbjct  671  VDVEWPRKGE---CAFEDCHWLN  690



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 148/216 (69%), Gaps = 22/216 (10%)
 Frame = -3

Query  708  KETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  535
            K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G W DTM
Sbjct  480  KLTTGSENNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTEGPWSDTM  537

Query  534  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  355
             +WSPDG+ IAFSS+RHNPG    F+IY++ P+GTGLRR+ V  A+G       R NH  
Sbjct  538  CNWSPDGEWIAFSSDRHNPGGG-SFAIYMIHPNGTGLRRV-VHSADGG------RTNHPW  589

Query  354  FSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  175
            FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DGTG++RLT N +E+GTP+W 
Sbjct  590  FSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGTGIRRLTHNSFEDGTPSWT  649

Query  174  PKAEVDLARLSLGKSGEKLRG----KFDEPLWINSD  79
            P        L     GE L+     KF +  W+  D
Sbjct  650  PY------YLEPEDVGETLQASGTCKFRDCHWLTVD  679



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score =   200 bits (509),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 132/174 (76%), Gaps = 10/174 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+L GE   GG+R+LT+G W DTM +WSPDG
Sbjct  484  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDALEGE--AGGLRRLTEGPWTDTMCNWSPDG  541

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FS D ++
Sbjct  542  EWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGMGG-------RTNHPYFSPDGKY  593

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  594  IVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  647



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   199 bits (507),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 145/218 (67%), Gaps = 18/218 (8%)
 Frame = -3

Query  726  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  553
            E     K T G  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+R+LT+G
Sbjct  481  ETGTYKKLTLGGENNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGE--KGGLRRLTEG  538

Query  552  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  373
             W DTM SWSPDG+ IAF+S+R NPG    F++Y++ P+GTGL ++  +G  G       
Sbjct  539  PWTDTMCSWSPDGEWIAFASDRDNPGGGG-FALYLIHPNGTGLMKVVHSGEGG-------  590

Query  372  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  193
            R NH  FS D   ++FT++  GV+AEP+S P+ +QPYG++++ R DG+G++RLT N YE+
Sbjct  591  RTNHPSFSPDGRSIVFTSDYVGVSAEPISNPHHYQPYGEIFIARSDGSGIKRLTHNSYED  650

Query  192  GTPAWHPK--AEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            GTPAW P      D+     G+ G      FD+  W+N
Sbjct  651  GTPAWGPTFMRPADVVESPFGEPG----CSFDDCHWLN  684



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score =   199 bits (506),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+  LT+GAW DTM +WSPDG
Sbjct  501  NNAFPWPSPDGKRIVFRSGRSGHKNLYLMDAEKGE--AGGLWSLTEGAWSDTMCTWSPDG  558

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R NH  FS DS+ 
Sbjct  559  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLIQSGSGG-------RTNHPIFSPDSKT  610

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  611  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPR  665



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score =   199 bits (506),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 136/207 (66%), Gaps = 12/207 (6%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            K LTKE TGNNAFP  SPDGK++VFRSGR+G KNLYI+D+  GE     +R+LT+G W D
Sbjct  479  KYLTKEGTGNNAFPCPSPDGKYVVFRSGRTGRKNLYIMDAAGGEEKY--LRRLTEGRWRD  536

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            TMP+WSPD + IAFSSNR +P     FS+Y++RP+GT L  +   G  G          H
Sbjct  537  TMPAWSPDNEWIAFSSNRAHPTGERSFSLYLIRPNGTDLHMLLDTGVGGLAM-------H  589

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ + FT+N  GV+AEP+S P+ +QPYG ++++ +DGTGL RLT N YE+GTP 
Sbjct  590  AVFSPDSKRIAFTSNWAGVSAEPISFPHAYQPYGTIFVINIDGTGLTRLTHNAYEDGTPT  649

Query  180  WHPKAEVDLARLSLGKSGEKLRGKFDE  100
            W     + L + ++   G +    FD+
Sbjct  650  W---GRLPLPKPAISSDGRRSSCDFDD  673



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 150/219 (68%), Gaps = 15/219 (7%)
 Frame = -3

Query  735  IPVEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL  562
            I V+  ++ K T    NNAFPS SPDGK IVFRSGRSGHKNLY++D++ GE    G+R+L
Sbjct  466  IDVDRNIVKKLTIDGKNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDAVEGE--KKGLRRL  523

Query  561  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  382
            T+G W DTM +WSPDG+ IAF+S+R +PG+   F +Y++ P+GTGL+++  +G+ G    
Sbjct  524  TEGPWTDTMCNWSPDGEWIAFASDRDDPGSG-SFELYLIHPNGTGLKKLIQSGSGG----  578

Query  381  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  202
               R NH  FS D + ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N 
Sbjct  579  ---RTNHPYFSPDGKSIVFTSDYSGISAEPISNPHAYQPYGEIFTVRLDGSGLTRLTHNS  635

Query  201  YENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            YE+GTPAW PK  +    +   K G      FD+  W+N
Sbjct  636  YEDGTPAWSPKY-IKPVNVERPKGGPYC--SFDDCHWLN  671



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 134/179 (75%), Gaps = 10/179 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N+AFPS SPDGK + FRSGRSGHKNLY++D+L GE   GG+ +LT+G W DTM +WSPDG
Sbjct  515  NDAFPSASPDGKWVAFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGPWSDTMCNWSPDG  572

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + I F+S+R NPG+   F +++V P+GTGL ++  +G+ G       R NH CFS D ++
Sbjct  573  EWILFASDRENPGSG-TFELFMVHPNGTGLHKLVQSGSGG-------RANHPCFSPDGKY  624

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVD  157
            V+FT++  GV+AEP+S P+ +QPYG++++++ DG+G++RLT N YE+GTPAW PK   D
Sbjct  625  VVFTSDYAGVSAEPISNPHHYQPYGEIFVIKSDGSGIRRLTHNSYEDGTPAWGPKYMKD  683



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D+LNGE   G + +LT+G W DTM +WSPDG
Sbjct  483  NNAFPSPSPDGKWIVFRSGRTGHKNLYIMDALNGE--AGWLYRLTEGQWTDTMCNWSPDG  540

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++ + P+GTGL+++  +G  G       R NH  FS D  +
Sbjct  541  EWIAFASDRENPGSG-SFELFKIHPNGTGLQKVIHSGVGG-------RTNHPWFSPDGNY  592

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++ T++  GV+AEP++ P+ +QPYGD++++R DG+G++RLT N YE+GTPAW PK  +  
Sbjct  593  IVLTSDYAGVSAEPIANPHHYQPYGDIFVIRADGSGIRRLTHNSYEDGTPAWSPKF-LSP  651

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
            A +     G K    FD+  W+N
Sbjct  652  ANVEWPNGGSKC--SFDDCHWLN  672



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK +VFRSGR+GHKNLYI+D+LNGE DG  + QLT+G W DTMP+WSP+G
Sbjct  508  NNAFPSPSPDGKRVVFRSGRTGHKNLYIMDALNGEKDG--LYQLTEGPWSDTMPNWSPNG  565

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++ + P+GTGL+++  +G+ G       R+NH  FS D + 
Sbjct  566  EWIAFASDRENPGSGG-FELFKIHPNGTGLQKVIQSGSGG-------RVNHPWFSPDGKH  617

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++ T++  GV+AEP+S P+ FQPYGD+++++ DG+ ++RLT N YE+GTP W PK+ +  
Sbjct  618  IVLTSDYAGVSAEPISNPHHFQPYGDIFVIKSDGSWIRRLTHNSYEDGTPTWIPKS-MKP  676

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
              +     G  L+  FD+  W+N
Sbjct  677  GNVEWPNGG--LKCSFDDCHWLN  697



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 132/172 (77%), Gaps = 10/172 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK +VFRSGRSGHKNLYI+D+L GE   GG+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSASPDGKWVVFRSGRSGHKNLYIMDALEGET--GGLSRLTEGPWSDTMCNWSPDG  569

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F +++V P+GTGL ++  +G+ G       R NH  FS DS++
Sbjct  570  EWIAFASDRENPGSG-SFELFMVHPNGTGLHKLIQSGSGG-------RTNHPWFSPDSKY  621

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            V+FT++  GV+AEP+S P+ +QPYGD+++++ DG+G++RLT N YE+GTP W
Sbjct  622  VVFTSDYAGVSAEPISNPHHYQPYGDIFVIKSDGSGIRRLTHNSYEDGTPTW  673



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 131/174 (75%), Gaps = 10/174 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+L GE+  GG+R LT+G W DTM +WSPD 
Sbjct  468  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDALEGEV--GGLRPLTEGPWTDTMCNWSPDD  525

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FS D ++
Sbjct  526  EWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGIGG-------RTNHPYFSPDGKY  577

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  578  IVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  631



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLYI+D+  GE   GG+ +LTDG W DTM +WSPDG
Sbjct  521  NNAFPWPSPDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGLFRLTDGPWTDTMCNWSPDG  578

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            +LIAF+S+R NPG+   F ++++ P+GTG+R++  +G+ G       R NH  FS D + 
Sbjct  579  ELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-------RTNHPIFSPDGQT  630

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N +E+GTPAW PK
Sbjct  631  IAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSDLRRLTHNSFEDGTPAWAPK  685



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 131/175 (75%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLYI+D+  GE   GG+ +LTDG W DTM +WSPDG
Sbjct  522  NNAFPWPSPDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGLFRLTDGPWTDTMCNWSPDG  579

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            +LIAF+S+R NPG+   F ++++ P+GTG+R++  +G+ G       R NH  FS D + 
Sbjct  580  ELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-------RTNHPIFSPDGQT  631

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N +E+GTPAW PK
Sbjct  632  IAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSDLRRLTHNSFEDGTPAWAPK  686



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE  GGG+ +LT+GAW DTM +WSP+G
Sbjct  509  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--GGGLWRLTEGAWTDTMCNWSPNG  566

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  567  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPVFSPDSKS  618

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  619  LVFTSDYAGISAEPISNPHSYQPYGDIFTVKLDGSNLKRLTHNSYEDGTPAWSPR  673



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R+NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  570  EWIAFASDRYNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 147/216 (68%), Gaps = 22/216 (10%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D++ GE    GI +LT+G W D
Sbjct  501  IKKLTTGGANNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAVEGE--SAGIHRLTEGPWSD  558

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            TM +WSPDG+ IAF+S+R NPG    F+IY+V P+GTGLRR+  +G+ G       R NH
Sbjct  559  TMCNWSPDGEWIAFASDRDNPGGG-SFAIYMVHPNGTGLRRVVHSGSGG-------RTNH  610

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ ++FT++ G V+AEP+S P+ +QPYG+++ + +DG+ ++RLT N +E+GTP 
Sbjct  611  PWFSPDSKSLVFTSDYGAVSAEPISNPHHYQPYGEIFTVGIDGSDIRRLTHNSFEDGTPT  670

Query  180  WHPKAEVDLARLSLGKSGEKLRG----KFDEPLWIN  85
            W P        L      E L+G    +FD+  W+N
Sbjct  671  WTPYF------LEPADVAESLQGSAWCEFDDCHWLN  700



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 144/203 (71%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+  GE+  GGIR+LT+G W DTM +WSPDG
Sbjct  510  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAEEGEI--GGIRRLTEGPWSDTMCNWSPDG  567

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAFSS+R NPG+   F I+++ P+GTGL ++  +G  G       R NH  FS D + 
Sbjct  568  EWIAFSSDRENPGSG-SFEIFMMHPNGTGLHKVIQSGIGG-------RANHPWFSPDGKS  619

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++ GGV+AEP+S P+ +QPYG++++ ++DG+ ++RLT N YE+GTP W P   + L
Sbjct  620  IVFTSDYGGVSAEPISNPHHYQPYGEIFIAKVDGSDIRRLTHNSYEDGTPTWGP---MFL  676

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
            + + + +   + +  F +  W+N
Sbjct  677  SPIDVAEPTSEPKCLFQDCHWLN  699



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 136/183 (74%), Gaps = 12/183 (7%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K T G  NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W D
Sbjct  473  MKKLTVGGENNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSD  530

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            TM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH
Sbjct  531  TMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-------RTNH  582

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+
Sbjct  583  PWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLTHNSFEDGTPS  642

Query  180  WHP  172
            W P
Sbjct  643  WTP  645



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  506  NNAFPWPSPDGKLIVFRSGRTGHKNLYIMDAEKGER--GGLWRLTEGAWTDTMCNWSPDG  563

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++++ P+GTGL+++  +G  G       R NH  FS DS+ 
Sbjct  564  EWIAFASDRENPGSG-SFELFLIHPNGTGLKKLIQSGTGG-------RTNHPVFSPDSKS  615

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++  G++AEP+S P+ FQPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  616  LVFTSDYAGISAEPISNPHHFQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  670



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 136/183 (74%), Gaps = 12/183 (7%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K T G  NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G W D
Sbjct  473  MKKLTVGGENNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEGPWSD  530

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            TM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G       R NH
Sbjct  531  TMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-------RTNH  582

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+GTP+
Sbjct  583  PWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLTHNSFEDGTPS  642

Query  180  WHP  172
            W P
Sbjct  643  WTP  645



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score =   196 bits (499),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 147/219 (67%), Gaps = 21/219 (10%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE    GIR+LT+G 
Sbjct  475  VSIKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--ASGIRRLTEGP  531

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM +WSPDG+ IAF+S+RHNPG    F IY+V P+GTGLRR+ V   +G       R
Sbjct  532  WSDTMCNWSPDGEWIAFASDRHNPGGG-SFGIYMVHPNGTGLRRV-VHSTDGG------R  583

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
             NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G++RLT N +E+G
Sbjct  584  TNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSGIRRLTHNSFEDG  643

Query  189  TPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  85
            TP+W P        L     GE L+      F++  W+N
Sbjct  644  TPSWTPH------YLKPEDVGETLQASGTCAFEDCHWLN  676



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score =   196 bits (499),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 144/203 (71%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP+ SPDGK IVFRSGRSG+KNLYI+D++ GE   GG+ +LT+G W DTM SWS DG
Sbjct  498  NNAFPAVSPDGKWIVFRSGRSGYKNLYIMDAVEGE--KGGLYRLTEGPWGDTMCSWSIDG  555

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+A  F ++++ P+GTGL+R+  +G  G       R NH  FS D + 
Sbjct  556  EWIAFASDRENPGSA-SFELFLIHPNGTGLKRLVKSGLGG-------RTNHPYFSPDGKS  607

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT + GG++AEP+S P+ FQPYG++Y ++LDG+ L+RLT N +E+GTPAW P A ++ 
Sbjct  608  IVFTTDYGGISAEPISNPHHFQPYGEIYTVKLDGSDLKRLTHNSFEDGTPAWGP-AYIEP  666

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
              L   K G +    FD+  W++
Sbjct  667  VDLEWPKYGPQC--SFDDCHWLS  687



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score =   196 bits (499),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  504  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDG  561

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  562  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  613

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  614  LVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPR  668



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score =   196 bits (497),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  465  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  522

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  523  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  574

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ 
Sbjct  575  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INP  633

Query  153  ARLSLGKSGEKLRGKFDEPLWINSD  79
            + + L K  +     F++  W+N +
Sbjct  634  SDVVLRKKNDS-SCAFEDCHWLNKN  657



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  466  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  523

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  524  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  575

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ 
Sbjct  576  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INP  634

Query  153  ARLSLGKSGEKLRGKFDEPLWINSD  79
            + + L K  +     F++  W+N +
Sbjct  635  SDVVLRKKNDS-SCAFEDCHWLNKN  658



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 145/205 (71%), Gaps = 12/205 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  503  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  560

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  561  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  612

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  +D 
Sbjct  613  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-IDP  671

Query  153  ARLSLGKSGEKLRGKFDEPLWINSD  79
              + L +  +     F++  W+N +
Sbjct  672  NDVVLRRKNDS-SCAFEDCHWLNKN  695



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FS D   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNS  608

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            + FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
                +   G   +  F+E  W+N
Sbjct  666  KPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FS D   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNS  608

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            + FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
                +   G   +  F+E  W+N
Sbjct  666  KPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  570  EWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  570  EWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 134/190 (71%), Gaps = 12/190 (6%)
 Frame = -3

Query  729  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  556
            V+     K TTG  NNAFPS SPDGK I FRSGRSG+KNLYI+D+++GE   GGI +LT+
Sbjct  489  VDQPSYKKLTTGGENNAFPSPSPDGKWIAFRSGRSGYKNLYIMDAVDGER--GGIHRLTE  546

Query  555  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+ G      
Sbjct  547  GPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGSAG------  599

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
             R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE
Sbjct  600  -RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYE  658

Query  195  NGTPAWHPKA  166
            +GTPAW PK 
Sbjct  659  DGTPAWAPKV  668



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+ +LT+GAW DTM SWSPDG
Sbjct  503  NNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGLWKLTEGAWTDTMCSWSPDG  560

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  561  EWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  612

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+  ++ 
Sbjct  613  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWAPRF-INP  671

Query  153  ARLSLGKSGEKLRGKFDEPLWINSD  79
            + + L K  +     F++  W+N +
Sbjct  672  SDVVLRKKNDS-SCAFEDCHWLNKN  695



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 133/177 (75%), Gaps = 12/177 (7%)
 Frame = -3

Query  702  TTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  529
            TTG  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +
Sbjct  493  TTGGQNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGSWTDTMCN  550

Query  528  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS
Sbjct  551  WSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVIQSGMGG-------RTNHPYFS  602

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
             D ++++FT++   V+AEP+S P+ +QPYGD+++++ DG+ ++RLT N YE+GTPAW
Sbjct  603  PDGKYIVFTSDYAAVSAEPISNPHHYQPYGDIFVIKSDGSEIRRLTHNSYEDGTPAW  659



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R NH  FS D   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RANHPYFSPDGNS  608

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IVFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
                +   G   +  F+E  W+N
Sbjct  666  KPEDVEWPGHGPQCSFEECHWLN  688



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 144/203 (71%), Gaps = 12/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  504  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDG  561

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  562  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  613

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ ++RLT N YE+GTPAW P+  +  
Sbjct  614  LVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNVRRLTHNSYEDGTPAWAPRF-IHP  672

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
              + L +  +  R  F++  W+N
Sbjct  673  NNVELQRRNDS-RCSFEDCHWLN  694



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 134/179 (75%), Gaps = 12/179 (7%)
 Frame = -3

Query  702  TTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  529
            TTG  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +
Sbjct  489  TTGGQNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGET--GGLYRLTEGSWTDTMCN  546

Query  528  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS
Sbjct  547  WSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVIQSGTGG-------RTNHPYFS  598

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
             D ++++FT++   V+AEP++ P+ +QPYGD+++++ DG+ ++R+T N YE+GTPAW P
Sbjct  599  PDGKYIVFTSDYAAVSAEPIANPHHYQPYGDIFVIKSDGSEIRRMTHNSYEDGTPAWGP  657



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 12/190 (6%)
 Frame = -3

Query  729  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  556
            V+     K TTG  NNAFPS SPDGK I FRSGRSG+KNLYI+D++ GE   GGI +LT+
Sbjct  489  VDQPSYKKLTTGGENNAFPSPSPDGKWIAFRSGRSGYKNLYIMDAVXGER--GGIHRLTE  546

Query  555  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+ G      
Sbjct  547  GPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGSAG------  599

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
             R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE
Sbjct  600  -RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYE  658

Query  195  NGTPAWHPKA  166
            +GTPAW PK 
Sbjct  659  DGTPAWAPKV  668



>ref|XP_010269111.1| PREDICTED: uncharacterized protein LOC104605872 [Nelumbo nucifera]
Length=623

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 144/217 (66%), Gaps = 18/217 (8%)
 Frame = -3

Query  726  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  553
            E+    K T G  NNAFPS SPDGK +VFRSGRSGHKNLY++D+L GE    G+R+LT+G
Sbjct  399  EMGQYKKLTIGGQNNAFPSPSPDGKWVVFRSGRSGHKNLYVMDALEGER--AGVRRLTEG  456

Query  552  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  373
             W DTM +WSPDG+ IAF+S+R NPG    F+IY + P+GTGL+++  +G  G       
Sbjct  457  PWTDTMCNWSPDGEWIAFASDRDNPGGG-SFAIYFIHPNGTGLKKVVHSGEGG-------  508

Query  372  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  193
            R NH  FS D + ++FT++   V+AEP++ P+ +QPYGD+++ R DG+G++RLT N YE+
Sbjct  509  RTNHPWFSPDGKSLVFTSDYAAVSAEPIANPHHYQPYGDIFIARSDGSGIRRLTHNSYED  568

Query  192  GTPAWHP--KAEVDLARLSLGKSGEKLRGKFDEPLWI  88
            GTP+W P     +D+     G      R  FD+  W+
Sbjct  569  GTPSWGPMFMRPIDVVESPFGGP----RCSFDDCHWL  601



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 136/184 (74%), Gaps = 12/184 (7%)
 Frame = -3

Query  717  VLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            ++ K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D++ G  D   +R+LT+G W 
Sbjct  484  IVKKLTTGGENNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAVEG--DSAALRRLTEGPWS  541

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  364
            DTM +WSPDG+ IAF+S+R NPG+   F+IY++ P+GTGLR++  +G  G       R N
Sbjct  542  DTMCNWSPDGEWIAFASDRDNPGSG-SFAIYMIHPNGTGLRKVVHSGDGG-------RTN  593

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            H  FS DS+ + FT++  GV+AEP+S P+ +QPYG+++ +++DG+ ++RLT N +E+GTP
Sbjct  594  HPWFSPDSKSLAFTSDYAGVSAEPISNPHHYQPYGEIFTVKIDGSDIRRLTHNSFEDGTP  653

Query  183  AWHP  172
             W P
Sbjct  654  TWAP  657



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   193 bits (491),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 12/187 (6%)
 Frame = -3

Query  726  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  553
            E   + K T G  NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGIR+LT+G
Sbjct  463  ETISMKKLTVGGENNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGIRRLTEG  520

Query  552  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  373
             W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G       
Sbjct  521  PWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGDGG-------  572

Query  372  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  193
            R NH  F  DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT N +E+
Sbjct  573  RTNHPWFGPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVHIDGSNIRRLTHNSFED  632

Query  192  GTPAWHP  172
            GTP+W P
Sbjct  633  GTPSWTP  639



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 131/175 (75%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGR+GHKNLY++D+  GE    G+ +LT+GAW DTM SWSPDG
Sbjct  508  NNAFPWPSPDGKLIVFRSGRTGHKNLYLMDAEKGET--SGLWRLTEGAWTDTMCSWSPDG  565

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G+ G       R NH  FS DS+ 
Sbjct  566  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGSGG-------RTNHPIFSPDSKS  617

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTP W P+
Sbjct  618  IVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPVWAPR  672



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK +VFRSGR+GHKNLY +D+  GE   GGI +LT+G W DTM +WSPDG
Sbjct  493  NNAFPSVSPDGKWVVFRSGRAGHKNLYAMDAEEGE--KGGIHRLTEGPWSDTMCNWSPDG  550

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F +Y++ P+GTGLR++  +G  G       R NH  FS D + 
Sbjct  551  EWIAFASDREDPGSG-SFELYLIHPNGTGLRKLVQSGLGG-------RTNHPYFSPDGKS  602

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            V+FT +  G++AEP+S P+ +QPYG++Y ++LDG+ L+RLT N +E+GTPAW P   + +
Sbjct  603  VVFTTDYAGISAEPISNPHHYQPYGEIYTIKLDGSDLKRLTHNSFEDGTPAWGP---IYI  659

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
                +    E+ + +F++  W+N
Sbjct  660  EPNDVEWPNERPQCQFEDCHWLN  682



>ref|XP_012078271.1| PREDICTED: uncharacterized protein LOC105638961 [Jatropha curcas]
Length=700

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK +VFRSGR+GHKNLY +D+  GE   GGI +LT+G W DTM +WSPDG
Sbjct  494  NNAFPSVSPDGKWVVFRSGRAGHKNLYAMDAEEGE--KGGIHRLTEGPWSDTMCNWSPDG  551

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F +Y++ P+GTGLR++  +G  G       R NH  FS D + 
Sbjct  552  EWIAFASDREDPGSG-SFELYLIHPNGTGLRKLVQSGLGG-------RTNHPYFSPDGKS  603

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            V+FT +  G++AEP+S P+ +QPYG++Y ++LDG+ L+RLT N +E+GTPAW P   + +
Sbjct  604  VVFTTDYAGISAEPISNPHHYQPYGEIYTIKLDGSDLKRLTHNSFEDGTPAWGP---IYI  660

Query  153  ARLSLGKSGEKLRGKFDEPLWIN  85
                +    E+ + +F++  W+N
Sbjct  661  EPNDVEWPNERPQCQFEDCHWLN  683



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 130/175 (74%), Gaps = 10/175 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  508  NNAFPWPSPDGKQIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGVWTDTMCNWSPDG  565

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F ++++ P+GTG+R++  +G  G       R NH  FS DS+ 
Sbjct  566  EWIAFASDRESPGSG-SFELFLIHPNGTGIRKLIQSGTGG-------RTNHPVFSPDSKS  617

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
            ++FT++  G++ EP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  618  LVFTSDYAGISGEPISNPHSYQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  672



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 138/185 (75%), Gaps = 13/185 (7%)
 Frame = -3

Query  723  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            +K LT  T+G NNAFP+ SPDGK IVFRSGRSGHKNLYI+D++ GE   GG+ +LTDG W
Sbjct  510  VKRLT--TSGKNNAFPAPSPDGKWIVFRSGRSGHKNLYIMDAVKGE--EGGLYRLTDGPW  565

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
             DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+ G       R 
Sbjct  566  SDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG-------RA  617

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
            NH  FS D + ++FT++   V+AEP+S  + +QPYG+++ ++LDG+ L+RLT N YE+GT
Sbjct  618  NHPYFSPDGKSIVFTSDYAAVSAEPISNSHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGT  677

Query  186  PAWHP  172
            PAW P
Sbjct  678  PAWGP  682



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 135/186 (73%), Gaps = 13/186 (7%)
 Frame = -3

Query  723  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D+++GE    G+R+LT+G W
Sbjct  485  IKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVDGE--SKGLRRLTEGLW  540

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
             DTM SWSPDG  IAFSS+R NPG A  F ++++ P+GTGLR++  +G  G       R 
Sbjct  541  TDTMCSWSPDGDWIAFSSDRENPG-AGSFDLFLIHPNGTGLRKLFQSGLGG-------RA  592

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
            NH  +  D + ++FT +  G++AEPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GT
Sbjct  593  NHPNWRPDGKALVFTTDNAGISAEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGT  652

Query  186  PAWHPK  169
            P W P+
Sbjct  653  PTWSPR  658



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 134/186 (72%), Gaps = 11/186 (6%)
 Frame = -3

Query  726  EIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            +I V    T G NNAFPS SPDGK IVFRSGRSGHKNLYI+D+  GE  G  +++LT+G 
Sbjct  493  QIAVKKLTTNGKNNAFPSPSPDGKRIVFRSGRSGHKNLYIMDAEEGERIG--LQRLTEGP  550

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  370
            W DTM +WSPDG  IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ G       R
Sbjct  551  WTDTMCNWSPDGDWIAFASDRENPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------R  602

Query  369  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  190
             NH  FS D + ++FT++ G ++AEP+S P+ +QPYG+++ +++DG+ L+RLT N +E+G
Sbjct  603  TNHPWFSPDGKSLVFTSDYGAISAEPISNPHHYQPYGEIFTVKVDGSDLRRLTQNSFEDG  662

Query  189  TPAWHP  172
            TP W P
Sbjct  663  TPVWVP  668



>ref|XP_007223068.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
 gb|EMJ24267.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
Length=553

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 128/174 (74%), Gaps = 10/174 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSG SGHKNLYI+D+ +GE    G+ +LT+G W DTM +WSPDG
Sbjct  342  NNAFPSPSPDGKRIVFRSGLSGHKNLYIMDAEDGER--SGLHRLTEGMWTDTMCNWSPDG  399

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  400  EWIAFASDRDNPGSG-SFELYVIHPNGTGLRKVIESGSGG-------RTNHPWFSPDGKS  451

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++FT++ G ++AEP+S P+ +QPYG+++ + LDG+ L+RLT N YE+GTP W P
Sbjct  452  LVFTSDYGAISAEPISNPHHYQPYGEIFTINLDGSDLRRLTQNSYEDGTPVWIP  505



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 132/188 (70%), Gaps = 12/188 (6%)
 Frame = -3

Query  729  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  556
            V+     K TT   NNAFPS SPDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+
Sbjct  471  VDRATFKKLTTNGKNNAFPSPSPDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTE  528

Query  555  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            G W DTM +WSPDG  IAF+S+R +PG+   F +YV+RP+G GLR++  +G  G      
Sbjct  529  GPWTDTMCNWSPDGNWIAFASDREDPGSG-SFELYVIRPNGAGLRKVIQSGTGG------  581

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
             R NH  FS DS+ ++FT++   ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE
Sbjct  582  -RTNHPWFSPDSKSLVFTSDYRAISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTQNSYE  640

Query  195  NGTPAWHP  172
            +GTP W P
Sbjct  641  DGTPVWVP  648



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 151/234 (65%), Gaps = 14/234 (6%)
 Frame = -3

Query  783  FDPSNLTddgdddsDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYII  607
            F P +   D    + E P +I V    T G NNAFPS SPDG  IVFRSG++G KNLYI+
Sbjct  487  FAPVSTEVDIIAVNVEDPEKIVVKKLTTNGKNNAFPSLSPDGNRIVFRSGQTGFKNLYIM  546

Query  606  DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTG  427
            D++ GE   GG+ +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTG
Sbjct  547  DAVKGE--EGGLHRLTEGPWTDTMCNWSPDGEWIAFASDRENPGSG-SFELYLIHPNGTG  603

Query  426  LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM  247
            LR +  +G+ G       R NH  FS D + + FT++  G++AEP+S P+ +QPYG+++ 
Sbjct  604  LRTLIESGSGG-------RTNHPWFSPDGKKLAFTSDYAGISAEPISNPHHYQPYGEIFT  656

Query  246  MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  85
            +  DG+ ++RLT N YE+GTP W PK    +  + +    ++ R +F++  W+N
Sbjct  657  VNFDGSDVRRLTHNSYEDGTPTWVPKF---IRPVDVEWPVDRPRCEFEDLHWLN  707



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 128/174 (74%), Gaps = 10/174 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSG SGHKNLYI+D+ +GE    G+++LT+G W DTM +WSPDG
Sbjct  486  NNAFPSASPDGKRIVFRSGLSGHKNLYIMDAEDGER--SGLQRLTEGMWTDTMCNWSPDG  543

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + IAF+S+R +PG+   F +YV+ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  544  EWIAFASDRDDPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------RTNHPWFSPDGKS  595

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++FT++   ++AEP+S P+ +QPYG+++ + LDG+ L+RLT N YE+GTP W P
Sbjct  596  LVFTSDYRAISAEPISNPHHYQPYGEIFTINLDGSDLKRLTQNSYEDGTPVWIP  649



>ref|XP_004149439.1| PREDICTED: uncharacterized protein LOC101203758 [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 132/186 (71%), Gaps = 13/186 (7%)
 Frame = -3

Query  723  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D++ GE    G+R+LT+G W
Sbjct  485  IKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRRLTEGQW  540

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
             DTM SWSP+G  IAFSS+R NPG    F ++++ P+GTGLR++  +G  G       R 
Sbjct  541  TDTMCSWSPEGDWIAFSSDRENPGGG-SFDLFLIHPNGTGLRKLFQSGLGG-------RA  592

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
            NH  +  D + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N YE+GT
Sbjct  593  NHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHNSYEDGT  652

Query  186  PAWHPK  169
            P W P+
Sbjct  653  PTWSPR  658



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 125/174 (72%), Gaps = 10/174 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+G W DTM +WSPDG
Sbjct  485  NNAFPSPSPDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTEGPWTDTMCNWSPDG  542

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              IAF+S+R +PG+   F +YV+RP+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  543  NWIAFASDREDPGSG-SFELYVIRPNGTGLRKVIQSGTGG-------RTNHPWFSPDSKS  594

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++FT++   ++AEP+     +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  595  LVFTSDYRAISAEPIXNXXHYQPYGEIFTVKLDGSDLKRLTQNSYEDGTPVWVP  648



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 109/158 (69%), Gaps = 16/158 (10%)
 Frame = -3

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  364
            D  P+ SP GK +              F IY+VRPDG+GLRR+HVAG  GS   +RER+N
Sbjct  449  DAFPAVSPCGKWV-------------VFRIYLVRPDGSGLRRVHVAGPAGSAAADRERIN  495

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            HVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT N YENGTP
Sbjct  496  HVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTP  555

Query  183  AWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  79
            AW P +     L  LSLG  +G++  G+FDEPLW+  D
Sbjct  556  AWGPASSPAAGLESLSLGPGAGDESLGEFDEPLWLTCD  593


 Score = 47.4 bits (111),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 33/127 (26%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL-  562
            E+   +KVLT+   GN+AFP+ SP GK +VFR        +Y++       DG G+R++ 
Sbjct  433  EVAATLKVLTRPEAGNDAFPAVSPCGKWVVFR--------IYLVRP-----DGSGLRRVH  479

Query  561  ---------TDGAWIDTMPSWSPDGKLIAFSSNR--------HNPGNADCF-SIYVVRPD  436
                      D   I+ +  +SPD + + F++N           P     +  +YV R D
Sbjct  480  VAGPAGSAAADRERINHV-CFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLD  538

Query  435  GTGLRRI  415
            G+GL R+
Sbjct  539  GSGLVRL  545


 Score = 33.9 bits (76),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -2

Query  844  TSIGPIFESVKATVQIARL  788
            TS+GPIFE+ KATV+IARL
Sbjct  402  TSMGPIFETTKATVRIARL  420



>ref|XP_006652005.1| PREDICTED: uncharacterized protein LOC102702184, partial [Oryza 
brachyantha]
Length=391

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 121/184 (66%), Gaps = 12/184 (7%)
 Frame = -3

Query  717  VLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
             + K T G  NNAFPS SPDGK +VFRSGRSGHKNLY++D+ +GE   GG+R+LT+G W 
Sbjct  175  AMKKLTVGGENNAFPSPSPDGKWVVFRSGRSGHKNLYVMDAEHGE--AGGVRRLTEGPWS  232

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  364
            DTM +WSPDG+ IAF+S+RH+PG+         R               G       R N
Sbjct  233  DTMCNWSPDGEWIAFASDRHDPGSG--------RFAXXXXXXXGPGRRGGVHSGGGGRTN  284

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            H  FS DS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GTP
Sbjct  285  HPWFSPDSKSIVFTSDYAAVSAEPVSNPHHYQPYGEIYTVSIDGSNIRRLTHNSFEDGTP  344

Query  183  AWHP  172
            AW P
Sbjct  345  AWTP  348



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 118/176 (67%), Gaps = 12/176 (7%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRS  SG+KNLYI+D+  GE   GG+ +LTDGAW DTM SWSPDG
Sbjct  474  NNAFPWPSPDGKRIVFRSSMSGNKNLYIMDAEKGET--GGLFRLTDGAWNDTMCSWSPDG  531

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL-NHVCFSSDSE  337
              IAF+SNR NPG  + F ++++ P+GTGLR++         E    R+ NH  FS D +
Sbjct  532  DWIAFASNRENPGT-ESFGLFLIHPNGTGLRKL--------TETGLGRMSNHPVFSPDGK  582

Query  336  WVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
             V FT+N   ++AEP+S P+     G+++ ++LDG+ L R+T N Y +GTP W PK
Sbjct  583  TVAFTSNYAAISAEPISNPDIAISAGEIFTVKLDGSDLSRVTHNSYMDGTPIWAPK  638



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 119/183 (65%), Gaps = 12/183 (7%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRS RSG KN+YIID+  GE   GG+ +LT+G W D++P+WSPDG
Sbjct  495  NNAFPWPSPDGKRIVFRSARSGAKNIYIIDAEKGE--SGGLFRLTNGNWNDSIPTWSPDG  552

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              I FSSNR  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ 
Sbjct  553  NWIVFSSNREFPGTF-LDNLYVVHPDGTGLRKL-------AQNLTGGLSMHSTFSPDSKR  604

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEV  160
            ++FT    G++AEP+ +P+ F   G+++ + LDG+ L RLT N  E+G P W P  KA V
Sbjct  605  IVFTTTYAGISAEPIGVPHFFIAGGEIFTVNLDGSDLTRLTHNSVEDGPPMWFPKIKATV  664

Query  159  DLA  151
            D+A
Sbjct  665  DVA  667



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 120/194 (62%), Gaps = 12/194 (6%)
 Frame = -3

Query  738  EIPVEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  565
            + P  +  + K TT   NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +
Sbjct  472  DAPNPLTAVKKLTTKGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFR  529

Query  564  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  385
            LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++       ++ 
Sbjct  530  LTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQN  581

Query  384  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  205
            +      H  FS DS+ ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N
Sbjct  582  LTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHN  641

Query  204  GYENGTPAWHPKAE  163
              E+G P W PK +
Sbjct  642  SLEDGPPMWFPKIK  655



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 13/188 (7%)
 Frame = -3

Query  723  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            +K LT  TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W
Sbjct  482  VKKLT--TTGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--SGGLFRLTNGNW  537

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
             DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++       ++ +     
Sbjct  538  NDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGLVS  589

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
             H  FS DS+ ++FT    G++AE +  P+   P  +++ + LDG+GL RLT N  E+G 
Sbjct  590  MHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGLTRLTHNSVEDGP  649

Query  186  PAWHPKAE  163
            P W PK +
Sbjct  650  PMWFPKIK  657



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 10/177 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  489  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  546

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ 
Sbjct  547  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  598

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
            ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  599  IVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 10/177 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  488  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  545

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ 
Sbjct  546  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  597

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
            ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  598  IVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  654



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  489  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  546

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ 
Sbjct  547  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  598

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
            ++FT+   G++AEP+  P    P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  599  IVFTSIYAGLSAEPIGTPRFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  655



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 119/188 (63%), Gaps = 13/188 (7%)
 Frame = -3

Query  723  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            +K LT  TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W
Sbjct  482  VKKLT--TTGENNAFPWPSPDGKRIVFRSSRSGTKNLYIMDAEKGE--SGGLFRLTNGNW  537

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
             DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++       ++ +     
Sbjct  538  NDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGGVS  589

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
             H  FS DS+ ++FT    G++AE +  P+   P  +++ + LDG+G+ RLT N  E+G 
Sbjct  590  MHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGMTRLTHNSVEDGP  649

Query  186  PAWHPKAE  163
            P W PK +
Sbjct  650  PMWFPKIK  657



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 111/156 (71%), Gaps = 11/156 (7%)
 Frame = -3

Query  639  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  460
            G  GHKNLYI+D+ +GE   GGIR+LT+G W DTM +WSP  + IAF+S+RH PG+   F
Sbjct  284  GCRGHKNLYIMDAKDGE--AGGIRRLTEGPWSDTMCNWSPHDEWIAFASDRHAPGSGS-F  340

Query  459  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP  280
            +I +V P+GTGLRR+  +G  G       R NH  FSSD + ++FT++   V+AEPVS P
Sbjct  341  AI-MVHPNGTGLRRVVHSGDGG-------RTNHPWFSSDFKSLVFTSDYAAVSAEPVSNP  392

Query  279  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            + +QPYG++Y + +DG+ ++RLT N +E+GTP+W P
Sbjct  393  HHYQPYGEIYTVDIDGSNIRRLTHNSFEDGTPSWTP  428



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 111/182 (61%), Gaps = 11/182 (6%)
 Frame = -3

Query  702  TTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  526
            TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D + +W
Sbjct  488  TTGQNNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGET--GGLFRLTNGNWSDVIATW  545

Query  525  SPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  346
            SPDG  I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FS 
Sbjct  546  SPDGNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKV-------AQNLTGAVSMHPMFSP  597

Query  345  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  166
            DS+ ++FT     ++AE +  P+   P  +++ + LDG+   RLT N  E+G P W PK 
Sbjct  598  DSKRIVFTTTYAAISAESIGNPHFNVPSSEIFTVNLDGSDFTRLTHNSLEDGPPMWFPKI  657

Query  165  EV  160
            + 
Sbjct  658  KA  659



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 114/187 (61%), Gaps = 18/187 (10%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
             ++  LT   TGNNAFPS S DG  IVFRSGRSG KNLYI+ +   E +  G+ +LT+G 
Sbjct  489  TDVLTLTANGTGNNAFPSFSSDGSEIVFRSGRSGFKNLYIMPT---EGEAAGLIRLTEGP  545

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGN---ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  379
            W DTMP W+P    I F+S+R    +   A  F I+++R DG+GL+++         + +
Sbjct  546  WDDTMPGWTPASGWIVFASSREYVESNRPAGAFDIFMIRTDGSGLQKVF--------DSH  597

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  199
                NH  FS     V+FT      +AE +S P+QFQPYGDL+ +  DGT L+RLT + Y
Sbjct  598  GGLANHPHFSPSQTSVVFTR----YSAEEISTPHQFQPYGDLFAIDTDGTNLRRLTHDPY  653

Query  198  ENGTPAW  178
            ENGTPAW
Sbjct  654  ENGTPAW  660



>emb|CBI18981.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = -3

Query  582  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  403
            GGGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G
Sbjct  372  GGGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGG-GFELYVIHPNGTGLRKVVHSG  430

Query  402  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  223
            + G       R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL
Sbjct  431  SAG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGL  483

Query  222  QRLTWNGYENGTPAWHPKA  166
             RLT N YE+GTPAW PK 
Sbjct  484  HRLTHNSYEDGTPAWAPKV  502



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 111/186 (60%), Gaps = 12/186 (6%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  483  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  540

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  541  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  592

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ ++FT    G++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  593  PMFSPDSKRIVFTTTYAGISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  652

Query  180  WHPKAE  163
            W PK +
Sbjct  653  WFPKIK  658



>ref|XP_002520327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42113.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 18/192 (9%)
 Frame = -3

Query  732  PVEIKVLTKETTG--NNAFPSCSPDGKHI--VFRSGRSGHKNLYIIDSLNGELDGGGIRQ  565
            P      T+ TT   NNAFP    DG  +  VFR  R+    LYI+D++ GE   GG+ +
Sbjct  313  PAFASATTQLTTNGDNNAFPDRMGDGLCLGRVFRVVRT----LYIMDAVEGE--KGGLYR  366

Query  564  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  385
            + +G W DTM  WSPDG+ I F S+R  PG    F +Y + P+GTGLR++  +G+ G   
Sbjct  367  VIEGLWDDTMCDWSPDGEWIVFCSDREEPGTG-SFDLYFIHPNGTGLRKLLQSGSGG---  422

Query  384  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  205
                R+NH+  S + + ++FT +   ++AEP+S    FQPYG++Y++ LDG+GL+RLT N
Sbjct  423  ----RVNHLYISPNGKSIVFTTDYTAISAEPISNQQMFQPYGEIYIINLDGSGLKRLTHN  478

Query  204  GYENGTPAWHPK  169
             +E+GTPAW P+
Sbjct  479  SFEDGTPAWGPR  490



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score =   145 bits (367),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  490  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  547

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  548  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  599

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ ++FT     ++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  600  PMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  659

Query  180  WHPKAE  163
            W PK +
Sbjct  660  WFPKIK  665



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score =   145 bits (367),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  490  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  547

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  548  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  599

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              FS DS+ ++FT     ++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  600  PMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  659

Query  180  WHPKAE  163
            W PK +
Sbjct  660  WFPKIK  665



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 113/183 (62%), Gaps = 12/183 (7%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            NNAFP  SPDGK IVFRS RSG  NLYI+D+  GE   GG+ +LT+G   DT+ +WSPDG
Sbjct  486  NNAFPWPSPDGKRIVFRSARSGSFNLYIMDAKKGET--GGLFRLTNGHGNDTIATWSPDG  543

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
              I F+SNR  PG     ++YVV PDGTGL+++       +E++      H  FS DS+ 
Sbjct  544  NWIVFASNREFPGTL-FLNLYVVHPDGTGLKKV-------TEKLTGGISMHPMFSPDSKR  595

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEV  160
            ++FT     ++AEP+  P+   P  +++ + LDG+ L R+T N  E+G P W P  KA  
Sbjct  596  IVFTTIHAAISAEPIGNPHFNVPSSEIFTVNLDGSDLTRITHNSVEDGPPMWFPKIKATS  655

Query  159  DLA  151
            D+A
Sbjct  656  DVA  658



>gb|EMT16880.1| hypothetical protein F775_15390 [Aegilops tauschii]
Length=390

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 113/188 (60%), Gaps = 33/188 (18%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG-GGIRQLTDGAWIDTMPSWSPD  517
            + ++PS SPDGK I F     G   LY+++S     DG GG R++  G    T   W   
Sbjct  168  DGSYPSFSPDGKRIAF----VGLPGLYVVNS-----DGSGGRRKIFSGNAFPTSWDWKRK  218

Query  516  GKL---------------IAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  382
            G +               IAF+S+RHNPG A  F+IY++ P+GTGLRR+ V  A+G    
Sbjct  219  GVIYTSIGPDFASESTEWIAFASDRHNPG-AGSFAIYMIHPNGTGLRRV-VHSADGG---  273

Query  381  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  202
               R NH  FS DS+ ++FT++L  V+AEP+S P  +QPYG+++ + +DG+GLQRLT N 
Sbjct  274  ---RTNHPWFSPDSKRMVFTSDLAAVSAEPISNPRHYQPYGEIFTINIDGSGLQRLTHNS  330

Query  201  YENGTPAW  178
            +E+GTP+W
Sbjct  331  FEDGTPSW  338



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 3/101 (3%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            +I  ++KVLT+E T NNAFPSCSPDGK +VFRSGR+GHKNLYI+D +NGE D  GI QLT
Sbjct  426  DITCDVKVLTREDTRNNAFPSCSPDGKWLVFRSGRTGHKNLYIVDVVNGEFD-SGICQLT  484

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNP--GNADCFSIYVVR  442
            DG+WIDTMPSWSP+  LIAF  N HNP  G  D    Y++R
Sbjct  485  DGSWIDTMPSWSPNDNLIAFFLNWHNPHVGRYDADLEYILR  525



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 13/126 (10%)
 Frame = -3

Query  723  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            +K LT  T+G NNAFP+ SPDGK IVFRSGRSGHKNLYI+D++ GE   GG+ +LTDG W
Sbjct  510  VKRLT--TSGKNNAFPAPSPDGKWIVFRSGRSGHKNLYIMDAVKGE--EGGLYRLTDGPW  565

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
             DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+ G       R 
Sbjct  566  SDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG-------RA  617

Query  366  NHVCFS  349
            NH  FS
Sbjct  618  NHPYFS  623



>ref|XP_002467956.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
 gb|EER94954.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
Length=724

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 112/198 (57%), Gaps = 31/198 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFP  +PDG   VFRS R G    +KNLYI+ D+  GE+ GG + +LT+G+WIDT   
Sbjct  483  NNAFPFTNPDGTKFVFRSTRDGGDKNYKNLYIMEDAEFGEVGGGKVTRLTEGSWIDTHCQ  542

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            WSPDG L+ F+SNR  P +A           F++Y++      + R+  +G + S  V  
Sbjct  543  WSPDGNLVVFASNRDKPADAPERDHGLDPGYFAVYLMNVSDRSVVRVIRSGYDLSGHV--  600

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ-----  220
               NH  FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   ++     
Sbjct  601  ---NHPVFSPDGRSIAVTSDLAAVSADPMSLPTFLHSVRPYGDIFSVDIDPDDMEKNKDL  657

Query  219  ----RLTWNGYENGTPAW  178
                R+T + YEN TPAW
Sbjct  658  DKFVRVTHSRYENSTPAW  675



>ref|NP_001173830.1| Os04g0278101 [Oryza sativa Japonica Group]
 dbj|BAH92558.1| Os04g0278101 [Oryza sativa Japonica Group]
Length=378

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 115/216 (53%), Gaps = 60/216 (28%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + K T G  NNAFPS  PDGK                   L+GE   GGIR+LT+G W D
Sbjct  202  MKKLTVGDENNAFPSPPPDGKW------------------LDGE--AGGIRRLTEGPWSD  241

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
            TM +WSPD + IAF+S+RH PG+   F+I +V P+GTG                      
Sbjct  242  TMCNWSPDDEWIAFASDRHAPGSG-SFAI-MVHPNGTG----------------------  277

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
                SDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GTP+
Sbjct  278  ----SDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRRLTHNSFEDGTPS  333

Query  180  WHPKAEVDLARLSLGKSGEKL----RGKFDEPLWIN  85
            W P        L     GE L    R  F +  W+N
Sbjct  334  WTPYF------LDPRDVGETLQASGRCAFQDCHWLN  363



>gb|EMT08438.1| hypothetical protein F775_30261 [Aegilops tauschii]
Length=806

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 116/208 (56%), Gaps = 32/208 (15%)
 Frame = -3

Query  726  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLT  559
            E ++LTK    NNAFPS + DG  +VFRS R+G    +KNLY++D+  GE DGG   ++T
Sbjct  557  ERRLLTK-GKFNNAFPSTNSDGTKLVFRSTRNGGHKKYKNLYMMDAEIGE-DGGEAERIT  614

Query  558  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVA  406
            +G WIDT   WSPD   I FSSNR  P +A           F++Y++      + R+  +
Sbjct  615  EGDWIDTHCQWSPDRDWIVFSSNRDKPADAPERDHGMDPGYFAVYLMNAIDRSVVRVIRS  674

Query  405  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD  235
            G + S  V     NH  FS D   ++ TA+L  V+A+P+S+P   +  +PYGD++ + +D
Sbjct  675  GYDFSGHV-----NHPVFSPDGRSIVVTADLAAVSADPMSLPLLLHSQRPYGDIFTVDID  729

Query  234  GTGLQ---------RLTWNGYENGTPAW  178
               ++         R+T + YEN TP W
Sbjct  730  PDDMEKNQDVEEFARVTHSRYENATPDW  757



>gb|AEW08691.1| hypothetical protein CL1213Contig1_01, partial [Pinus lambertiana]
Length=97

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = -3

Query  735  IPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  556
            +  E+++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGIR LT+
Sbjct  23   VKSEVRILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEQGE--EGGIRALTE  80

Query  555  GAWIDTMPSWSPDGKLI  505
            G WIDTMPSWSPDG+ I
Sbjct  81   GPWIDTMPSWSPDGEWI  97



>ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
 gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
Length=730

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 106/199 (53%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS SPDG   VFRS R G    HKNLYI  D+  GE  GG + +LT+G W DT   
Sbjct  488  NNAFPSSSPDGSRFVFRSTRDGGDKKHKNLYIAEDAEVGEYSGGTVTRLTNGEWTDTHCQ  547

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           +++++V+  D T + R+  +G +    V 
Sbjct  548  WSPRGDWIVFSSTRDKPKDAPELDNGLDSGYYAVFMVKVSDPTVVIRVVQSGDDLGGHV-  606

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  232
                NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++++ +D         
Sbjct  607  ----NHPVFSPDGRSIAMTADLAAVSADPISLPLFIHSVRPYGDIFVVDIDPDDARKNKD  662

Query  231  -TGLQRLTWNGYENGTPAW  178
                 R+T + YE  TPAW
Sbjct  663  VKKFHRVTHSRYEYSTPAW  681



>ref|XP_004963491.1| PREDICTED: uncharacterized protein LOC101774581 [Setaria italica]
Length=740

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 108/209 (52%), Gaps = 32/209 (15%)
 Frame = -3

Query  720  KVLTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQL  562
            +V+ + T G  NNAFPS +P+G   VFRS R G    HKNLYI+ DS  GE   G + +L
Sbjct  507  QVVNRLTKGDFNNAFPSSNPEGTKFVFRSTRDGGDKHHKNLYIMEDSDMGEHGEGTVTRL  566

Query  561  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------CFSIYVVRPDGTGLRRIHVA  406
            TDG W DT  SWSP G  I FSS+R  P  A          F+I++V  +   +    V 
Sbjct  567  TDGPWTDTHCSWSPRGDWIVFSSSRDKPAGAPEKDILDPGFFAIFLVNANNPDV----VV  622

Query  405  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD  235
                S +     + H  FS D   ++ TA+L  V+AEP+S+P   +  +PYGD++ + L 
Sbjct  623  RVMKSSDTIAGHVTHPMFSPDMRSIVVTADLAAVSAEPISMPQFLHSVRPYGDVFSVNLR  682

Query  234  GT----------GLQRLTWNGYENGTPAW  178
             T             R+T + YE  TPAW
Sbjct  683  DTVDIAKNENIEEFHRITHSRYEYATPAW  711



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 112/199 (56%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS +PDG  +VFRS R G    +KNLYI+ D+ +GE   G I +LT+G WIDT   
Sbjct  473  NNAFPSTNPDGTKLVFRSTRDGGDERYKNLYIMEDAESGEYGDGIITRLTNGPWIDTHCQ  532

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           F++Y+V+  D + + R+  +G++ +  V 
Sbjct  533  WSPRGDWIVFSSTRDKPEDAPESDNDLDPGYFAVYLVKANDPSVVVRVLGSGSDVAGHV-  591

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  223
                NH  FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++ + +D   +     
Sbjct  592  ----NHPIFSPDGKSIVVTADLAAVSVDPISLPLFLHSVRPYGDIFTIDIDPDDIYMNED  647

Query  222  ----QRLTWNGYENGTPAW  178
                 R+T + YEN T +W
Sbjct  648  VEKCNRITHSRYENSTASW  666



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 113/207 (55%), Gaps = 29/207 (14%)
 Frame = -3

Query  726  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQL  562
            ++K LT  +  NNAFP  +PDG  +VFRS R G    +KNLYII+ L+   DG G I +L
Sbjct  473  QVKRLTNGS--NNAFPCTNPDGTKLVFRSTRDGGENHYKNLYIIEDLDSMEDGEGEITRL  530

Query  561  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD-------CFSIYVVRPDGTGLRRIHVAG  403
            T+G W+DT   WSP+G+ I F+SNRH   +          F++Y+V+ D   +  + V G
Sbjct  531  TNGPWVDTHCEWSPNGEWIVFASNRHRTTDDSDHGLDTGYFAVYLVKADDPDV-WVKVIG  589

Query  402  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG  232
            +   +      +NH  FS D   +   A+L  V+ +P+S+P   +  +PYGDL+++ +D 
Sbjct  590  SRSGDLAG--HVNHPFFSPDGRSLSVVADLAAVSCDPISMPLFIHSVRPYGDLFILDIDE  647

Query  231  TGL---------QRLTWNGYENGTPAW  178
              +         +R+T   YEN T  W
Sbjct  648  DDIYANEDVEDYRRITHTRYENSTAVW  674



>ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42598.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 109/199 (55%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKQYKNLYIMEDAKVGEFGDGKITRLTNGPWTDTHCQ  542

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPDSDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-  601

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  223
                NH  FS D   +  T++L  V+ +P+S+P   +  +PYGDL+++ +D + +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSVDPISLPLFLHSVRPYGDLFVVDIDPSDINKNKD  657

Query  222  ----QRLTWNGYENGTPAW  178
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>ref|XP_002519807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42603.1| conserved hypothetical protein [Ricinus communis]
Length=711

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS +PDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G WIDT   
Sbjct  480  NNAFPSTNPDGTKLVFRSTRDGGDKKYKNLYIMEDARVGEYGDGKITRLTNGPWIDTHCQ  539

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G   +  V 
Sbjct  540  WSPRGNWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKANDSSVVVRVIKSGDNIAGHV-  598

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  223
                NH  FS D   +  T++L  V+ +PVS+P   +  +PYGD++ + +D   +     
Sbjct  599  ----NHPFFSPDGMSIAVTSDLAAVSVDPVSLPHFLHSVRPYGDVFTLDIDPDDINKNKD  654

Query  222  ----QRLTWNGYENGTPAW  178
                 R+T + YEN TP+W
Sbjct  655  LKKFNRITHSRYENATPSW  673



>ref|XP_008662981.1| PREDICTED: uncharacterized protein LOC103641407 [Zea mays]
 gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=730

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 105/199 (53%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS SPDG   VFRS R G    HKNLYI ++   GE   G + +LT+G W DT   
Sbjct  488  NNAFPSSSPDGNRFVFRSTRDGGDKKHKNLYIAENAEVGEYGDGTVTRLTNGEWTDTHCQ  547

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           F++++V+  D T + R+  +G +    V 
Sbjct  548  WSPSGDWIVFSSTRDKPKDAPELDNGLDPGYFAVFMVKASDPTVVIRVIRSGDDLGGHV-  606

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  232
                NH  FS D   ++ T++L  V+A+P+S+P   +  +PYGD++++ +D         
Sbjct  607  ----NHPVFSPDGRSIVVTSDLAAVSADPISLPLFIHSVRPYGDIFVVDIDPEDASKNKD  662

Query  231  -TGLQRLTWNGYENGTPAW  178
                 R+T + YE  TP W
Sbjct  663  VKKFHRVTHSRYEYSTPTW  681



>dbj|BAJ92843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=754

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 103/200 (52%), Gaps = 33/200 (17%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  532
            NNAFPS +P G   VFRS R G     HKNLYI+ D+  GE   G + +LTDG W DT  
Sbjct  509  NNAFPSSNPQGDKFVFRSTRDGGKEKFHKNLYIMEDAEVGEFSEGTVTRLTDGPWTDTHC  568

Query  531  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  379
            SWSP G  + FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V 
Sbjct  569  SWSPRGDWVVFSSTREMPPSAPEMAFLDAGYFAVYLVKVSDPTAVVRVVQSSATLAGHV-  627

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  226
                NH  FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  628  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDIAKNK  683

Query  225  ----LQRLTWNGYENGTPAW  178
                  R+T + YE  TP W
Sbjct  684  DIQEFHRITHSRYEYSTPTW  703



>gb|AEW08692.1| hypothetical protein CL1213Contig1_01, partial [Pinus radiata]
 gb|AFB33859.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFB33860.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFG48604.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            ++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGI  LT+G WID
Sbjct  28   RILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEKGE--EGGIHALTEGPWID  85

Query  540  TMPSWSPDGKLI  505
            TMPSWSPDG+ I
Sbjct  86   TMPSWSPDGEWI  97



>gb|AFG48602.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48603.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48605.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            ++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGI  LT+G WID
Sbjct  28   RILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEEGE--EGGIHALTEGPWID  85

Query  540  TMPSWSPDGKLI  505
            TMPSWSPDG+ I
Sbjct  86   TMPSWSPDGEWI  97



>ref|NP_001049934.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|ABF95608.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11848.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|EAZ26709.1| hypothetical protein OsJ_10615 [Oryza sativa Japonica Group]
Length=730

 Score =   114 bits (286),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 34/201 (17%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDT  538
            NNAFPS +PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT
Sbjct  486  NNAFPSTNPDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDT  545

Query  537  MPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEE  385
               WSP+GK I FSSNR  P +A           F++Y++      + R+  +G + +  
Sbjct  546  HCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGH  605

Query  384  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG------  232
            V     NH  FS D   +  T++L  VTA+P+S+P   +  +PYGD++ + +D       
Sbjct  606  V-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARN  660

Query  231  ---TGLQRLTWNGYENGTPAW  178
                G  R+T + YEN TPAW
Sbjct  661  EDVEGFVRVTHSRYENSTPAW  681



>gb|EAY89757.1| hypothetical protein OsI_11300 [Oryza sativa Indica Group]
Length=737

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 34/201 (17%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDT  538
            NNAFPS +PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT
Sbjct  493  NNAFPSTNPDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDT  552

Query  537  MPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEE  385
               WSP+GK I FSSNR  P +A           F++Y++      + R+  +G + +  
Sbjct  553  HCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGH  612

Query  384  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG------  232
            V     NH  FS D   +  T++L  VTA+P+S+P   +  +PYGD++ + +D       
Sbjct  613  V-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARN  667

Query  231  ---TGLQRLTWNGYENGTPAW  178
                G  R+T + YEN TPAW
Sbjct  668  EDVEGFVRVTHSRYENSTPAW  688



>ref|XP_004960704.1| PREDICTED: uncharacterized protein LOC101777811 [Setaria italica]
Length=754

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 113/239 (47%), Gaps = 48/239 (20%)
 Frame = -3

Query  729  VEIKVLTK-ETTG-------------NNAFPSCSPDGKHIVFRSGR----------SGHK  622
            VEIK + K E TG             N+AFPS + DG   VFR  R            H 
Sbjct  473  VEIKAIVKNEETGEWNKPNRLTKGEFNHAFPSSNHDGSKFVFRCTRDRTHGQSVRKQNHT  532

Query  621  NLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRH-----NPGNADC-  463
            NLYI+ D+  GE   G + QLTDG W+DT  SWSP G  I FSS+R       PG  D  
Sbjct  533  NLYIMEDAEEGEWGEGTVTQLTDGPWVDTHCSWSPSGDWIVFSSSRDKDPDAQPGTLDAG  592

Query  462  -FSIYVVRP---DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAE  295
             FSIY+V     D T            S +     +NH  FS D   ++FT++L  V+ E
Sbjct  593  YFSIYIVNAAERDPTNKTMPPPVRVVHSADTFIGHVNHPVFSHDMRSLIFTSDLAAVSVE  652

Query  294  PVSIP---NQFQPYGDLYMMRL----------DGTGLQRLTWNGYENGTPAWHPKAEVD  157
            P+S+P   +  +PYGD++ + L          + T   RLT + YE  TPAW   A VD
Sbjct  653  PISMPIFIHSVRPYGDIFSVDLRDDKDIAKNENITEFHRLTHSRYEYSTPAWTKFATVD  711



>ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38223.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKITRLTNGPWTDTHCQ  542

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-  601

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  223
                NH  FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKD  657

Query  222  ----QRLTWNGYENGTPAW  178
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 110/202 (54%), Gaps = 22/202 (11%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIID-SLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+AFPS + DG  +V+RS + G KNLYI++ +L GE +G  + +LT+G W DT   WSP 
Sbjct  484  NSAFPSTNADGTRLVYRSTKDGPKNLYIMENALLGEFEGAKVTRLTEGNWTDTHCQWSPK  543

Query  516  GKLIAFSSNRHNPG--------NADCFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLN  364
               I F+SNR NP         +   F +Y+V+  D T + ++  +G     ++    +N
Sbjct  544  QDWIVFASNRSNPTAKTPQDLPDPGFFGVYLVKANDKTVVVKVMDSGYTYLGDLFPGHVN  603

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------Q  220
            H  FS D E ++  A+L  V+ +PVS+P   +  +PYGD++++ ++   +          
Sbjct  604  HPFFSPDGESLVVAADLAAVSCDPVSMPLFVHSVRPYGDIFILDINRDDIYKNENLKKFT  663

Query  219  RLTWNGYENGTPAWHPKAEVDL  154
            R+T + YEN T  W   +  DL
Sbjct  664  RVTHSKYENSTATWTMTSTKDL  685



>gb|EAY90391.1| hypothetical protein OsI_11968 [Oryza sativa Indica Group]
Length=744

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 104/203 (51%), Gaps = 36/203 (18%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  535
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE   G + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTGKVTRLTSGAWTDTH  554

Query  534  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  391
             SWSP      I FSS R  P  A           F++++VR  D T + R+  +    +
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVA  614

Query  390  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  232
              V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  615  GHV-----NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  231  -----TGLQRLTWNGYENGTPAW  178
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|WP_041858684.1| hypothetical protein [Candidatus Solibacter usitatus]
Length=611

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 99/185 (54%), Gaps = 27/185 (15%)
 Frame = -3

Query  714  LTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWID  541
            LT E  GNNAFPS SPDGK  V+R+       L I   +N E   G I  RQ       D
Sbjct  445  LTAEP-GNNAFPSFSPDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------D  494

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
              P WSP G LI FS           + IY ++PDG+ L+R+       +         H
Sbjct  495  NFPLWSPRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------H  540

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
            + +S D E+++FT++  G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPA
Sbjct  541  MAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPA  599

Query  180  WHPKA  166
            W P A
Sbjct  600  WQPMA  604


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = -3

Query  708  KETTGNNAF---PSCSPDGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            K+ T + A+    + S D K + F S R G   NL+ +D + G       R LT G   D
Sbjct  93   KQLTADPAYDDQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGD  147

Query  540  TMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  403
              PSWSPDGK IAFSS R NP               IYV+RPDG+GL++I  +G
Sbjct  148  FRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  201


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 83/168 (49%), Gaps = 19/168 (11%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  502
            P+ +PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +A
Sbjct  61   PAWAPDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLA  115

Query  501  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  322
            F S R   G A+ +++ +V    TG  R   +G  G             +S D +W+ F+
Sbjct  116  FVSTRGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFS  162

Query  321  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            +              + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  163  SGRDNPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  209



>gb|ABJ88479.1| WD40 domain protein beta Propeller [Candidatus Solibacter usitatus 
Ellin6076]
Length=638

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 99/185 (54%), Gaps = 27/185 (15%)
 Frame = -3

Query  714  LTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWID  541
            LT E  GNNAFPS SPDGK  V+R+       L I   +N E   G I  RQ       D
Sbjct  472  LTAEP-GNNAFPSFSPDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------D  521

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
              P WSP G LI FS           + IY ++PDG+ L+R+       +         H
Sbjct  522  NFPLWSPRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------H  567

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
            + +S D E+++FT++  G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPA
Sbjct  568  MAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPA  626

Query  180  WHPKA  166
            W P A
Sbjct  627  WQPMA  631


 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = -3

Query  708  KETTGNNAF---PSCSPDGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            K+ T + A+    + S D K + F S R G   NL+ +D + G       R LT G   D
Sbjct  120  KQLTADPAYDDQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGD  174

Query  540  TMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  403
              PSWSPDGK IAFSS R NP               IYV+RPDG+GL++I  +G
Sbjct  175  FRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  228


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 83/168 (49%), Gaps = 19/168 (11%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  502
            P+ +PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +A
Sbjct  88   PAWAPDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLA  142

Query  501  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  322
            F S R   G A+ +++ +V    TG  R   +G  G             +S D +W+ F+
Sbjct  143  FVSTRGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFS  189

Query  321  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            +              + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  190  SGRDNPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  236



>gb|AFG48601.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            ++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE    GI  LT+G WID
Sbjct  28   RILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEKGE--ESGIHALTEGPWID  85

Query  540  TMPSWSPDGKLI  505
            TMPSWSPDG+ I
Sbjct  86   TMPSWSPDGEWI  97



>ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38217.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 107/199 (54%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G + +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKVTRLTNGPWTDTHCQ  542

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  379
            WSP G  I FSS R  P +A           F++++V+  D + + R+   G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKGGDDLAGHV-  601

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  223
                NH  FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKD  657

Query  222  ----QRLTWNGYENGTPAW  178
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>ref|XP_010097765.1| hypothetical protein L484_023906 [Morus notabilis]
 gb|EXB70720.1| hypothetical protein L484_023906 [Morus notabilis]
Length=744

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 104/197 (53%), Gaps = 29/197 (15%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  526
            NNAFPS SPDGK +VFRS R+G    +KNLYI D+  GE   G + +LT+G W DT   W
Sbjct  502  NNAFPSSSPDGKKLVFRSTRNGGDKKYKNLYITDAEAGEYGNGFLTRLTEGDWTDTHCQW  561

Query  525  SPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  373
            SP+   I FSS R  P +A           F++++V  +    +   V    GS      
Sbjct  562  SPNSDWIVFSSTRDKPKDAPPLDNGLDPGFFAVFLVNVN----KPSVVVRVVGSGNRLAG  617

Query  372  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ------  220
             LNH  FS D   ++ T +L  V++EP+S+P   +  +PYGD++ + +D   ++      
Sbjct  618  HLNHPFFSPDGNSIVVTGDLAAVSSEPISLPLFLHSVRPYGDIFTVDIDPKNIEKNEDVE  677

Query  219  ---RLTWNGYENGTPAW  178
               R+T + YE  T +W
Sbjct  678  KFKRITHSRYEYSTASW  694



>gb|EAZ27259.1| hypothetical protein OsJ_11196 [Oryza sativa Japonica Group]
Length=744

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 103/203 (51%), Gaps = 36/203 (18%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  535
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTH  554

Query  534  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  391
             SWSP      I FSS R  P  A           F++++VR  D T + R+  +    +
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVA  614

Query  390  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  232
              V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  615  GHV-----NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  231  -----TGLQRLTWNGYENGTPAW  178
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|XP_010676033.1| PREDICTED: uncharacterized protein LOC104891943 [Beta vulgaris 
subsp. vulgaris]
Length=751

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 115/217 (53%), Gaps = 36/217 (17%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH------KNLYIIDSLN-GELDGGGIRQL  562
            K LTK+   NNAFPS + +G  +VFRS R  H      KNLYI+ S + GE   G IR+L
Sbjct  478  KKLTKQF--NNAFPSTNGEGTQLVFRSTRDHHENGGIFKNLYIMKSADEGEFGRGEIRRL  535

Query  561  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DC--------FSIYVVRPDGTG-LRRIH  412
            T G  IDT   WSP    I FSSNR  P +A  C        FS+Y+V+ D    L R+ 
Sbjct  536  TTGNCIDTHCKWSPRNDWIVFSSNRDMPEDARKCDEDLDSGYFSVYLVKADNPDVLVRVM  595

Query  411  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMR  241
             +G++ +  V     NH  FS D + ++ T+++  V+A+P+S+P   +  +PYGD++ + 
Sbjct  596  YSGSDLAGHV-----NHPFFSPDGKSIVVTSDVAAVSADPMSLPLFLHSARPYGDIFTID  650

Query  240  LDGTGL---------QRLTWNGYENGTPAWHPKAEVD  157
            +D   +          R+T + YEN T  W   +  D
Sbjct  651  IDSDDINKNEDLKMFNRITHSRYENATGTWTKSSTRD  687



>ref|NP_001050324.1| Os03g0403400 [Oryza sativa Japonica Group]
 gb|AAP03369.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96486.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12238.1| Os03g0403400 [Oryza sativa Japonica Group]
Length=744

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 103/203 (51%), Gaps = 36/203 (18%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  535
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTH  554

Query  534  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  391
             SWSP      I FSS R  P  A           F++++VR  D T + R+  +    +
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVA  614

Query  390  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  232
              V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  615  GHV-----NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  231  -----TGLQRLTWNGYENGTPAW  178
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|XP_002437598.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
 gb|EER88965.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
Length=769

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 105/218 (48%), Gaps = 39/218 (18%)
 Frame = -3

Query  720  KVLTKETTG--NNAFPSCSPDGKHIVFRSGRSG---------HKNLYII-DSLNGELDGG  577
            + L K T G  NNAFPS +P G  IVFRS +            KNLYI+ D++ GE    
Sbjct  501  RQLRKLTAGGFNNAFPSSNPAGTKIVFRSTKDAPPPPPGGFRQKNLYIMEDAMEGE--SA  558

Query  576  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG-TG  427
            G+ +LTDG W DT   WSP G  I FSS+RH P  A           F +Y+V P     
Sbjct  559  GVTRLTDGDWTDTHCQWSPSGDWIVFSSSRHKPDGAPKTDNFLDPGYFGVYLVNPASPKA  618

Query  426  LRRIHVAGAEGSEEVNRERLNHV---CFSSDSEWVLFTANLGGVTAEPVSIP---NQFQP  265
            + R+  +        N   L HV    FS D   ++ TA+L  V+ EP+S+P   +  +P
Sbjct  619  VVRVMTSALPPPVPTNVAGLGHVNHPMFSPDGRSIVVTADLAAVSVEPISMPMFLHSVRP  678

Query  264  YGDLYMMRLDGTGL---------QRLTWNGYENGTPAW  178
            YGD++   +D   +          R+T + YE  TP W
Sbjct  679  YGDIFSFDIDPVDMDKNKDIQKFHRVTHSRYEYATPVW  716



>gb|EMT14934.1| hypothetical protein F775_30553 [Aegilops tauschii]
Length=723

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 102/200 (51%), Gaps = 33/200 (17%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  532
            NNAFPS +  G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  
Sbjct  478  NNAFPSSNAQGDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHC  537

Query  531  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  379
            SWSP G  + FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V 
Sbjct  538  SWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVSDPTVVVRVVQSSATLAGHV-  596

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  226
                NH  FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  597  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNK  652

Query  225  ----LQRLTWNGYENGTPAW  178
                  R+T + YE  TP W
Sbjct  653  DIQEFHRITHSRYEYSTPTW  672



>ref|XP_010676032.1| PREDICTED: uncharacterized protein LOC104891942 [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 98/190 (52%), Gaps = 27/190 (14%)
 Frame = -3

Query  666  DGKHIVFRSGRSGH--KNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  496
            DG  +V+RS R G+  KNLYI+ D+  GE  GG I +LT+G W DT   WSP+G  I F+
Sbjct  426  DGTKLVYRSSRDGNNCKNLYIMQDASKGEFMGGEITRLTEGEWTDTHCQWSPNGDWIVFA  485

Query  495  SNRHNPG--------NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE----RLNHVCF  352
            SNR NP         +   F IY+V+ D        +     S    RE     +NH  F
Sbjct  486  SNRANPTAPKKDDLPDPGYFGIYMVKADNKNAWLKVIDSGFDSTRPGRELFPGHVNHPFF  545

Query  351  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLTW  208
            S D + ++  A+L  V+ EP+S+P   +  +PYGD++ + LD          T  +RLT 
Sbjct  546  SPDGKSIVIAADLAAVSCEPISLPLFAHSVRPYGDIFTVDLDSENFENNANLTKFKRLTH  605

Query  207  NGYENGTPAW  178
            + YEN T  W
Sbjct  606  SRYENSTAVW  615



>gb|EMS49561.1| hypothetical protein TRIUR3_11240 [Triticum urartu]
Length=568

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 102/200 (51%), Gaps = 33/200 (17%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  532
            NNAFPS +  G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  
Sbjct  323  NNAFPSSNAQGDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHC  382

Query  531  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  379
            SWSP G  + FSS R  P         +A  F++Y+V+  + T + R+  + A  +  V 
Sbjct  383  SWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVSNPTVVVRVVQSSATLAGHV-  441

Query  378  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  226
                NH  FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  442  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNK  497

Query  225  ----LQRLTWNGYENGTPAW  178
                  R+T + YE  TP W
Sbjct  498  DIQEFHRITHSRYEYSTPTW  517



>dbj|BAK07068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 102/199 (51%), Gaps = 32/199 (16%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS +PDG   VFRS R G    HKNLYI+ D+  GE   G +R+LT+G W DT  S
Sbjct  510  NNAFPSSNPDGTKFVFRSTRDGGAELHKNLYIMEDAEVGEFSEGTVRRLTNGPWTDTHCS  569

Query  528  WSPDGKLIAFSSNRHNPGNAD--------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNR  376
            WSP    I FSS+R     A          F++++V   D T + R+     + S+ V  
Sbjct  570  WSPKNDWIVFSSSRDKAAGAPKRDILDPGSFAVFMVMASDPTVVVRV----MKSSDSVA-  624

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG-------  226
              + H  FS D   ++  A+L  V+ EP+S+P   +  +PYGD++ + L  T        
Sbjct  625  GHVTHPMFSPDMRSIVVAADLAAVSTEPISMPQFLHSVRPYGDIFSVDLRDTDDMSKNKD  684

Query  225  ---LQRLTWNGYENGTPAW  178
                 R+T + YE  TP W
Sbjct  685  IKEFHRITHSRYEYATPEW  703



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 110/205 (54%), Gaps = 30/205 (15%)
 Frame = -3

Query  714  LTKETTG-NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQLTDG  553
            L + T G NNAFP  +PDG  +VFRS R G    +KNLYII+ L    +G G I +LT+G
Sbjct  473  LKRLTNGFNNAFPCTNPDGTKLVFRSTRDGGEKKYKNLYIIEDLQSMENGEGEITRLTNG  532

Query  552  AWIDTMPSWSPDGKLIAFSSNRHNPG-------NADCFSIYVVRPDGTGLRRIHVAGAEG  394
             W+DT   WSP G+ I F+SNR+          +   F++Y+V+ D   +  + V G+  
Sbjct  533  PWVDTHCDWSPSGEWIVFASNRNRTTEGMDHGLDTGYFAVYLVKADDPDV-WVKVIGSRS  591

Query  393  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF----QPYGDLYMMRLDGTG  226
             +      +NH  FS D   +   ++L  V+ +P+S+P QF    +PYG+L+++ +D   
Sbjct  592  GDLAG--HVNHPFFSPDGRSLSVVSDLAAVSCDPISLP-QFIHSARPYGELFILDIDHDD  648

Query  225  L---------QRLTWNGYENGTPAW  178
            +         +R+T   YEN T  W
Sbjct  649  IYANEDVEDYRRITHTRYENSTAVW  673



>gb|EMT19136.1| hypothetical protein F775_12749 [Aegilops tauschii]
Length=669

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 103/213 (48%), Gaps = 44/213 (21%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-------GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  535
            N AFPS +P+G  +VFRS       G+   KNL+IID+  GE    G+ QLT+G W DT 
Sbjct  417  NCAFPSTNPEGTKLVFRSSRDRVQGGKREDKNLFIIDAEKGEY--AGVDQLTNGPWTDTH  474

Query  534  PSWSPDGKL--IAFSSNRHNPGNADC---------FSIYVVRPDGTG-----LRRIHVAG  403
             SWSP      I FSS+R  PG A           FS+Y+V           +R IH A 
Sbjct  475  CSWSPREGCDWIVFSSSRGKPGGAPASDHGLDSGYFSVYLVNAKDMAEGVVPVRVIHSAP  534

Query  402  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL--  238
                       +NH  FS D   ++FTA+L  V+ +P+S+P   +  +PYGD++ + L  
Sbjct  535  TIAGH------VNHPVFSPDMMSIVFTADLAAVSVDPISMPHFMHSVRPYGDIFSVELLD  588

Query  237  --------DGTGLQRLTWNGYENGTPAWHPKAE  163
                    D     R+T + YE  TP W P  +
Sbjct  589  REDMAKNKDIHKYHRITHSRYEYSTPTWSPHTD  621



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 107/202 (53%), Gaps = 22/202 (11%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+AFPS +PDG  +V+RS + G KNLYI+++   GE +   + +LT G W DT   WSP 
Sbjct  658  NSAFPSSNPDGTRLVYRSTKHGPKNLYIMENAELGEFEEAKVTRLTKGNWTDTHCQWSPT  717

Query  516  GKLIAFSSNRHNPG--------NADCFSIYVVRPDGTGLR-RIHVAGAEGSEEVNRERLN  364
               I FSSNR  P         +A  F +Y+V  +   +  ++  +G      +    +N
Sbjct  718  QDWIVFSSNRSYPTAKTFEDLPDAGYFGVYLVNANNEDVVIKVIDSGYTYLGGLFPGHVN  777

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL---------Q  220
            H  FS D + ++ TA+L  V+ +PVS+P   +  +PYGD++++ +DG  +          
Sbjct  778  HPFFSPDGKSLVVTADLAAVSCDPVSMPLFLHSVRPYGDIFVVDIDGDDIYKNENLKKFT  837

Query  219  RLTWNGYENGTPAWHPKAEVDL  154
            R+T + YEN T  W   +  DL
Sbjct  838  RVTHSRYENSTGTWTEASTKDL  859



>gb|EMT29283.1| hypothetical protein F775_17496 [Aegilops tauschii]
Length=869

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 96/179 (54%), Gaps = 25/179 (14%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYI-IDSLNGELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS SPDG   VFRS R G    +KNL+I +++ NG+   G   +LT G W DT   
Sbjct  524  NNAFPSSSPDGSKFVFRSTRDGGVKKYKNLHIMLEAENGQSGIGWETRLTKGPWTDTHCQ  583

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG--TGLRRIHVAGAEGSEEV  382
            WSP G  + FSS R  P +AD          FS+Y+V+P      +R +   G  G    
Sbjct  584  WSPTGDWVVFSSTRGKPRDADELDNGLDPGYFSVYLVKPSDPMVVIRVMDSMGDLGGH--  641

Query  381  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQRL  214
                +NH  FS D   +  TA+L  V+ +P+S+P   +  +PYGD++M+ LD   L+ +
Sbjct  642  ----INHPVFSPDGRSIAVTADLAAVSVDPISLPMFMHAVRPYGDIFMIDLDTDNLKNI  696



>ref|XP_010105408.1| hypothetical protein L484_008562 [Morus notabilis]
 gb|EXC04631.1| hypothetical protein L484_008562 [Morus notabilis]
Length=424

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 110/207 (53%), Gaps = 30/207 (14%)
 Frame = -3

Query  699  TGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTM  535
              NNAFPS +P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT 
Sbjct  181  VSNNAFPSTNPAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTH  240

Query  534  PSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEV  382
              WSP G  I FSS R  P +A           F++++V+ +   +    V    GS+  
Sbjct  241  CQWSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSD  296

Query  381  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------  238
                +NH  FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         
Sbjct  297  LAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNK  356

Query  237  DGTGLQRLTWNGYENGTPAWHPKAEVD  157
            D     R+T + YEN T +W P +  D
Sbjct  357  DVEKFNRITHSRYENSTASWTPFSTQD  383



>ref|XP_004980674.1| PREDICTED: uncharacterized protein LOC101756594 [Setaria italica]
Length=1083

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 109/212 (51%), Gaps = 32/212 (15%)
 Frame = -3

Query  717   VLTKETTGN--NAFPSCSPDGKHIVFRSGRS----GHKNLYII-DSLNGELDGGGIRQLT  559
             V  + T G+  NA+PS +P+G  +VF+S R      +KNLYI+ D+  GE   G + +LT
Sbjct  853   VFIQLTKGDFFNAYPSTNPEGTKVVFQSTRDHGDYEYKNLYIMEDAQIGEFGEGSVTRLT  912

Query  558   DGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHV  409
             +G WIDT   WSP G  I FSS R  P  A           F+IY+V   D T + R+  
Sbjct  913   NGPWIDTQCQWSPRGNWIVFSSTRDKPAAAPENYNELDPGHFAIYLVNAADPTVVVRVVT  972

Query  408   AGAEGSEEVNRE-RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP-----NQFQPYGDLYM  247
             +G  G    +    +NH  FS D   + FT+++  V+AEP+S+P        +PYGD++ 
Sbjct  973   SGDPGPGASSIAGHVNHPVFSPDGRSIAFTSDIAAVSAEPISMPMASVMASVRPYGDIFS  1032

Query  246   MRLDGTGL---------QRLTWNGYENGTPAW  178
             + +D   +          R+T + YE  T AW
Sbjct  1033  VDIDPDDICRNKDIDRVHRVTHSRYEYSTNAW  1064



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 105/219 (48%), Gaps = 43/219 (20%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRS------GHKNLYII-DSLNGEL-DGGGIRQ  565
            ++LTK    NNAFPS SPDG   VFRS R        HKNLYI+ D   GE  +GG + +
Sbjct  488  RLLTKGKF-NNAFPSSSPDGTRFVFRSTRDHAKSERKHKNLYIMEDQEVGEYGEGGKVTR  546

Query  564  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIH  412
            LTDG W DT   WSP G  I FSS R  P  A           F++++V+     +    
Sbjct  547  LTDGEWTDTHCQWSPSGDWIVFSSTRDKPPTAAPLDHGLDPGYFAVFMVKASDPAV----  602

Query  411  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMR  241
            V    GS +     +NH  FS +   +  T++L  V+A+P+S+P   +  +PYGD++ + 
Sbjct  603  VIRVVGSGDDLSGHVNHPVFSPNGRSIAVTSDLAAVSADPISLPLFLHSVRPYGDIFAVD  662

Query  240  LDGT------------------GLQRLTWNGYENGTPAW  178
            +D                       R+T + YE  TP W
Sbjct  663  IDDILRLGDDAEKLKKIKDLRRKFHRITHSRYEYSTPEW  701



>ref|XP_010087211.1| hypothetical protein L484_006140 [Morus notabilis]
 gb|EXB28518.1| hypothetical protein L484_006140 [Morus notabilis]
Length=726

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 110/197 (56%), Gaps = 30/197 (15%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGR--SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWS  523
            N+AFPS + +G  +V+RS R    +KNLYI+ D+  GE   G I +LT+G+W DT   WS
Sbjct  487  NSAFPSTNREGTKLVYRSTRGDKRYKNLYIMEDAQVGEYGHGKITRLTNGSWTDTHCQWS  546

Query  522  PDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRE  373
            P G  I FSS R  P +A           F+IY+V+  D + + R+  +G++ +  V   
Sbjct  547  PTGDWIVFSSTRDKPEDAPKSDNGLDPGYFAIYLVKVNDPSVVVRVTGSGSDLTGHV---  603

Query  372  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-------  223
              NH  FS D + ++ T++L GV+ +P+S+P   +  +PYGD++ + +D   +       
Sbjct  604  --NHPFFSPDRKSIVVTSDLAGVSVDPISLPLFLHSVRPYGDIFTIDIDPDDINKNWDVK  661

Query  222  --QRLTWNGYENGTPAW  178
               R+T + YEN T +W
Sbjct  662  EFNRITHSRYENATGSW  678



>ref|XP_003575792.1| PREDICTED: uncharacterized protein LOC100821131 [Brachypodium 
distachyon]
Length=730

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 110/215 (51%), Gaps = 43/215 (20%)
 Frame = -3

Query  720  KVLTKETTG-NNAFPSCSPDGKHIVFRSG--RSG----HKNLYII-DSLNGELDGGGIRQ  565
            K LT +T   NNAFPS + +G  +VFRS   RSG     KNLYI+ D+  G+   G + Q
Sbjct  492  KQLTDDTKKYNNAFPSSNKEGDKLVFRSSCDRSGGDNKFKNLYIMEDATEGDSSAGKVTQ  551

Query  564  LTDGAWIDTMPSWSPDGKLIAFSSNRHN--PG------NADCFSIYVV--RPDGTGLRRI  415
            LT G W DT   WSP    I FSS+R    PG      +A CFSI++V  +     +R +
Sbjct  552  LTKGDWTDTHCCWSPTDDWIVFSSSRDRAPPGTDPAILDAGCFSIFMVNYKDPSVVVRVM  611

Query  414  HVAGAEGSEEVNRERLNHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDL  253
            H          +     HVC   FS D + ++ T+++  V+A+P S+P   +  +PYGD+
Sbjct  612  H---------SDMSLAGHVCHPVFSPDRKSIVVTSDVAAVSADPASLPIFIHSVRPYGDI  662

Query  252  YMMRL----------DGTGLQRLTWNGYENGTPAW  178
            + ++L          D     R+T + YEN TP W
Sbjct  663  FTIKLRDPDCLEKNGDIVEFDRITHSRYENSTPTW  697



>gb|AFB33555.1| hypothetical protein 2_7121_02, partial [Pinus mugo]
Length=152

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  558  DGAWIDTMPSWSPDGKLI  505
            +G W DTM SWSPDG+ I
Sbjct  135  EGPWTDTMCSWSPDGEWI  152



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 101/214 (47%), Gaps = 47/214 (22%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGG----GIRQLTDGAW  547
            NNAFPS SPDG   VFRS R        HKNLYI+ D   GE         + +LTDG W
Sbjct  494  NNAFPSSSPDGTRFVFRSTRDHAKSEKKHKNLYIMEDQEFGEYGYDTVVPKVTRLTDGEW  553

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAE  397
             DT   WSP G  I FSS R  P  A           F++++V+  D T + R+  +G +
Sbjct  554  TDTHCQWSPSGDWIVFSSTRDKPATAAPTDHGLDPGYFAVFMVKASDPTVVIRVVGSGDD  613

Query  396  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD---  235
             S  V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D   
Sbjct  614  LSGHV-----NHPVFSPDGRTIAVTADLAAVSADPISLPLFLHSVRPYGDIFAVDIDDIL  668

Query  234  ---------------GTGLQRLTWNGYENGTPAW  178
                                R+T + YE  TP W
Sbjct  669  RLGDDVEKLKKIKDLKKKFHRITHSRYEYSTPEW  702



>gb|AFG49274.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  558  DGAWIDTMPSWSPDGKLI  505
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCTWSPDGEWI  152



>gb|AEW08359.1| hypothetical protein 2_7121_02, partial [Pinus radiata]
 gb|AFG49263.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49264.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49265.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49266.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49267.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49268.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49269.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49270.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49271.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49272.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49273.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49275.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49276.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49277.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49278.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49279.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49280.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  558  DGAWIDTMPSWSPDGKLI  505
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCTWSPDGEWI  152



>gb|EMS54560.1| hypothetical protein TRIUR3_19354 [Triticum urartu]
Length=136

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = -3

Query  450  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF  271
            +V P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +
Sbjct  1    MVHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKSMVFTSDLAAVSAEPISNPHHY  53

Query  270  QPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            QPYG+++ + +DG+GLQRLT N +E+GTP+W P
Sbjct  54   QPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTP  86



>gb|AFB33549.1| hypothetical protein 2_7121_02, partial [Abies alba]
Length=150

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
            +  K LTKE  GNNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT+G 
Sbjct  80   ISYKTLTKE--GNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLTEGP  135

Query  549  WIDTMPSWSPDGKLI  505
            W DTM +WSPDG+ I
Sbjct  136  WTDTMCNWSPDGEWI  150



>gb|EJL34752.1| periplasmic component of the Tol biopolymer transport system 
[Caulobacter sp. AP07]
Length=602

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 97/185 (52%), Gaps = 23/185 (12%)
 Frame = -3

Query  723  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAW  547
            +K+LTK  TGN  FP  S DG+HIV+R  ++G  N L ++D     LD G    L  G  
Sbjct  432  LKLLTK-GTGNFGFPDWSGDGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPA  483

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
                P+WSP   +IAF+++         + IY +R DG+GL+R+  +    +        
Sbjct  484  HYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLTRSPGNDA--------  530

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
             H  +S D +W+ F +  GG   E +  P   QPYG++Y+MR DG+    LT   +E GT
Sbjct  531  -HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFEKGT  589

Query  186  PAWHP  172
            PAW P
Sbjct  590  PAWAP  594


 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 14/97 (14%)
 Frame = -3

Query  678  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  499
            + SPDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AF
Sbjct  113  ALSPDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAF  167

Query  498  SSNR--HNPGNAD-------CFSIYVVRPDGTGLRRI  415
            SS+R   +P   +          IY+V+ DGT LRR+
Sbjct  168  SSDRVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRV  204


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (48%), Gaps = 27/173 (16%)
 Frame = -3

Query  678  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  499
            S S DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF
Sbjct  69   SFSSDGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAF  123

Query  498  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  322
             S+R   G AD   I+++      LR + H    +              +S D  W+ F+
Sbjct  124  VSSRG--GQAD---IWILDLASKALRNLTHDPAGD----------FRPSWSPDGRWLAFS  168

Query  321  ANLGGVTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++     +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  169  SDR---VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  218



>ref|XP_010102640.1| hypothetical protein L484_010932 [Morus notabilis]
 gb|EXB93790.1| hypothetical protein L484_010932 [Morus notabilis]
Length=717

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 30/198 (15%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPS  529
            NNAFPS +P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT   
Sbjct  476  NNAFPSTNPAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTHCQ  535

Query  528  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            WSP G  I FSS R  P +A           F++++V+ +   +    V    GS+    
Sbjct  536  WSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSDLA  591

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------DG  232
              +NH  FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         D 
Sbjct  592  GHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNKDV  651

Query  231  TGLQRLTWNGYENGTPAW  178
                R+T + YEN T +W
Sbjct  652  EKFNRITHSRYENSTASW  669



>ref|XP_010097467.1| hypothetical protein L484_024672 [Morus notabilis]
 gb|EXB68658.1| hypothetical protein L484_024672 [Morus notabilis]
Length=743

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 114/212 (54%), Gaps = 40/212 (19%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDG  553
            L   TTG  NNAF S + +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G
Sbjct  487  LKTLTTGDFNNAFASTNIEGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEG  544

Query  552  AWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYVVR-PDGTGLRR  418
             W DT   WSP+G  I FSS+R NP  AD               F++Y+V   + + + R
Sbjct  545  KWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVR  604

Query  417  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYM  247
            +  +G + +  V     NH  FS D + ++ T++L  V+ +P+S+P   +  +PYGD+++
Sbjct  605  VAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPISLPLFVHSVRPYGDIFI  659

Query  246  MRLDGTGL---------QRLTWNGYENGTPAW  178
              +D   +         +R T + +E  T +W
Sbjct  660  FDIDTKDIHKNKDLKTFKRATHSRFEYSTVSW  691



>ref|XP_010097483.1| hypothetical protein L484_024689 [Morus notabilis]
 gb|EXB68674.1| hypothetical protein L484_024689 [Morus notabilis]
Length=740

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 112/211 (53%), Gaps = 39/211 (18%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDG  553
            L   TTG  NNAF S + +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G
Sbjct  486  LKTLTTGDFNNAFASTNIEGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEG  543

Query  552  AWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYVVR-PDGTGLRR  418
             W DT   WSP+G  I FSS+R NP  AD               F++Y+V   + + + R
Sbjct  544  KWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVR  603

Query  417  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYM  247
            +  +G + +  V     NH  FS D + ++ T++L  V+ +P S+P   +  +PYGD+++
Sbjct  604  VAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPTSLPLFVHSVRPYGDVFI  658

Query  246  MRLDGTGL--------QRLTWNGYENGTPAW  178
               D   +        +R T + +E  T +W
Sbjct  659  FDFDCNDMNQEDLKTFKRATHSRFEYSTVSW  689



>gb|AEW08360.1| hypothetical protein 2_7121_02, partial [Pinus lambertiana]
 gb|AFB33551.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33552.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K+LTK+   NNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKKD--NNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  558  DGAWIDTMPSWSPDGKLI  505
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCNWSPDGEWI  152



>gb|EMT06488.1| hypothetical protein F775_06751 [Aegilops tauschii]
Length=739

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 104/207 (50%), Gaps = 44/207 (21%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRS--------GHKNLYII-DSLNGELDGGGIRQLTDGAWID  541
            NNAFPS + DG  +VFRS R+         +KNLYI+ D+  GE   G + QLTDG W D
Sbjct  515  NNAFPSSNKDGTKLVFRSTRNRMGKPEDVKYKNLYIMEDADEGEWGSGTVTQLTDGPWTD  574

Query  540  TMPSWSPDGKLIAFSSNRHN-PG-------NADCFSIYVVRPDGTG--LRRIHVAGAEGS  391
            +  +WSP    I FSS+R   PG       +A  FSI++V        +R +H A +   
Sbjct  575  SHCTWSPTDDWIVFSSSRDRAPGAPDRDILDAGFFSIFLVLATDPSVLVRVMHSADSLA-  633

Query  390  EEVNRERLNHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---  238
                     HVC   FS   + ++ T+++ GV+A+PVS+P   +  +PYGD++ + L   
Sbjct  634  --------GHVCHPVFSPFKDSIVVTSDIAGVSADPVSLPIFIHSVRPYGDIFTINLRDK  685

Query  237  -------DGTGLQRLTWNGYENGTPAW  178
                   D     R+T   YE  TP W
Sbjct  686  NDIMKNKDIMEFDRITHTRYEYSTPTW  712



>ref|WP_035092853.1| hypothetical protein [Caulobacter henricii]
Length=625

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 90/174 (52%), Gaps = 21/174 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            ++ FPS S DGK IVFR      K L +I+     LD   IR LT G   D +P WSPDG
Sbjct  471  HSGFPSYSADGKEIVFRVWGEAEKGLRVIN-----LDTRQIRVLTTG--YDNLPFWSPDG  523

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            K I F+       +A  F IY +RPDG+ L+R+           NR    H  +S+D + 
Sbjct  524  KRIVFTRKV----DAVNFDIYTIRPDGSDLQRL---------TTNRGNDGHAVWSADGK-  569

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            +LF+  + G   E     N FQPYG + +M  DGTG + +T + +E+  P + P
Sbjct  570  ILFSTGMYGFREEAALYDNTFQPYGQIMVMSADGTGKRLVTDSLWEDSMPLYLP  623


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 21/105 (20%)
 Frame = -3

Query  675  CSPDGKHIVFRSGRSGHK-NLYIIDSLNGELD----GGGIR---QLTDGAWIDTMPSWSP  520
             SPDG  + F S R G++ N+++ D   G L     G G++    L DG +    P+WSP
Sbjct  122  LSPDGARLAFVSTRDGYRTNIWLKDLKTGRLTNLTGGEGVQGDPSLPDGFF---RPAWSP  178

Query  519  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  415
            DGK +AFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  179  DGKWLAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  223



>gb|AFB33553.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33554.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K+LTK+   NNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKKD--NNAFPSPSPDGKFVVFRSGRNGHKNLYIMDAEEGEE--GGLWQLT  134

Query  558  DGAWIDTMPSWSPDGKLI  505
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCNWSPDGEWI  152



>gb|AFB33550.1| hypothetical protein 2_7121_02, partial [Larix decidua]
Length=152

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 4/78 (5%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  559
            E  +  K LTK    NNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKTLTK--VDNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  558  DGAWIDTMPSWSPDGKLI  505
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCNWSPDGEWI  152



>emb|CDM86908.1| unnamed protein product [Triticum aestivum]
Length=731

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 100/199 (50%), Gaps = 38/199 (19%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGR--------SGHKNLYII-DSLNGELDGGGIRQLTDGAWID  541
            N+AFPS +P G   VFRS R        + + NLYI+ D+  GE   G + QLTDG W D
Sbjct  494  NDAFPSSNPAGTKFVFRSTRNRSGRPEDAKYNNLYIMEDAEEGEWGEGTVTQLTDGPWTD  553

Query  540  TMPSWSPDGKLIAFSSNRHNP--GNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
            +  SWSP G  I FSS+R      +A CFSI++V      +  + V    G         
Sbjct  554  SHCSWSPRGDWIVFSSSRDRDILDSAGCFSIFLVLATDRKV-LVRVMSLPG---------  603

Query  366  NHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG-------  226
             HVC   FS D + ++ T+++  V+A+PVS+P      +PYGD++ ++L  T        
Sbjct  604  -HVCHPIFSPDMDNLVVTSDVAVVSADPVSLPIFIASGRPYGDMFSIKLRDTTDINKNKD  662

Query  225  ---LQRLTWNGYENGTPAW  178
                 R+T   YE   P+W
Sbjct  663  IMEFHRITHTRYEYSKPSW  681



>gb|EJE50504.1| periplasmic component of the Tol biopolymer transport system 
[Acidovorax sp. CF316]
Length=637

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -3

Query  723  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            ++ LT ++  N  FPS S DGK +VFR       +  +       L+   IR +T G   
Sbjct  460  LEQLTDDSVFNAGFPSYSADGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--Y  517

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A           
Sbjct  518  DNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------  568

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
             H  +++D + +L+ +   G   E       FQPYG +++M  DG+G +++T + +E+ T
Sbjct  569  GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDST  628

Query  186  PAWHP  172
            P + P
Sbjct  629  PQYAP  633


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (49%), Gaps = 21/169 (12%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQ  565
             +++ LT  +   +A  + SPD   + F S R G   N++++D    +L       GI+ 
Sbjct  101  TQVERLTDGSIVEDA-AALSPDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQG  159

Query  564  LTDGAWIDTMPSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  415
              D       PSWSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTG R+I
Sbjct  160  RADSPNGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKI  219

Query  414  HVAG--AEGSEEVNRERLNHVCFSSDSE---WVLFTANLGGVTAEPVSI  283
                   +GS + + +    V + + +E   WVL    L  + ++ VS+
Sbjct  220  SSRKDYCQGSPKWSADGKRIVFYETQAEYTYWVLRPDLLLKIDSQIVSV  268



>ref|WP_035205184.1| hypothetical protein [Acidovorax sp. CF316]
Length=622

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -3

Query  723  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            ++ LT ++  N  FPS S DGK +VFR       +  +       L+   IR +T G   
Sbjct  445  LEQLTDDSVFNAGFPSYSADGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--Y  502

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A           
Sbjct  503  DNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------  553

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
             H  +++D + +L+ +   G   E       FQPYG +++M  DG+G +++T + +E+ T
Sbjct  554  GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDST  613

Query  186  PAWHP  172
            P + P
Sbjct  614  PQYAP  618


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (49%), Gaps = 21/169 (12%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQ  565
             +++ LT  +   +A  + SPD   + F S R G   N++++D    +L       GI+ 
Sbjct  86   TQVERLTDGSIVEDA-AALSPDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQG  144

Query  564  LTDGAWIDTMPSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  415
              D       PSWSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTG R+I
Sbjct  145  RADSPNGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKI  204

Query  414  HVAG--AEGSEEVNRERLNHVCFSSDSE---WVLFTANLGGVTAEPVSI  283
                   +GS + + +    V + + +E   WVL    L  + ++ VS+
Sbjct  205  SSRKDYCQGSPKWSADGKRIVFYETQAEYTYWVLRPDLLLKIDSQIVSV  253



>ref|WP_020604165.1| hypothetical protein [Spirosoma spitsbergense]
Length=612

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 97/176 (55%), Gaps = 20/176 (11%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N+ FPS SPDG+ IV+R        L I++ LN +L    ++ LT     D +P WSPDG
Sbjct  454  NSGFPSWSPDGQRIVYRVWGEKDSGLRILN-LNDKL----VQVLTTE--YDNLPFWSPDG  506

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
             LI+F+  +H+  N   F I+ +RPDGT LR++    A  +         H  +++DS+ 
Sbjct  507  SLISFT-RKHDDNN---FDIFTIRPDGTNLRQLTTTPANDA---------HAYWTADSKH  553

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  166
            +++++ + G   E     N FQPYG ++ M  DG+  ++LT + +E+  P   PKA
Sbjct  554  LMWSSGIYGFKDEAALYDNTFQPYGAIFSMNADGSDKRQLTDSAWEDSMPVVVPKA  609


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 87/196 (44%), Gaps = 24/196 (12%)
 Frame = -3

Query  726  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            E K+L   T+G +   S S +G+ IVF S R+G   L   D      DG  + +LTD   
Sbjct  57   ERKLLA--TSGLDYHASYSGNGQWIVFTSERNG---LGQADIYRVHPDGTALERLTDSPA  111

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
            +D   + SPDG  + F S R         +I+++      + ++    A   +       
Sbjct  112  LDDQAALSPDGSKVTFVSTRE----MHTANIWLLDIKSKKVTKLTALPAIQGDSTKPNGF  167

Query  366  NHVCFSSDSEWVLFTAN-----LG---GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  211
                +S D +W+ F ++     LG   G   E V      Q  G +Y++  DGTGL++L+
Sbjct  168  FRPSWSPDGKWIAFASDRNTQWLGHGNGAGWEHV------QELG-IYVVHPDGTGLRKLS  220

Query  210  WNGYENGTPAWHPKAE  163
              G  +G+P W P  +
Sbjct  221  QAGICSGSPKWSPDGK  236



>ref|XP_006658881.1| PREDICTED: uncharacterized protein LOC102705738, partial [Oryza 
brachyantha]
Length=502

 Score = 87.8 bits (216),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 4/69 (6%)
 Frame = -3

Query  738  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG---IR  568
            E+   +KVLT+  +GN+AFP+ SP GK IVFRSGRSGHKNLYI+D+ +GE DG G   IR
Sbjct  435  EVAATLKVLTRPESGNDAFPAVSPCGKWIVFRSGRSGHKNLYIVDAAHGE-DGAGEGTIR  493

Query  567  QLTDGAWID  541
            +LTDG WID
Sbjct  494  RLTDGEWID  502


 Score = 33.5 bits (75),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -2

Query  844  TSIGPIFESVKATVQIARL  788
            TS+GPIFE+ KATV+IARL
Sbjct  404  TSMGPIFETHKATVRIARL  422



>ref|WP_006298539.1| hypothetical protein [Hylemonella gracilis]
 gb|EGI76207.1| hypothetical protein HGR_12282 [Hylemonella gracilis ATCC 19624]
Length=638

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -3

Query  723  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            ++ LT ++  N  FPS S DGK +VFR      K+  +       L+   IR++T G   
Sbjct  461  LEQLTDDSIFNAGFPSYSADGKEVVFRIANEDPKSASLGGLAVLNLETRQIRRITAG--Y  518

Query  543  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ L+R+    A           
Sbjct  519  DNMPIWSPDGSRILFNRGVRNPNSIWSNFDLYTVRPDGSDLQRLTSHPASD---------  569

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
             H  ++ D + +L+ + + G   E       FQPYG L++M  DG   +++T + +E+ T
Sbjct  570  GHPVWTPDGKQILYNSGMAGYRDEACHYDQTFQPYGQLFVMDADGRNKRQITDSIWEDST  629

Query  186  PAWHP  172
            P + P
Sbjct  630  PQYVP  634


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 82/176 (47%), Gaps = 33/176 (19%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH-KNLYIIDSLNGELDGGGIRQLT--  559
             +++ LT     ++A    SPDG  + F S R G   N++++D     L    +R LT  
Sbjct  100  TQVERLTDSPAVDDA-AVFSPDGSKVAFVSTRDGFLANIWVLD-----LQTRKLRNLTGI  153

Query  558  DGAWIDTM---------PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPD  436
             G   D +         PSWSPDG+ +AFSS+R      H+ G    +    SIYV+R D
Sbjct  154  KGVQADDLQNSPSGFFRPSWSPDGQWLAFSSDRNTEWKGHHDGAGWEHTQELSIYVIRVD  213

Query  435  GTGLRRI-----HVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  283
            GTGLRR+     H  G+       +  + +   +  + WVL    L  + ++ VS+
Sbjct  214  GTGLRRVASRKDHCLGSPRWSGDGKRIVFYETLAEYTYWVLRPDLLLKIDSQIVSV  269



>gb|KFY81759.1| hypothetical protein V500_11119 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=665

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 90/175 (51%), Gaps = 22/175 (13%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+ FPS SPDG  +V+R  G  G   L I++     L       LTD  W D  P WSPD
Sbjct  500  NSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-DNNPGWSPD  552

Query  516  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            G+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  553  GELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA---------HAAWS  603

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E+  P
Sbjct  604  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWEDSMP  657



>gb|KFZ03462.1| hypothetical protein V502_10931 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=666

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 94/184 (51%), Gaps = 24/184 (13%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LTD  W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-  543

Query  543  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            D  P WSPDG+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA-----  598

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWE  653

Query  195  NGTP  184
            +  P
Sbjct  654  DSMP  657



>ref|WP_029915040.1| hypothetical protein [Caulobacter sp. UNC358MFTsu5.1]
Length=618

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 90/174 (52%), Gaps = 21/174 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            ++ FPS S DGK IVFR     +  L +I+     LD   +R LT G  +D +P WSPDG
Sbjct  464  HSGFPSYSADGKEIVFRVWGENNMGLRVIN-----LDTREVRTLTTG--LDNLPFWSPDG  516

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            K I F+       +A  F ++ +RPDG+ L+R+           NR    H  +++D   
Sbjct  517  KRIVFTRKV----DAVNFDVFTIRPDGSDLQRL---------TTNRGNDGHAVWTADGR-  562

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            +L++  + G   E     N FQPYG + +M  DGTG + LT + +E+  P + P
Sbjct  563  ILWSTGMYGFREEAALYDNTFQPYGQIMVMNADGTGKRLLTDSLWEDSMPLYLP  616


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 21/105 (20%)
 Frame = -3

Query  675  CSPDGKHIVFRSGRSGHK-NLYIID-------SLNGELDGGGIRQLTDGAWIDTMPSWSP  520
             SPDG  + F S R G++ N++I D       +L G  D  G   L DG +    P+WSP
Sbjct  115  LSPDGTRLAFVSTREGYRTNIWIKDLKSGRLTNLTGAADVQGDPSLPDGFF---RPAWSP  171

Query  519  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  415
            DGK IAFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  172  DGKQIAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  216



>gb|KFY12538.1| hypothetical protein V491_06750 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=665

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 94/184 (51%), Gaps = 24/184 (13%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LT   W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYREFGPDGPLGLRIMN-----LADKTTTNLT-ADW-  543

Query  543  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            D  PSWSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPSWSPDGKRIVFTRRNHINWDDIGATDSFDIYTIAPDGTGLAQLTTSGANDA-----  598

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+  + LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFREESVNYDNTFQPYGQIVIMDADGSNKRMLTDSMWE  653

Query  195  NGTP  184
            +  P
Sbjct  654  DSMP  657



>ref|NP_001066679.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|ABA97669.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29698.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|EAY82937.1| hypothetical protein OsI_38155 [Oryza sativa Indica Group]
 gb|EAZ20324.1| hypothetical protein OsJ_35933 [Oryza sativa Japonica Group]
Length=777

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 99/216 (46%), Gaps = 52/216 (24%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRS-------GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  535
            N AFPS + +G  +VFRS R+        HKNLYIID+  GE    G+  LTDG W DT 
Sbjct  517  NCAFPSTNAEGTKLVFRSSRNRVAGGERQHKNLYIIDAEKGE--AAGVVPLTDGPWTDTH  574

Query  534  PSWSPDGKL--IAFSSN----------RHNPG-----NADCFSIYVVRPDGTG-------  427
             SWSP      I FSS           +  P      +   F++Y+V             
Sbjct  575  CSWSPREGCDWIVFSSTGRPEKDIVKGKDEPEKDHGLDPGYFAVYLVNAKDIKKGEVPVP  634

Query  426  LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGD  256
            +R IH A            +NH  FS D + ++F A+L  V+A+P+S+P   +  +PYGD
Sbjct  635  VRVIHSAPTIAGH------INHPVFSPDMKSIVFAADLAAVSADPISMPHFTHSVRPYGD  688

Query  255  LYMMRLDGTG----------LQRLTWNGYENGTPAW  178
            ++ + L  T             R+T + YE  TP W
Sbjct  689  IFSVNLRDTTDMAKNRDIQEFHRITHSRYEYSTPTW  724



>ref|WP_043399319.1| tolB protein precursor protein, partial [Cystobacter violaceus]
Length=349

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 102/210 (49%), Gaps = 39/210 (19%)
 Frame = -3

Query  729  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  550
             E+  LT+   GN   PS SPDG  + F S R+G   +Y++ +     DG  +R+LT   
Sbjct  149  AEVTRLTQAPEGNFE-PSVSPDGTQVAFVSSRTGDPEIYVMKA-----DGTDVRRLTSFH  202

Query  549  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE-----  385
              D  P WSPDGK I+F S+R          ++VV+PDGTGLR +  +   G E      
Sbjct  203  KEDMAPKWSPDGKWISFLSDREG-----RVRVFVVKPDGTGLRAVSGSQQTGEEREPVWS  257

Query  384  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPN--------QFQPYG----------  259
             + ++L  V  + D +  ++ A++GG   EPV++ +        ++ P G          
Sbjct  258  PDGKKLAFVGRAKDQKSRIWVADMGG--GEPVALTDGKSTDDQPEWSPDGKYLAFASERT  315

Query  258  ---DLYMMRLDGTGLQRLTWNGYENGTPAW  178
               +L++MR +G+G  +LT     +  P W
Sbjct  316  GDVELFLMRANGSGQTQLTSTKGADWLPRW  345



>gb|KFY42678.1| hypothetical protein V495_04387 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY59861.1| hypothetical protein V497_04044 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=665

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 24/186 (13%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            LT  T G  N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W 
Sbjct  491  LTFGTAGEVNSGFPSFSPVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-  543

Query  543  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
                H  +S+D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E
Sbjct  599  ----HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWE  653

Query  195  NGTPAW  178
            +  P +
Sbjct  654  DSMPVY  659



>gb|KFY02373.1| hypothetical protein O988_02191 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=665

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 24/186 (13%)
 Frame = -3

Query  714  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  544
            LT  T G  N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W 
Sbjct  491  LTFGTAGEVNSGFPSFSPFGDQLVYRDFGPDGGLGLRILN-----ITDKTTINLTDG-W-  543

Query  543  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  375  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
                H  +S+D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E
Sbjct  599  ----HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWE  653

Query  195  NGTPAW  178
            +  P +
Sbjct  654  DSMPVY  659



>gb|KFX90155.1| hypothetical protein V490_06619 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=665

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 90/177 (51%), Gaps = 22/177 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W D  P WSPD
Sbjct  500  NSGFPSFSPVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-DNNPGWSPD  552

Query  516  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  ++
Sbjct  553  GKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWT  603

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            +D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E+  P +
Sbjct  604  ADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWEDSMPVY  659



>gb|KFY15902.1| hypothetical protein V492_01680 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=652

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 89/175 (51%), Gaps = 22/175 (13%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+ FPS SPDG  +V+R  G  G   L I++  +          LT+  W D  P WSPD
Sbjct  487  NSGFPSFSPDGTQLVYRDFGPDGGLGLRILNIADNT-----TTTLTED-W-DNNPGWSPD  539

Query  516  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  540  GKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLMQLTTSGANDA---------HAAWS  590

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  591  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>ref|WP_035035180.1| hypothetical protein, partial [Caulobacter sp. AP07]
Length=544

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 91/177 (51%), Gaps = 23/177 (13%)
 Frame = -3

Query  723  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAW  547
            +K+LTK  TGN  FP  S DG+HIV+R  ++G  N L ++D     LD G    L  G  
Sbjct  390  LKLLTK-GTGNFGFPDWSGDGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPA  441

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
                P+WSP   +IAF+++         + IY +R DG+GL+R+  +    +        
Sbjct  442  HYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLTRSPGNDA--------  488

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  196
             H  +S D +W+ F +  GG   E +  P   QPYG++Y+MR DG+    LT   +E
Sbjct  489  -HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFE  544


 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 14/97 (14%)
 Frame = -3

Query  678  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  499
            + SPDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AF
Sbjct  71   ALSPDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAF  125

Query  498  SSNR--HNPGNAD-------CFSIYVVRPDGTGLRRI  415
            SS+R   +P   +          IY+V+ DGT LRR+
Sbjct  126  SSDRVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRV  162


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (48%), Gaps = 27/173 (16%)
 Frame = -3

Query  678  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  499
            S S DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF
Sbjct  27   SFSSDGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAF  81

Query  498  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  322
             S+R   G AD   I+++      LR + H    +              +S D  W+ F+
Sbjct  82   VSSRG--GQAD---IWILDLASKALRNLTHDPAGD----------FRPSWSPDGRWLAFS  126

Query  321  ANLGGVTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            ++     +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  127  SDR---VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  176



>ref|XP_001545913.1| hypothetical protein BC1G_15641 [Botrytis cinerea B05.10]
 gb|EMR86797.1| putative tat pathway signal sequence domain-containing protein 
[Botrytis cinerea BcDW1]
 emb|CCD52696.2| similar to prolyl oligopeptidase [Botrytis cinerea T4]
Length=674

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 86/176 (49%), Gaps = 18/176 (10%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N  FPS SPDG  IV+R    G   LY I      L  G +  LTD  W D  P WSPDG
Sbjct  507  NAGFPSYSPDGTKIVYR--ECGPAPLYCIGLRILNLADGTVTNLTD-TW-DNTPGWSPDG  562

Query  513  KLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  346
            + I F+   H    +  + D + +Y + P+GTGL ++  +GA  +         H  +S+
Sbjct  563  ERIVFTRRNHLNFDDLSSTDSYDVYTIFPNGTGLTQVTTSGANDA---------HAVWSA  613

Query  345  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            D   +L+++ + G   E     N FQPYG +  M  DG+    LT + +E+  P +
Sbjct  614  DGR-ILYSSGMYGFREESPLYDNAFQPYGQIISMNFDGSNKTMLTDSMWEDSMPLY  668



>ref|WP_034400879.1| translocation protein TolB [Candidatus Pelagibacter ubique]
Length=441

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 109/245 (44%), Gaps = 48/245 (20%)
 Frame = -3

Query  795  LVSXFDPSNLTddgdddsDEIP----VEIKVLTKETTGN----NAFPSCSPDGKHIVFRS  640
            L   F+P++           +P    ++I+  T+E  GN       P  SPDGK IV   
Sbjct  206  LTPRFNPTSQMVTYMSYFRNMPRVYLLDIETGTQEVVGNFPGMTFAPRFSPDGKKIVMSF  265

Query  639  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  460
             + G+ ++Y +D     LD   + ++TD + IDT PS+SPDGK IAF+S+R     +   
Sbjct  266  AKDGNSDIYTMD-----LDTRVVERITDHSSIDTSPSFSPDGKFIAFNSDR-----SGLQ  315

Query  459  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP  280
             IYV+R DG+G++RI          V   R + + F+   +                   
Sbjct  316  QIYVMRSDGSGVKRITFGNGIYGTPVWSPRGDLIAFTKMRK-------------------  356

Query  279  NQFQPYGDLYM--MRLDGTGLQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKF  106
                  G  Y+  MR DGTG + LT N Y+   P+W P   V L      K+G K  G F
Sbjct  357  ------GRFYIGVMRTDGTGERLLTENYYQEA-PSWSPNGRV-LVFYRETKAGSKGEG-F  407

Query  105  DEPLW  91
               LW
Sbjct  408  SAKLW  412



>gb|KFZ05841.1| hypothetical protein V501_07970 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=665

 Score = 87.8 bits (216),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 89/177 (50%), Gaps = 22/177 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+ FPS SPDG  +V+R  G  G   L I++     L       LT+  W D  P WSPD
Sbjct  500  NSGFPSFSPDGTQLVYRDFGPEGGLGLRILN-----LADRTTTNLTED-W-DNNPGWSPD  552

Query  516  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            G+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  553  GERIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  603

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            +D   +++T+ + G   E V+  N FQPYG +  M  DG+    +T + +E+  P +
Sbjct  604  ADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVAMNADGSNKTLVTDSMWEDSMPVY  659



>gb|KFY39698.1| hypothetical protein V494_03875 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=652

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 89/175 (51%), Gaps = 22/175 (13%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+ FPS SP+G  +V+R  G  G   L I++  +          LT+  W D  P WSPD
Sbjct  487  NSGFPSFSPNGTQLVYRDFGPDGGLGLRILNIADNT-----TTTLTED-W-DNNPGWSPD  539

Query  516  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  540  GKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  590

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  591  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>ref|WP_020383615.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=342

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 94/201 (47%), Gaps = 44/201 (22%)
 Frame = -3

Query  696  GNNAFPSCSPDGKHIVFRSGRSGH--------KNLYIIDSLNGELDGGGIRQLTDGAWID  541
            G + FPS SPDGKHIVF S R GH          +Y++D+     DGG  ++LT+    D
Sbjct  167  GEDRFPSWSPDGKHIVFSSRRDGHFRGNFGITHEIYVMDT-----DGGNQQRLTENRTND  221

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
              PSWSPDGK IAFSS+R   G+ + F IYV+  DG   +++           NR     
Sbjct  222  WHPSWSPDGKRIAFSSDRK--GDFENFEIYVMDADGGNQQKL---------TENRVYDWR  270

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
              +S D++ + F +   G                ++Y+M  DG   Q LT N   +  PA
Sbjct  271  PSWSPDAKRITFASERDGNY--------------EIYVMDADGGNPQNLTNNPNYDALPA  316

Query  180  WHPKAEVDLARLSLGKSGEKL  118
            W   A       S+  +G+K 
Sbjct  317  WFGSA------FSVSPAGKKF  331


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 89/182 (49%), Gaps = 34/182 (19%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRS----GHKNL--YIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  520
            PS SPDGK IVF S R     GH NL  Y++D+     DGG  + LT+    D  PSWSP
Sbjct  122  PSWSPDGKRIVFTSRRKKDADGHFNLEIYVMDA-----DGGNQQNLTNNPGEDRFPSWSP  176

Query  519  DGKLIAFSSNR--HNPGN-ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            DGK I FSS R  H  GN      IYV+  DG   +R+           NR    H  +S
Sbjct  177  DGKHIVFSSRRDGHFRGNFGITHEIYVMDTDGGNQQRL---------TENRTNDWHPSWS  227

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  169
             D + + F+++  G           F+ + ++Y+M  DG   Q+LT N   +  P+W P 
Sbjct  228  PDGKRIAFSSDRKG----------DFENF-EIYVMDADGGNQQKLTENRVYDWRPSWSPD  276

Query  168  AE  163
            A+
Sbjct  277  AK  278


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 81/192 (42%), Gaps = 35/192 (18%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRSGH----------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMP  532
            PS SP GK I F S R GH            +Y++D+     DGG  + LT+    D  P
Sbjct  68   PSWSPHGKRIAFVSDRDGHFRADMPDIPSYGIYVMDA-----DGGNQQNLTNDLSDDRSP  122

Query  531  SWSPDGKLIAFSSNRHNPGNADC-FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  355
            SWSPDGK I F+S R    +      IYV+  DG   + +     E           H+ 
Sbjct  123  SWSPDGKRIVFTSRRKKDADGHFNLEIYVMDADGGNQQNLTNNPGEDRFPSWSPDGKHIV  182

Query  354  FSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  175
            FSS  +   F  N  G+T E             +Y+M  DG   QRLT    EN T  WH
Sbjct  183  FSSRRD-GHFRGNF-GITHE-------------IYVMDTDGGNQQRLT----ENRTNDWH  223

Query  174  PKAEVDLARLSL  139
            P    D  R++ 
Sbjct  224  PSWSPDGKRIAF  235


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 79/176 (45%), Gaps = 27/176 (15%)
 Frame = -3

Query  675  CSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  496
            C      I F S R G   +Y++D     ++GG  + LT+    D  PSWSP GK IAF 
Sbjct  26   CVDAQAQIAFVSRRDGDPEIYVMD-----INGGNPQNLTNHPDRDWDPSWSPHGKRIAFV  80

Query  495  SNRHNPGNAD-----CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWV  331
            S+R     AD      + IYV+  DG   + +       + +++ +R     +S D + +
Sbjct  81   SDRDGHFRADMPDIPSYGIYVMDADGGNQQNL-------TNDLSDDR--SPSWSPDGKRI  131

Query  330  LFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
            +FT+          ++        ++Y+M  DG   Q LT N  E+  P+W P  +
Sbjct  132  VFTSRRKKDADGHFNL--------EIYVMDADGGNQQNLTNNPGEDRFPSWSPDGK  179



>gb|KFY74302.1| hypothetical protein V499_05663 [Pseudogymnoascus pannorum VKM 
F-103]
Length=667

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 89/177 (50%), Gaps = 22/177 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            N+ FP  SPDG  +V+R  G  G   L I++     L       LT+  W D  P WSPD
Sbjct  502  NSGFPGFSPDGTQLVYRDFGPGGGLGLRILN-----LADKTTTNLTED-W-DNNPGWSPD  554

Query  516  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            G+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  555  GERIVFTRRNHIKWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  605

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P +
Sbjct  606  ADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVVMNADGSNKTLVTDSMWEDSMPVY  661



>gb|ENH85242.1| WD40 domain protein beta propeller [Colletotrichum orbiculare 
MAFF 240422]
Length=655

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 89/176 (51%), Gaps = 22/176 (13%)
 Frame = -3

Query  699  TGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  520
            T ++ FPS SPDG  IVFR     +  L ++D     L    +R LTD    D +PSWSP
Sbjct  497  TVHSGFPSYSPDGGSIVFREWGVRY-GLRVVD-----LATRAVRNLTDA--TDNLPSWSP  548

Query  519  DGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDS  340
            DG  I F+       +A  F +  +RPDG+GLR +  +GA  +         H  +++D 
Sbjct  549  DGTRIVFTRKV----DAANFDVCTIRPDGSGLRVLTSSGANDA---------HAVWTADG  595

Query  339  EWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
              +L+++ + G   E  +    FQPYG + +M  DG   + LT + +E+  P + P
Sbjct  596  R-ILYSSGMYGFRDEAAAYDQTFQPYGQIVVMDADGANKRMLTDSLWEDSMPLYVP  650


 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 25/107 (23%)
 Frame = -3

Query  675  CSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLTDGAWI--DTM-------PSW  526
             SPDG  + + S  +G++ N++++D   GE      R LTD   +  D +       PSW
Sbjct  139  LSPDGTKLAYVSTENGYRANIWVLDLATGER-----RNLTDTPEVAGDPLLPDGHFRPSW  193

Query  525  SPDGKLIAFSSNRHNP----GN------ADCFSIYVVRPDGTGLRRI  415
            SPDG  IAF+S+R+ P    GN          S+Y +RPDGTG R+I
Sbjct  194  SPDGGWIAFASDRNTPWRGHGNGTGWEHTQELSVYAIRPDGTGFRQI  240



>gb|AFK45973.1| unknown [Medicago truncatula]
Length=97

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -3

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  154
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  1    MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  59

Query  153  ARLSLGKSGEKLRGKFDEPLWINS  82
              + + K G      F++  W+N+
Sbjct  60   VNVEMPKGGPYC--SFEDCHWLNN  81



>ref|XP_007914327.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
 gb|EOO00969.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
Length=679

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 87/176 (49%), Gaps = 23/176 (13%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  520
            N  FPS SPDG  +V+R     +G   LYI+D     L  G   +LTDG W D  P WSP
Sbjct  512  NAGFPSFSPDGTKLVYRLWDWNNGPLGLYIMD-----LATGNTTRLTDG-W-DNTPGWSP  564

Query  519  DGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  352
            DGKLI F+   +    N    D F I  ++PDGT L+ +  + A  +         H  +
Sbjct  565  DGKLIVFTRQTNWTWGNSWELDRFDICTIKPDGTDLKVLTESQANDA---------HAVW  615

Query  351  SSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            S D   +++++ + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  616  SLDGR-IMYSSGMYGFRDESSLYDNTFQPYGQIIVMNADGSNKTMLTDSMWEDSMP  670



>ref|WP_027978304.1| hypothetical protein [gamma proteobacterium L18]
Length=628

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 84/176 (48%), Gaps = 19/176 (11%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N  FPS SPDGK IV+R      + L I+D     +D     +LT  A  D +P WSPDG
Sbjct  468  NAGFPSYSPDGKKIVYRVWSPKVQGLRILD-----VDTRQTTELTSEA--DNLPGWSPDG  520

Query  513  KLIAFSSNRHNPGNADCF--SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDS  340
              I F+    NP + + F   +Y ++PDGTG+ R+   GA            H  +  D 
Sbjct  521  SKIVFTRKEINPADPNKFHYDVYTIKPDGTGVTRLTTPGAN---------QGHAVWLYDG  571

Query  339  EWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
              + +++ + G   E     N FQP G  ++M  DG+G   +T   +E+  P + P
Sbjct  572  R-IAYSSGVYGFRDELALYDNTFQPDGQNWVMNADGSGQHAITDTLWEDSMPLYVP  626


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 14/193 (7%)
 Frame = -3

Query  726  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS--GHKNLYIIDSLNGELDGGGIRQLTDG  553
            E K+L  +T G +   S S DG+ IVF S R   G  NLY +     + DG  +++LTD 
Sbjct  49   EHKLL--QTPGFDYHASFSKDGQWIVFTSERDGLGEANLYRV-----KADGTELKRLTDH  101

Query  552  AWIDTMPSWSP-DGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  376
              ID    +SP D  +IAF S+R          I+ +      L+  +V G    +    
Sbjct  102  VAIDDAAVFSPTDPNVIAFVSSRRGKDAFGTTHIWTLNIATGALK--NVTGDIKFDPGLP  159

Query  375  ERLNHVCFSSDSEWVLFTANLGGV-TAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN-G  202
                   +S D +W+  ++++G       + +  +      +Y++  DG+G +++  N G
Sbjct  160  HSFFRPTWSPDGKWIALSSDIGSQWRGHNLPVGWERTQESSIYIIHPDGSGWKKIASNPG  219

Query  201  YENGTPAWHPKAE  163
            ++ G+P W P  +
Sbjct  220  FDEGSPTWSPDGK  232



>ref|WP_041305462.1| hypothetical protein, partial [Herpetosiphon aurantiacus]
Length=173

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 17/122 (14%)
 Frame = -3

Query  696  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            G++  PS SPDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPD
Sbjct  42   GDDQSPSWSPDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPD  96

Query  516  GKLIAFSSNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSD  343
            G LIAF+S+R    P   +   +YV++PDG GL+ +       +E   R R  H  +S D
Sbjct  97   GSLIAFTSDRGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPD  146

Query  342  SE  337
            S+
Sbjct  147  SQ  148


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 82/173 (47%), Gaps = 27/173 (16%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  502
            P+ SPDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +A
Sbjct  3    PTWSPDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLA  57

Query  501  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  322
            F SNR   GN +   +Y++  DG+ LR++    A         R     +S D   + FT
Sbjct  58   FQSNRS--GNDE---LYLINRDGSNLRQLTNDPA---------RDWQPSWSPDGSLIAFT  103

Query  321  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
            ++ G  T  P    +Q      LY+++ DG GL+ LT        PAW P ++
Sbjct  104  SDRGAQT--PDGWNDQ------LYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  148



>gb|ETI58852.1| hypothetical protein C100_22665 [Sphingobium sp. C100]
Length=611

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 84/170 (49%), Gaps = 21/170 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            ++ FPS S DGK IVFR      K L +++     LD    R LT G  +D +P WSPDG
Sbjct  456  HSGFPSYSADGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDG  508

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            K I F+  R + GN   F IY ++PDG+GL R     +            H  +S D   
Sbjct  509  KRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-  554

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            ++++ +  G   E       FQ YG +Y+M  DG+  + LT + +E+  P
Sbjct  555  IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMP  604


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 27/121 (22%)
 Frame = -3

Query  717  VLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT------  559
            ++T ++  + A    SPDG+ + F S R G++ N+++ D   G       RQLT      
Sbjct  93   IITTDSLDDAAM--LSPDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVH  145

Query  558  -DGAWIDTM--PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRR  418
             +  + D    P+WSPDGK +AFSS+R      H+ G    +    SIY++RPDGTG R+
Sbjct  146  GEDLYPDCYFRPAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRK  205

Query  417  I  415
            +
Sbjct  206  V  206



>ref|WP_031310342.1| hypothetical protein [Sphingobium sp. C100]
Length=621

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 85/172 (49%), Gaps = 21/172 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            ++ FPS S DGK IVFR      K L +++     LD    R LT G  +D +P WSPDG
Sbjct  466  HSGFPSYSADGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDG  518

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            K I F+  R + GN   F IY ++PDG+GL R     +            H  +S D   
Sbjct  519  KRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-  564

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            ++++ +  G   E       FQ YG +Y+M  DG+  + LT + +E+  P +
Sbjct  565  IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMPLY  616


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 27/121 (22%)
 Frame = -3

Query  717  VLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT------  559
            ++T ++  + A    SPDG+ + F S R G++ N+++ D   G       RQLT      
Sbjct  103  IITTDSLDDAAM--LSPDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVH  155

Query  558  -DGAWIDTM--PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRR  418
             +  + D    P+WSPDGK +AFSS+R      H+ G    +    SIY++RPDGTG R+
Sbjct  156  GEDLYPDCYFRPAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRK  215

Query  417  I  415
            +
Sbjct  216  V  216



>emb|CAE05101.3| OSJNBa0009K15.21 [Oryza sativa Japonica Group]
 gb|EAZ30049.1| hypothetical protein OsJ_14105 [Oryza sativa Japonica Group]
Length=139

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = -3

Query  366  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  187
            NH  FSSDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GT
Sbjct  33   NHPWFSSDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRRLTHNSFEDGT  92

Query  186  PAWHPKAEVDLARLSLGKSGEKL----RGKFDEPLWIN  85
            P+W P        L     GE L    R  F +  W+N
Sbjct  93   PSWTPY------FLDPRDVGETLQASGRCAFQDCHWLN  124



>gb|ESZ89568.1| hypothetical protein SBOR_10048 [Sclerotinia borealis F-4157]
Length=677

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 83/176 (47%), Gaps = 18/176 (10%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N+ FPS SPDG  IV+R    G   LY I      L  G I  LTD  W D  P WS DG
Sbjct  508  NSGFPSFSPDGTQIVYRD--CGPAPLYCIGLRILNLTDGTITNLTD-TW-DNTPGWSADG  563

Query  513  KLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  346
            + I F+   H    + G+ D + IY + P+GTGL ++  +G   +         H  ++ 
Sbjct  564  ERIVFTRRNHLDFTDLGSTDSYDIYTIHPNGTGLTQLTTSGTNDA---------HAVWTD  614

Query  345  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  178
            D   +L+++ + G   E     N FQPYG +  M  DG     LT   +E+  P +
Sbjct  615  DGR-ILYSSGMYGFREESSLYDNAFQPYGQIMSMNGDGGNKTLLTDTMWEDSMPLY  669



>gb|AHI25037.1| hypothetical protein H845_1092 [Komagataeibacter xylinus E25]
Length=628

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 88/174 (51%), Gaps = 21/174 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            ++ FPS S DG  IV+R     +  L I+D     L     R LT     D +P WSPDG
Sbjct  475  HSGFPSYSADGTQIVYRVWGENNMGLRILD-----LQTRQTRVLTTA--YDNLPGWSPDG  527

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + I F+  R +  N D F+I   RPDG+GL+R+  +GA            H  ++ D   
Sbjct  528  RRIVFT-RRVDDENYDIFTI---RPDGSGLKRLTTSGAND---------GHAVWTGDGR-  573

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            +++++ L G   E     N FQPYG +++M  DG+  + LT + +E+  P + P
Sbjct  574  IMWSSGLYGFRDEAALYDNTFQPYGQIFIMNADGSHKKILTDSLWEDSMPLYVP  627



>ref|WP_025438063.1| hypothetical protein [Komagataeibacter xylinus]
Length=614

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 88/174 (51%), Gaps = 21/174 (12%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            ++ FPS S DG  IV+R     +  L I+D     L     R LT     D +P WSPDG
Sbjct  461  HSGFPSYSADGTQIVYRVWGENNMGLRILD-----LQTRQTRVLTTA--YDNLPGWSPDG  513

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  334
            + I F+  R +  N D F+I   RPDG+GL+R+  +GA            H  ++ D   
Sbjct  514  RRIVFT-RRVDDENYDIFTI---RPDGSGLKRLTTSGAND---------GHAVWTGDGR-  559

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            +++++ L G   E     N FQPYG +++M  DG+  + LT + +E+  P + P
Sbjct  560  IMWSSGLYGFRDEAALYDNTFQPYGQIFIMNADGSHKKILTDSLWEDSMPLYVP  613



>dbj|GAA89133.1| tat pathway signal sequence domain-containing protein [Aspergillus 
kawachii IFO 4308]
Length=687

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 89/185 (48%), Gaps = 20/185 (11%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N+ FPS SPDG  IV+R      +    +  LN     G   QLTDG   D  P WSPDG
Sbjct  517  NSGFPSWSPDGTAIVYRKWSLATEAPLGLHILN--FTTGKTHQLTDG--WDNTPGWSPDG  572

Query  513  KLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  352
            + I F+ N +   +      AD F IY +RPDG+ L R+       ++ ++ +   H  +
Sbjct  573  ERIVFTRNNNWTESYGARWYADRFDIYTIRPDGSELTRV-------TDSLSNDA--HAVW  623

Query  351  SSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
            S D   ++++  + G   E     + FQPYG + +M  DGT    +T   +E+  P + P
Sbjct  624  SQDGR-IMWSTGMYGFKDESALFDDTFQPYGQIMVMNYDGTNKTLVTDTIWEDSMPLYMP  682

Query  171  KAEVD  157
               ++
Sbjct  683  NEYLE  687



>gb|ABX03625.1| WD40 domain protein beta Propeller [Herpetosiphon aurantiacus 
DSM 785]
Length=316

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 17/122 (14%)
 Frame = -3

Query  696  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  517
            G++  PS SPDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPD
Sbjct  125  GDDQSPSWSPDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPD  179

Query  516  GKLIAFSSNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSD  343
            G LIAF+S+R    P   +   +YV++PDG GL+ +       +E   R R  H  +S D
Sbjct  180  GSLIAFTSDRGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPD  229

Query  342  SE  337
            S+
Sbjct  230  SQ  231


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 81/173 (47%), Gaps = 27/173 (16%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  502
            P+ SPDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +A
Sbjct  86   PTWSPDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLA  140

Query  501  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  322
            F SNR   GN +   +Y++  DG+ LR++    A         R     +S D   + FT
Sbjct  141  FQSNRS--GNDE---LYLINRDGSNLRQLTNDPA---------RDWQPSWSPDGSLIAFT  186

Query  321  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
            ++ G  T +  +          LY+++ DG GL+ LT        PAW P ++
Sbjct  187  SDRGAQTPDGWN--------DQLYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  231



>gb|KEQ78669.1| tricorn protease N-terminal domain-containing protein [Aureobasidium 
pullulans EXF-150]
Length=675

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 23/178 (13%)
 Frame = -3

Query  699  TGNNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  526
            T N  FPS SPDG  +V+R  +   G   L+++D     ++ G   QLT G W D  P W
Sbjct  507  TNNAGFPSFSPDGTKLVYRLWNATYGPLGLHVLD-----METGDTTQLTAG-W-DNTPGW  559

Query  525  SPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHV  358
            SPDG+LI F+   +    +    D F I  +RPDGT L+ +  + A  +         H 
Sbjct  560  SPDGELIVFTRQTNWTYGSSWQEDRFDICTIRPDGTDLKILTESEANDA---------HA  610

Query  357  CFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
             +S D   ++++  + G   E V   N FQPYG + +M  DG   + LT + +E+  P
Sbjct  611  VWSFDGR-IMYSTGMYGFRDESVMYDNTFQPYGQIVVMDKDGQNKKMLTDSMWEDSMP  667



>ref|XP_007835900.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
 gb|ETS79275.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
Length=678

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 94/186 (51%), Gaps = 25/186 (13%)
 Frame = -3

Query  699  TGNNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  526
            T N  FPS SPDG  +VFR   G +G   L+++D     ++ G   Q+T+G W D  P W
Sbjct  507  TFNAGFPSFSPDGTKLVFRLWDGENGPLGLHVMD-----METGNTTQITNG-W-DNTPGW  559

Query  525  SPDGKLIAFSSNR---HNPGNA---DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  364
            SPDG+LI F+       + GN    D + I  ++PDGT L+ +  + A  +         
Sbjct  560  SPDGELIVFARQTNWTQDYGNRWYDDRYDIATIKPDGTDLKILTESHANDA---------  610

Query  363  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  184
            H  ++ D   +++ + + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  611  HAVWAPDGR-IMYNSGMHGFRDESPLYDNTFQPYGQIIIMNADGSNKTALTDSMWEDSMP  669

Query  183  AWHPKA  166
             + P++
Sbjct  670  QYIPRS  675



>ref|WP_033378529.1| MULTISPECIES: hypothetical protein, partial [Marinimicrobia]
Length=304

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 95/206 (46%), Gaps = 33/206 (16%)
 Frame = -3

Query  726  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  547
            +I  LT +  G    P  SPDGK I F    +G+ ++Y+ D+      G  +R+LT    
Sbjct  107  QISRLT-QIVGPATSPVFSPDGKKIAFSLTTNGNTDIYVSDT-----HGNNLRRLTQNPG  160

Query  546  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  367
            IDT P+WSP+GK +AF+S+R     +    IY++  DG  +RR+       +      R 
Sbjct  161  IDTSPAWSPNGKSLAFTSDR-----SGSPQIYLMDADGANIRRLTYNNDYNASPAWSPRG  215

Query  366  NHVCFSS-------------DSEWVLFTANLGGVTAEPVSIPNQFQPYG--------DLY  250
            + + + S             D E V    +     A+PV  PN              ++Y
Sbjct  216  DVIAYESQESNGFQIYLITPDGEEVQCITDRTASYADPVWAPNGLHLACASNRTGKWEIY  275

Query  249  MMRLDGTGLQRLTWNGYENGTPAWHP  172
             M LDG+ L+RLT++G  N  PAW P
Sbjct  276  SMYLDGSRLKRLTFSG-NNTQPAWSP  300


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 79/178 (44%), Gaps = 38/178 (21%)
 Frame = -3

Query  681  PSCSPDGKHIVFRS---GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGK  511
            P  SPDGK ++F S    +     L I +  + +     I +LT      T P +SPDGK
Sbjct  74   PDWSPDGKQLIFSSLIPAQHLASQLVIFNFASNQ-----ISRLTQIVGPATSPVFSPDGK  128

Query  510  LIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEW  334
             IAFS   +  GN D   IYV    G  LRR+    G + S            +S + + 
Sbjct  129  KIAFSLTTN--GNTD---IYVSDTHGNNLRRLTQNPGIDTSP----------AWSPNGKS  173

Query  333  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  160
            + FT++  G                 +Y+M  DG  ++RLT+N   N +PAW P+ +V
Sbjct  174  LAFTSDRSGSP--------------QIYLMDADGANIRRLTYNNDYNASPAWSPRGDV  217



>ref|WP_020384321.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=323

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 87/186 (47%), Gaps = 29/186 (16%)
 Frame = -3

Query  720  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  541
            + LTK   G++  PS SPDGK I+F SG+ G++ +Y++ +     DGG    LT+    D
Sbjct  56   RRLTK-NRGDDWSPSWSPDGKRIIFSSGQDGNREIYMMAA-----DGGNQVNLTNSPQED  109

Query  540  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  361
              PSWSPDG+ I FSS R          IYV+  DG   +R+     +G           
Sbjct  110  YSPSWSPDGERIVFSSARE---------IYVMDVDGGNQQRLSQEDQKGYSPSWSPDGKR  160

Query  360  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  181
            + FSS  E   F  + G +T E             +Y+M  DG   QRLT N   +  P+
Sbjct  161  IVFSSQRE-GHFIDDHGHITTE-------------IYVMDADGGNEQRLTENRDNDSGPS  206

Query  180  WHPKAE  163
            W P  +
Sbjct  207  WSPDGK  212


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 83/178 (47%), Gaps = 39/178 (22%)
 Frame = -3

Query  681  PSCSPDGKHIVFRSGRSGH---------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  529
            PS SPDGK IVF S R GH           +Y++D+     DGG  ++LT+    D+ PS
Sbjct  152  PSWSPDGKRIVFSSQREGHFIDDHGHITTEIYVMDA-----DGGNEQRLTENRDNDSGPS  206

Query  528  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  349
            WSPDGK IAFSS  + PGN     IYV+  DG   RR+           N        +S
Sbjct  207  WSPDGKRIAFSS--YKPGNWASLEIYVMDVDGGNPRRL---------TKNHHPDGSPSWS  255

Query  348  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  175
             D + + F+++  G                ++Y+M  DG   +R T +G  +  P W+
Sbjct  256  PDGKRIAFSSSRDG--------------NAEIYVMDADGDNQRRRTEHGGHDDNPVWY  299


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 58/99 (59%), Gaps = 13/99 (13%)
 Frame = -3

Query  705  ETTGNNAFPSCSPDGKHIVFRSGRSGH---KNLYIIDSLNGELDGGGIRQLTDGAWIDTM  535
            E   N++ PS SPDGK I F S + G+     +Y++D     +DGG  R+LT     D  
Sbjct  197  ENRDNDSGPSWSPDGKRIAFSSYKPGNWASLEIYVMD-----VDGGNPRRLTKNHHPDGS  251

Query  534  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRR  418
            PSWSPDGK IAFSS+R   GNA+   IYV+  DG   RR
Sbjct  252  PSWSPDGKRIAFSSSRD--GNAE---IYVMDADGDNQRR  285


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 71/169 (42%), Gaps = 45/169 (27%)
 Frame = -3

Query  657  HIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNP  478
             I F S R+G   +Y++      ++G   R+LT     D  PSWSPDGK I FSS +   
Sbjct  32   QIAFVSDRTGSFEIYVM-----AINGKNQRRLTKNRGDDWSPSWSPDGKRIIFSSGQ---  83

Query  477  GNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR----ERLNHVCFSSDSEWVLFTANLG  310
                            G R I++  A+G  +VN     +      +S D E ++F++   
Sbjct  84   ---------------DGNREIYMMAADGGNQVNLTNSPQEDYSPSWSPDGERIVFSSAR-  127

Query  309  GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  163
                             ++Y+M +DG   QRL+    +  +P+W P  +
Sbjct  128  -----------------EIYVMDVDGGNQQRLSQEDQKGYSPSWSPDGK  159



>gb|EKD68537.1| Periplasmic component of the Tol biopolymer transport system, 
partial [uncultured bacterium]
Length=653

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 64/118 (54%), Gaps = 19/118 (16%)
 Frame = -3

Query  672  SPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSS  493
            SPDG  IVF S R G+  +YI++S     DG G+  LT+ A  DT P++SPDGK I FSS
Sbjct  518  SPDGSKIVFVSDRDGNNEIYIMNS-----DGSGLANLTNNAKNDTDPNFSPDGKKIVFSS  572

Query  492  NRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTA  319
            +R  PG      IY +  DGTGL RI   G    E          C+S D   ++F+A
Sbjct  573  DRDGPGQ-----IYTMNADGTGLARITSGGLNCFEP---------CYSPDGRKIVFSA  616


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = -3

Query  693  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  514
            N+  P+ SPDGK IVF S R G   +Y +++     DG G+ ++T G      P +SPDG
Sbjct  555  NDTDPNFSPDGKKIVFSSDRDGPGQIYTMNA-----DGTGLARITSGGLNCFEPCYSPDG  609

Query  513  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI  415
            + I FS+   +  +   F+   V PDGT  + I
Sbjct  610  RKIVFSAYTSSLSDGGVFT---VNPDGTDPKVI  639


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 65/149 (44%), Gaps = 33/149 (22%)
 Frame = -3

Query  618  LYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRP  439
            +Y+ D       GG +  LT+    D    +SPDG  I F S+R   GN +   IY++  
Sbjct  492  IYVFDKT-----GGSLVNLTNNPAADVTSKFSPDGSKIVFVSDRD--GNNE---IYIMNS  541

Query  438  DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYG  259
            DG+GL  +    A+   + N        FS D + ++F+++  G               G
Sbjct  542  DGSGLANL-TNNAKNDTDPN--------FSPDGKKIVFSSDRDGP--------------G  578

Query  258  DLYMMRLDGTGLQRLTWNGYENGTPAWHP  172
             +Y M  DGTGL R+T  G     P + P
Sbjct  579  QIYTMNADGTGLARITSGGLNCFEPCYSP  607



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1826294691389